Psyllid ID: psy8012


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MGDPYDPYVPYEDHKPIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDFLKNVRSNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFIHEIFKLMANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLAEL
ccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHccHHHHHHHHHcccccccccccccHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccHHHHHHHccccc
cccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHcccHHHHHHHHHccccHHHccccccccHHHHHHHHHHHHHcccHHccccccccccHHHHHcccccccHHHHHHHccccHHHHHHcccccc
mgdpydpyvpyedhkpiaiaIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDFLKNVRSNKYDevkkniedgacinvsSERCGSALIYAAWKGYEEIVDLLLDngadvnfksatgfTALHMACRFHDDDSIVRKLLRHGAyynvvdgktgktpllhagkgarEVNTVLLYFIHEIFKLMANNDTTILDRLDEMKSLILegtkefgpgdynnfsllkvtkndaGETILDIAKKRGFPLLEELEKKLAEL
MGDPYDPYVPYEDHKPIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDFLKnvrsnkydevkkniedgacinvsSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFIHEIFKLMANNDTTILDRLDEMKSLILEGtkefgpgdynNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLAEL
MGDPYDPYVPYEDHKPIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDFLKNVRSNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFIHEIFKLMANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPlleelekklael
*******YVPYEDHKPIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDFLKNVRSNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFIHEIFKLMANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPL***********
**DPYDPYVPYEDHKPIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDFLKNVRSNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFIHEIFKLMANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLAEL
MGDPYDPYVPYEDHKPIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDFLKNVRSNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFIHEIFKLMANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLAEL
**DPYDPYVPYEDHKPIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDFLKNVRSNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFIHEIFKLMANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDPYDPYVPYEDHKPIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDFLKNVRSNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFIHEIFKLMANNDTTILDRLDEMKSLILEGTKEFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLAEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query271 2.2.26 [Sep-21-2011]
Q6NXT1300 Ankyrin repeat domain-con yes N/A 0.361 0.326 0.377 6e-09
Q566C8299 Ankyrin repeat domain-con yes N/A 0.361 0.327 0.377 7e-09
Q91WK7299 Ankyrin repeat domain-con yes N/A 0.361 0.327 0.377 7e-09
Q9GZV1360 Ankyrin repeat domain-con no N/A 0.605 0.455 0.324 8e-09
O90760341 Putative ankyrin repeat p N/A N/A 0.357 0.284 0.386 1e-08
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.571 0.079 0.287 1e-08
Q07E30 475 Ankyrin repeat, SAM and b N/A N/A 0.579 0.330 0.281 1e-08
Q09YN0 475 Ankyrin repeat, SAM and b yes N/A 0.579 0.330 0.291 1e-08
A0M8T3 475 Ankyrin repeat, SAM and b N/A N/A 0.619 0.353 0.298 1e-08
Q8NFD2765 Ankyrin repeat and protei no N/A 0.590 0.209 0.288 1e-08
>sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 Back     alignment and function desciption
 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 63/106 (59%), Gaps = 8/106 (7%)

Query: 77  LKNVR----SNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVN 132
           LK +R    +N  + V++ +EDGA    + ++  +AL +A+  G ++IV LLLD+GAD N
Sbjct: 111 LKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPN 170

Query: 133 FKSATGFTALHM-ACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPL 177
            +   G T LH+ AC  H    ++  LLR GA  + +D + G+TPL
Sbjct: 171 QRDGLGNTPLHLAACTNH--VPVITTLLRGGARVDALD-RAGRTPL 213




Plays an important role in regulating intracellular signaling events associated with erythroid terminal differentiation.
Homo sapiens (taxid: 9606)
>sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 Back     alignment and function description
>sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 Back     alignment and function description
>sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 Back     alignment and function description
>sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=4 SV=1 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 Back     alignment and function description
>sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 Back     alignment and function description
>sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 Back     alignment and function description
>sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
194771252 909 GF19976 [Drosophila ananassae] gi|190617 0.704 0.210 0.303 4e-15
353328688 768 ankyrin repeat domain protein, partial [ 0.830 0.292 0.274 6e-15
321272302 2474 ankyrin repeat protein [Wolbachia endosy 0.704 0.077 0.303 6e-15
225630441 2474 ankyrin repeat domain protein [Wolbachia 0.704 0.077 0.303 6e-15
321272354 2474 ankyrin repeat protein [Wolbachia endosy 0.704 0.077 0.303 7e-15
383858766 2315 PREDICTED: uncharacterized protein LOC10 0.439 0.051 0.410 1e-11
398337377 432 hypothetical protein LkmesMB_18507 [Lept 0.590 0.370 0.354 7e-11
296125273 382 ankyrin [Brachyspira murdochii DSM 12563 0.394 0.280 0.403 4e-10
405977020 1160 Ankyrin-1 [Crassostrea gigas] 0.627 0.146 0.309 6e-10
392935567169 Chain B, Crystal Structure Of A Designed 0.424 0.680 0.398 1e-09
>gi|194771252|ref|XP_001967653.1| GF19976 [Drosophila ananassae] gi|190617400|gb|EDV32924.1| GF19976 [Drosophila ananassae] Back     alignment and taxonomy information
 Score = 88.2 bits (217), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 105/204 (51%), Gaps = 13/204 (6%)

Query: 16  PIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLD 75
           P+ IA   G   +++ L  +GA     +Y+   A  ++    LE+   K + +LL    +
Sbjct: 119 PMHIAANFGYKDVIEVLLKNGA-----VYN---AVDKLCRRPLEMTNDKDVINLLASTEN 170

Query: 76  FLKNVRSNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKS 135
             + V+ N   EV+  I+ GA +N  +    + L YAAWKGY+ +V++LL N A+ N   
Sbjct: 171 LFEAVKRNSSSEVENYIKAGAFVNAKNADSVTPLYYAAWKGYDGVVNILLQNKANPNVVG 230

Query: 136 ATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAGKGAREVNTVLLYFI 195
             GFT LH A +F     +V+ LL +GA YN V   +GKTP   +     +  T L   +
Sbjct: 231 NKGFTPLHYAAKF-SHLKVVKALLSNGAVYNAV-SDSGKTP---SDFTVDKSITSLFKLV 285

Query: 196 HEIFKLMANNDTTILDRLDEMKSL 219
            E FK + + +  +++ L+++K +
Sbjct: 286 SESFKKVKDGNAQVINDLNKIKDI 309




Source: Drosophila ananassae

Species: Drosophila ananassae

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|353328688|ref|ZP_08971015.1| ankyrin repeat domain protein, partial [Wolbachia endosymbiont wVitB of Nasonia vitripennis] Back     alignment and taxonomy information
>gi|321272302|gb|ADW80187.1| ankyrin repeat protein [Wolbachia endosymbiont wVitA of Nasonia vitripennis phage WOVitA1] Back     alignment and taxonomy information
>gi|225630441|ref|YP_002727232.1| ankyrin repeat domain protein [Wolbachia sp. wRi] gi|225592422|gb|ACN95441.1| ankyrin repeat domain protein [Wolbachia sp. wRi] Back     alignment and taxonomy information
>gi|321272354|gb|ADW80235.1| ankyrin repeat protein [Wolbachia endosymbiont wVitB of Nasonia vitripennis phage WOVitB] Back     alignment and taxonomy information
>gi|383858766|ref|XP_003704870.1| PREDICTED: uncharacterized protein LOC100882592 [Megachile rotundata] Back     alignment and taxonomy information
>gi|398337377|ref|ZP_10522082.1| hypothetical protein LkmesMB_18507 [Leptospira kmetyi serovar Malaysia str. Bejo-Iso9] Back     alignment and taxonomy information
>gi|296125273|ref|YP_003632525.1| ankyrin [Brachyspira murdochii DSM 12563] gi|296017089|gb|ADG70326.1| Ankyrin [Brachyspira murdochii DSM 12563] Back     alignment and taxonomy information
>gi|405977020|gb|EKC41492.1| Ankyrin-1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|392935567|pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
UNIPROTKB|Q2KI59151 PSMD10 "Proteasome (Prosome, m 0.435 0.781 0.352 3.7e-09
UNIPROTKB|F1SKL6299 ANKRD54 "Uncharacterized prote 0.409 0.371 0.358 4.8e-09
UNIPROTKB|Q6NXT1300 ANKRD54 "Ankyrin repeat domain 0.409 0.37 0.358 4.8e-09
MGI|MGI:2444209299 Ankrd54 "ankyrin repeat domain 0.409 0.371 0.358 6.3e-09
RGD|1309552299 Ankrd54 "ankyrin repeat domain 0.409 0.371 0.358 6.3e-09
UNIPROTKB|Q566C8299 Ankrd54 "Ankyrin repeat domain 0.409 0.371 0.358 6.3e-09
UNIPROTKB|F1NBL4245 LOC100858286 "Uncharacterized 0.354 0.391 0.386 8.8e-09
UNIPROTKB|O15084 1053 ANKRD28 "Serine/threonine-prot 0.642 0.165 0.314 1.1e-08
ASPGD|ASPL00000628241030 AN1130 [Emericella nidulans (t 0.642 0.168 0.302 1.4e-08
FB|FBgn0011747 1549 Ank "Ankyrin" [Drosophila mela 0.723 0.126 0.281 1.8e-08
UNIPROTKB|Q2KI59 PSMD10 "Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 10" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 138 (53.6 bits), Expect = 3.7e-09, P = 3.7e-09
 Identities = 43/122 (35%), Positives = 63/122 (51%)

Query:    73 NLDFLKNVRSNKYDEVKKNI-EDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADV 131
             NL       S K +E+K+ I  D +    + +   +AL +A   G+ EIV+ LL  G  V
Sbjct:     7 NLMICNLAYSGKLEELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPV 66

Query:   132 NFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHAG-KGAREVNTV 190
             N K   G++ LH+A     D+ IV+ LL  GA  N V+ + G TPL +A  K   E+  +
Sbjct:    67 NDKDDAGWSPLHIAASAGRDE-IVKALLGKGAQVNAVN-QNGCTPLHYAASKNRHEIAVM 124

Query:   191 LL 192
             LL
Sbjct:   125 LL 126




GO:0090201 "negative regulation of release of cytochrome c from mitochondria" evidence=IEA
GO:0070682 "proteasome regulatory particle assembly" evidence=IEA
GO:0045737 "positive regulation of cyclin-dependent protein kinase activity" evidence=IEA
GO:0045111 "intermediate filament cytoskeleton" evidence=IEA
GO:0043518 "negative regulation of DNA damage response, signal transduction by p53 class mediator" evidence=IEA
GO:0043409 "negative regulation of MAPK cascade" evidence=IEA
GO:0043066 "negative regulation of apoptotic process" evidence=IEA
GO:0032088 "negative regulation of NF-kappaB transcription factor activity" evidence=IEA
GO:0031398 "positive regulation of protein ubiquitination" evidence=IEA
GO:0030307 "positive regulation of cell growth" evidence=IEA
GO:0015629 "actin cytoskeleton" evidence=IEA
GO:0008540 "proteasome regulatory particle, base subcomplex" evidence=IEA
GO:0008134 "transcription factor binding" evidence=IEA
GO:0007253 "cytoplasmic sequestering of NF-kappaB" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IEA
UNIPROTKB|F1SKL6 ANKRD54 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NXT1 ANKRD54 "Ankyrin repeat domain-containing protein 54" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444209 Ankrd54 "ankyrin repeat domain 54" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309552 Ankrd54 "ankyrin repeat domain 54" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q566C8 Ankrd54 "Ankyrin repeat domain-containing protein 54" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NBL4 LOC100858286 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O15084 ANKRD28 "Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ASPGD|ASPL0000062824 AN1130 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
FB|FBgn0011747 Ank "Ankyrin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-15
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-11
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-11
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-11
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-11
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-09
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-08
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 6e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-07
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-05
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 6e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-05
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 7e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 8e-04
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.002
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.003
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 80.5 bits (199), Expect = 4e-19
 Identities = 47/114 (41%), Positives = 63/114 (55%), Gaps = 3/114 (2%)

Query: 80  VRSNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGF 139
             +   + VK  +E+GA +N       + L  AA  G+ EIV LLL+ GADVN +   G 
Sbjct: 15  ASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNARDKDGN 74

Query: 140 TALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHA-GKGAREVNTVLL 192
           T LH+A R  + D +V+ LL+HGA  N  D K G+TPL  A   G  EV  +LL
Sbjct: 75  TPLHLAARNGNLD-VVKLLLKHGADVNARD-KDGRTPLHLAAKNGHLEVVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 271
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
KOG4412|consensus226 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
KOG4412|consensus226 100.0
KOG0509|consensus 600 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02859209 ankyrin repeat protein; Provisional 99.98
PHA02878 477 ankyrin repeat protein; Provisional 99.97
KOG0508|consensus 615 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
KOG4177|consensus 1143 99.97
KOG0509|consensus 600 99.96
PHA02792 631 ankyrin-like protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.96
KOG4177|consensus 1143 99.96
PHA02792 631 ankyrin-like protein; Provisional 99.96
PHA02795 437 ankyrin-like protein; Provisional 99.96
PHA02917 661 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PLN03192823 Voltage-dependent potassium channel; Provisional 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.94
KOG0508|consensus 615 99.93
KOG0502|consensus296 99.93
KOG0514|consensus452 99.9
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.89
PHA02741169 hypothetical protein; Provisional 99.89
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.88
KOG0502|consensus296 99.88
KOG0507|consensus 854 99.88
PHA02741169 hypothetical protein; Provisional 99.87
KOG0505|consensus 527 99.87
PHA02884300 ankyrin repeat protein; Provisional 99.87
KOG4369|consensus 2131 99.87
PHA02884300 ankyrin repeat protein; Provisional 99.87
KOG0505|consensus 527 99.87
KOG0514|consensus452 99.86
KOG0512|consensus228 99.86
PHA02736154 Viral ankyrin protein; Provisional 99.85
KOG0507|consensus 854 99.84
KOG0512|consensus228 99.82
PHA02736154 Viral ankyrin protein; Provisional 99.81
KOG4369|consensus 2131 99.78
KOG3676|consensus 782 99.78
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.77
KOG0195|consensus 448 99.76
KOG0195|consensus 448 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.75
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.75
KOG3676|consensus 782 99.69
KOG4214|consensus117 99.61
KOG4214|consensus117 99.61
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.57
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.56
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.52
KOG0515|consensus752 99.5
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.48
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.46
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.46
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.46
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.45
KOG0515|consensus752 99.39
KOG1710|consensus 396 99.37
KOG1710|consensus 396 99.33
PF1360630 Ank_3: Ankyrin repeat 99.07
KOG0818|consensus 669 99.0
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.99
KOG0782|consensus1004 98.97
KOG0782|consensus1004 98.89
KOG0783|consensus 1267 98.88
PF1360630 Ank_3: Ankyrin repeat 98.83
KOG0506|consensus622 98.82
KOG0506|consensus622 98.82
KOG0783|consensus 1267 98.77
KOG0818|consensus 669 98.74
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.73
KOG0705|consensus749 98.7
KOG0522|consensus 560 98.53
KOG0522|consensus 560 98.47
KOG0705|consensus749 98.44
KOG0511|consensus 516 98.31
KOG3609|consensus 822 98.29
KOG3609|consensus 822 98.24
KOG2384|consensus223 98.23
KOG0520|consensus 975 98.22
KOG0521|consensus785 98.17
KOG0511|consensus 516 98.11
KOG0520|consensus 975 98.06
KOG0521|consensus785 98.03
KOG2384|consensus223 97.97
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.55
KOG2505|consensus591 97.01
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.84
KOG2505|consensus591 96.67
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 95.54
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.8
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 94.11
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.82
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 90.7
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 86.06
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.7e-39  Score=276.24  Aligned_cols=186  Identities=27%  Similarity=0.353  Sum_probs=121.3

Q ss_pred             CCCCCCCChHHHHHHhCCHHHHHHHHHCCCCCCchhhcccchHHHHHHHHHHHHhHHHHHHHHHcCcHHHHHHHhcChHH
Q psy8012           8 YVPYEDHKPIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDFLKNVRSNKYDE   87 (271)
Q Consensus         8 ~~~~~g~t~L~~A~~~g~~~~~~~Ll~~g~~~~~~~~~g~t~~~~~l~~A~~~~~~~~~~~L~~~g~~~l~~a~~~~~~~   87 (271)
                      ..+.+|.||||.|++.|+.+++++|++.|++++..+..|.||    ||.|+..|+.+++++|+++|+++-..+......+
T Consensus        30 ~~~~~~~tpL~~A~~~g~~~iv~~Ll~~Ga~~n~~~~~~~t~----L~~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~~~~  105 (434)
T PHA02874         30 ISVDETTTPLIDAIRSGDAKIVELFIKHGADINHINTKIPHP----LLTAIKIGAHDIIKLLIDNGVDTSILPIPCIEKD  105 (434)
T ss_pred             CcCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCH----HHHHHHcCCHHHHHHHHHCCCCCCcchhccCCHH
Confidence            456789999999999999999999999999999999999999    9999999999999999998865422222223334


Q ss_pred             -HHHHHhcCCCCccCCCCCCcHHHHHHHhCCHHHHHHHHHCCCCccccCCCCCcHHHHHHHhCCCHHHHHHHHhCCCCcc
Q psy8012          88 -VKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYN  166 (271)
Q Consensus        88 -~~~ll~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~Ll~~g~~~~  166 (271)
                       ++.+++.|++++.++..|.||||+|+..|+.+++++|++.|++++..+..|.||||+|+.. ++.+++++|++.|++++
T Consensus       106 ~i~~ll~~g~d~n~~~~~g~T~Lh~A~~~~~~~~v~~Ll~~gad~n~~d~~g~tpLh~A~~~-~~~~iv~~Ll~~g~~~n  184 (434)
T PHA02874        106 MIKTILDCGIDVNIKDAELKTFLHYAIKKGDLESIKMLFEYGADVNIEDDNGCYPIHIAIKH-NFFDIIKLLLEKGAYAN  184 (434)
T ss_pred             HHHHHHHCcCCCCCCCCCCccHHHHHHHCCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHC-CcHHHHHHHHHCCCCCC
Confidence             5555555555555555555555555555555555555555555555555555555555554 55555555555555555


Q ss_pred             ccCCCCCCCHHHHH-hcCCchHHHHHHhchhhHH
Q psy8012         167 VVDGKTGKTPLLHA-GKGAREVNTVLLYFIHEIF  199 (271)
Q Consensus       167 ~~~~~~g~tpL~~A-~~~~~~~~~~L~~~g~~~~  199 (271)
                      ..+. .|.||||+| ..|+.+++++|+++|+++.
T Consensus       185 ~~~~-~g~tpL~~A~~~g~~~iv~~Ll~~g~~i~  217 (434)
T PHA02874        185 VKDN-NGESPLHNAAEYGDYACIKLLIDHGNHIM  217 (434)
T ss_pred             CCCC-CCCCHHHHHHHcCCHHHHHHHHhCCCCCc
Confidence            5544 455555555 5555555555555554443



>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-12
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 8e-12
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-11
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-11
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-11
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-11
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-11
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-11
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-11
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-11
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-11
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-11
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 8e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-10
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-10
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-10
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-10
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-10
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 6e-10
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 7e-10
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-09
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-09
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 6e-09
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 9e-09
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-08
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-08
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 3e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-08
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-08
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 5e-08
1uoh_A226 Human Gankyrin Length = 226 6e-08
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-08
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 6e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-07
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 5e-06
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 5e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 6e-05
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 6e-05
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 7e-05
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 8e-05
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 8e-05
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-04
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-04
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-04
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-04
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 4e-04
2xen_A91 Structural Determinants For Improved Thermal Stabil 5e-04
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 7e-04
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 8e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 9e-04
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure

Iteration: 1

Score = 70.1 bits (170), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 47/118 (39%), Positives = 69/118 (58%), Gaps = 3/118 (2%) Query: 76 FLKNVRSNKYDEVKKNIEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKS 135 L+ R+ + DEV+ + +GA +N ++ + L AAW G+ EIV++LL +GADVN + Sbjct: 18 LLEAARAGQDDEVRILMANGADVNAHDDQGSTPLHLAAWIGHPEIVEVLLKHGADVNARD 77 Query: 136 ATGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPL-LHAGKGAREVNTVLL 192 G+T LH+A + IV LL++GA N D G TPL L A +G E+ VLL Sbjct: 78 TDGWTPLHLAAD-NGHLEIVEVLLKYGADVNAQDA-YGLTPLHLAADRGHLEIVEVLL 133
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-21
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-20
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-19
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-21
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-20
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-07
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-17
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-21
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-18
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-05
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-20
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-19
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-16
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-12
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-05
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-20
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-20
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-19
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-19
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-19
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-19
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-18
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-18
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-20
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-18
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-17
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-19
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-19
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-15
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-19
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-19
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-19
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-18
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-19
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-12
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-18
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-18
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-17
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-18
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-15
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-18
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 9e-18
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-17
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-17
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-16
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-16
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-15
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-13
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-17
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-09
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-17
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-04
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-16
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-08
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-04
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-15
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-15
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 6e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-12
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-15
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-08
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-14
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-15
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-15
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-08
2rfa_A232 Transient receptor potential cation channel subfa 6e-14
2rfa_A232 Transient receptor potential cation channel subfa 2e-12
2rfa_A232 Transient receptor potential cation channel subfa 2e-11
2rfa_A232 Transient receptor potential cation channel subfa 3e-04
2etb_A256 Transient receptor potential cation channel subfam 2e-13
2etb_A256 Transient receptor potential cation channel subfam 1e-11
2etb_A256 Transient receptor potential cation channel subfam 1e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-05
2pnn_A273 Transient receptor potential cation channel subfa 1e-11
2pnn_A273 Transient receptor potential cation channel subfa 1e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 9e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-05
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
 Score = 87.5 bits (218), Expect = 2e-21
 Identities = 35/103 (33%), Positives = 48/103 (46%), Gaps = 5/103 (4%)

Query: 92  IEDGACINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRF-HD 150
           +E GA  ++ ++   SAL  A+  GY +IV LLL+   D+N     G T L  A R  H 
Sbjct: 56  LEWGADPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHV 115

Query: 151 DDSIVRKLLRHGAYYNVVDGKTGKTPLLHA-GKGAREVNTVLL 192
               V  LL  GA        +G TP+  A   G R+V  V+ 
Sbjct: 116 K--CVEALLARGADLTTEA-DSGYTPMDLAVALGYRKVQQVIE 155


>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 99.98
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.98
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.98
2rfa_A232 Transient receptor potential cation channel subfa 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.88
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.86
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.85
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.85
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.78
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.74
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
Probab=100.00  E-value=1.1e-42  Score=278.21  Aligned_cols=215  Identities=24%  Similarity=0.256  Sum_probs=168.7

Q ss_pred             CCCCCCCChHHHHHHhC-------------CHHHHHHHHHCCCCCCc-hhhcccchHHHHHHHHHHHHhHHHHHHHHHcC
Q psy8012           8 YVPYEDHKPIAIAIQIG-------------DPQIVKELQNHGAQIDK-EIYSKNKAAARIAHSALELEERKAINDLLRLN   73 (271)
Q Consensus         8 ~~~~~g~t~L~~A~~~g-------------~~~~~~~Ll~~g~~~~~-~~~~g~t~~~~~l~~A~~~~~~~~~~~L~~~g   73 (271)
                      ..|.+|.||||+|+..|             +.+++++|++.|++++. .+..|.||    ||+|+..|+.+++++|+++|
T Consensus         5 ~~d~~g~tpL~~A~~~g~~~~~~~~~~~~~~~~~v~~Ll~~g~~~~~~~d~~g~t~----L~~A~~~g~~~~v~~Ll~~g   80 (253)
T 1yyh_A            5 VRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETA----LHLAARYSRSDAAKRLLEAS   80 (253)
T ss_dssp             -----------------------------------------------CCCTTSCCH----HHHHHHTTCHHHHHHHHHTT
T ss_pred             CCCCCCCcHHHHHHhccccccccchhhcCCChHHHHHHHHccCCcccccCCCCCcH----HHHHHHcCCHHHHHHHHHcC
Confidence            35788999999999987             89999999999999865 47899999    99999999999999999998


Q ss_pred             cHH----------HHHHHhcChHH-HHHHHhcCC-CCccCCCCCCcHHHHHHHhCCHHHHHHHHHCCCCccccCCCCCcH
Q psy8012          74 LDF----------LKNVRSNKYDE-VKKNIEDGA-CINVSSERCGSALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTA  141 (271)
Q Consensus        74 ~~~----------l~~a~~~~~~~-~~~ll~~~~-~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~t~  141 (271)
                      +++          ||+|+..++.+ +++|++.+. +++..+..|.||||+|+..|+.+++++|++.|++++..+..|+||
T Consensus        81 ~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~d~~g~t~  160 (253)
T 1yyh_A           81 ADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSA  160 (253)
T ss_dssp             CCTTCCCTTSCCHHHHHHHHTCHHHHHHHHHSTTSCTTCCCTTCCCHHHHHHHHTCSSHHHHHHHTTCCTTCBCTTSCBH
T ss_pred             CCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCccccCCCCCcHHHHHHHcChHHHHHHHHHcCCCCCCcCCCCCCH
Confidence            765          99999999999 999999987 889999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhCCCHHHHHHHHhCCCCccccCCCCCCCHHHHH-hcCCchHHHHHHhchhhHHHHhhcCCcccccchHHHHHHH
Q psy8012         142 LHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHA-GKGAREVNTVLLYFIHEIFKLMANNDTTILDRLDEMKSLI  220 (271)
Q Consensus       142 l~~a~~~~~~~~~~~~Ll~~g~~~~~~~~~~g~tpL~~A-~~~~~~~~~~L~~~g~~~~~~~~~~~~~~~~~~~~~~~l~  220 (271)
                      ||+|+.. ++.+++++|+++|++++.++. .|.||||+| ..++.+++++|+++|++++                     
T Consensus       161 L~~A~~~-~~~~~v~~Ll~~ga~~~~~~~-~g~tpL~~A~~~~~~~~v~~Ll~~ga~~~---------------------  217 (253)
T 1yyh_A          161 LHWAAAV-NNVDAAVVLLKNGANKDMQNN-REETPLFLAAREGSYETAKVLLDHFANRD---------------------  217 (253)
T ss_dssp             HHHHHHH-TCHHHHHHHHHTTCCTTCCCT-TSCCHHHHHHHHTCHHHHHHHHHTTCCTT---------------------
T ss_pred             HHHHHHc-CCHHHHHHHHHcCCCCCCcCC-CCCCHHHHHHHCCCHHHHHHHHHcCCCcc---------------------
Confidence            9999998 999999999999999999998 899999999 9999999999999998854                     


Q ss_pred             hhccCCCCCCCCCCcccccccccCCCchHHHHHHHhCCCcHHHHHHHHh
Q psy8012         221 LEGTKEFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKLA  269 (271)
Q Consensus       221 ~~~~~~~~~~~~~~~~~~~~~~d~~g~tpl~~A~~~~~~~~~~ll~~~~  269 (271)
                                          .+|..|.||+++|+++|+.+++++|.+.+
T Consensus       218 --------------------~~d~~g~tpl~~A~~~g~~~i~~~l~~~~  246 (253)
T 1yyh_A          218 --------------------ITDHMDRLPRDIAQERMHHDIVRLLDLEH  246 (253)
T ss_dssp             --------------------CCCTTCCCHHHHHHHTTCHHHHHHHHC--
T ss_pred             --------------------ccccCCCCHHHHHHHcCCHHHHHHHHHHh
Confidence                                78999999999999999999999998754



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 271
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-16
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-11
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-11
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-08
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-09
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-04
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-08
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-06
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.002
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-09
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 6e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 8e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 76.6 bits (187), Expect = 1e-16
 Identities = 28/99 (28%), Positives = 40/99 (40%), Gaps = 3/99 (3%)

Query: 108 ALIYAAWKGYEEIVDLLLDNGADVNFKSATGFTALHMACRFHDDDSIVRKLLRHGAYYNV 167
            L  A++ G+  IV  LL  GA  N  +    T LHMA R    + + + LL++ A  N 
Sbjct: 3   PLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTE-VAKYLLQNKAKVNA 61

Query: 168 VDGKTGKTPLLHA-GKGAREVNTVLLYFIHEIFKLMANN 205
              K  +TPL  A   G   +  +LL             
Sbjct: 62  KA-KDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAG 99


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.88
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.88
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=7.5e-38  Score=264.09  Aligned_cols=247  Identities=20%  Similarity=0.248  Sum_probs=197.7

Q ss_pred             CCCCCCCCCCCCCChHHHHHHhCCHHHHHHHHHCCCCCCchhhcccchHHHHHHHHHHHHhHHHHHHHHHcCcHH-----
Q psy8012           2 GDPYDPYVPYEDHKPIAIAIQIGDPQIVKELQNHGAQIDKEIYSKNKAAARIAHSALELEERKAINDLLRLNLDF-----   76 (271)
Q Consensus         2 g~~~~~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~g~~~~~~~~~g~t~~~~~l~~A~~~~~~~~~~~L~~~g~~~-----   76 (271)
                      |.+++ ..|..|.||||+||..|+.+++++|+++|++++.++..|.||    ||+|+..|+.+++++|+..+.++     
T Consensus        23 g~~in-~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~~~~g~t~----L~~A~~~g~~~~~~~Ll~~~~~~~~~~~   97 (408)
T d1n11a_          23 GASPN-VSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTP----LHCAARIGHTNMVKLLLENNANPNLATT   97 (408)
T ss_dssp             TCCSC-CSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCH----HHHHHHHTCHHHHHHHHHHTCCTTCCCT
T ss_pred             CCCCC-CCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCH----HHHHHHcCCHHHHHHHHHhhhccccccc
Confidence            54444 346789999999999999999999999999999999999999    99999999999999988764433     


Q ss_pred             --------------------------------------HHHHHhcChHH-HHHHHhcCCCCccCCCCCCcHHHHHHHhCC
Q psy8012          77 --------------------------------------LKNVRSNKYDE-VKKNIEDGACINVSSERCGSALIYAAWKGY  117 (271)
Q Consensus        77 --------------------------------------l~~a~~~~~~~-~~~ll~~~~~~~~~~~~g~t~l~~a~~~~~  117 (271)
                                                            ++.++..++.+ ++.|++.+++++..+..|.+||++|+..|+
T Consensus        98 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~L~~A~~~~~  177 (408)
T d1n11a_          98 AGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNN  177 (408)
T ss_dssp             TCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTC
T ss_pred             cccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCCCCcCCCcCchHHHHHHHcCC
Confidence                                                  78888888888 999999999999999999999999999999


Q ss_pred             HHHHHHHHHCCCCccccCC-------------------------------------------------------------
Q psy8012         118 EEIVDLLLDNGADVNFKSA-------------------------------------------------------------  136 (271)
Q Consensus       118 ~~~~~~Ll~~~~~~~~~~~-------------------------------------------------------------  136 (271)
                      .+++++|+.+|++++..+.                                                             
T Consensus       178 ~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~  257 (408)
T d1n11a_         178 LDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANG  257 (408)
T ss_dssp             HHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCT
T ss_pred             HHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHHHHhCcHhHhhhhhcccccc
Confidence            9999999988877654332                                                             


Q ss_pred             -----CCCcHHHHHHHhCCCHHHHHHHHhCCCCccccCCCCCCCHHHHH-hcCCchHHHHHHhchhhHHHHhhcCCcccc
Q psy8012         137 -----TGFTALHMACRFHDDDSIVRKLLRHGAYYNVVDGKTGKTPLLHA-GKGAREVNTVLLYFIHEIFKLMANNDTTIL  210 (271)
Q Consensus       137 -----~~~t~l~~a~~~~~~~~~~~~Ll~~g~~~~~~~~~~g~tpL~~A-~~~~~~~~~~L~~~g~~~~~~~~~~~~~~~  210 (271)
                           .|.||++.|+.. ++.+++++|++.|++++..+. .+.||||.+ ..+..++++++++.|++++..+..+.++.+
T Consensus       258 ~~~~~~g~~~l~~a~~~-~~~~i~~~Ll~~g~~~~~~~~-~~~t~L~~~~~~~~~~~~~~ll~~g~~in~~d~~G~T~Lh  335 (408)
T d1n11a_         258 NLGNKSGLTPLHLVAQE-GHVPVADVLIKHGVMVDATTR-MGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLH  335 (408)
T ss_dssp             TCCCTTCCCHHHHHHHH-TCHHHHHHHHHHTCCTTCCCS-SCCCHHHHHHHSSCSHHHHHHHHTTCCTTCCCTTSCCHHH
T ss_pred             ccccCCCCChhhhhhhc-CcHHHHHHHHHCCCccccccc-cccccchhhcccCcceeeeeeccccccccccCCCCCCHHH
Confidence                 333445555554 666777777777777777776 677777777 777777777777777777766554443322


Q ss_pred             -----cchHHHHHHHhhccCCCCCCCCCCcccccccccCCCchHHHHHHHhCCCcHHHHHHHH
Q psy8012         211 -----DRLDEMKSLILEGTKEFGPGDYNNFSLLKVTKNDAGETILDIAKKRGFPLLEELEKKL  268 (271)
Q Consensus       211 -----~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~d~~g~tpl~~A~~~~~~~~~~ll~~~  268 (271)
                           ...+++++|+.+|++             ++.+|..|+||||+|+++|+.+++++|+.+
T Consensus       336 ~A~~~g~~~iv~~Ll~~GAd-------------~n~~d~~G~t~L~~A~~~~~~~iv~~L~~~  385 (408)
T d1n11a_         336 QAAQQGHTDIVTLLLKNGAS-------------PNEVSSDGTTPLAIAKRLGYISVTDVLKVV  385 (408)
T ss_dssp             HHHHTTCHHHHHHHHHTTCC-------------SCCCCSSSCCHHHHHHHTTCHHHHHHHHHH
T ss_pred             HHHHcCCHHHHHHHHHCCCC-------------CCCCCCCCCCHHHHHHHcCCHHHHHHHHHH
Confidence                 358899999999999             778999999999999999999999999754



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure