Psyllid ID: psy8013

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKTFYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPDVSRRSHNETLIAGIESAISDLKNGRAISPFKCHETVKSLYNWVDVSERTEIVYKRVTQEETKSVSEILKW
ccccccccccccHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEccEEEEEEccccccccccHHHHHHcHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHccccccEEEEcccccccccccccccccccccEEEcccccEEEEccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHccc
cccccccccccHHHHHHHHHHHHHHHcccEEEEEEccccccEEEEEcccccEEEEEccHHEEcccccHHHHHHHHHHHHHHHHHccEEEEccHHHHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHcccEEEEEEccccccEEEEEccccccEEEEcccccHHHccccccccccccEEEEEEEEcccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHcc
mvsdffypnvggveEHIFNLSQCLLQRGHKVIVLTHSykdrvgirymtnglkvyycpiktfynqsilptmvcsipLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKtvftdhslfgfadssaivTNKCLEISlagcnhcicvshigkENTVLRARVNHynvsvipnavdttvfvpdvsrrshnETLIAGIESAISdlkngraispfkcheTVKSLYNWVDVSERTEIVYKRVTQEETKSVSEILKW
MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLThsykdrvgiRYMTNGLKVYYCPIKTFYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYnvsvipnavdttvfvpdvsrRSHNETLIAGIESAISDLKNGRAISPFKCHETVKSLynwvdvserTEIVykrvtqeetksvseilkw
MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKTFYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPDVSRRSHNETLIAGIESAISDLKNGRAISPFKCHETVKSLYNWVDVSERTEIVYKRVTQEETKSVSEILKW
***DFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKTFYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPDVSRRSHNETLIAGIESAISDLKNGRAISPFKCHETVKSLYNWVDVSERTEIVYKRV**************
MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKTFYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPDVSRRSHNETLIAGIESAISDLKNGRAISPFKCHETVKSLYNWVDVSERTEIVYKRVTQEETKS*SEILKW
MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKTFYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPDVSRRSHNETLIAGIESAISDLKNGRAISPFKCHETVKSLYNWVDVSERTEIVYKRV**************
*VSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKTFYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPDVSRRSHNETLIAGIESAISDLKNGRAISPFKCHETVKSLYNWVDVSERTEIVYKRVTQEETKSVS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKTFYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPDVSRRSHNETLIAGIESAISDLKNGRAISPFKCHETVKSLYNWVDVSERTEIVYKRVTQEETKSVSEILKW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query252 2.2.26 [Sep-21-2011]
P37287 484 Phosphatidylinositol N-ac yes N/A 0.765 0.398 0.611 6e-67
Q64323 485 N-acetylglucosaminyl-phos yes N/A 0.738 0.383 0.629 6e-67
P87172 456 Phosphatidylinositol N-ac yes N/A 0.746 0.412 0.571 3e-57
A6ZW78 452 Phosphatidylinositol N-ac N/A N/A 0.765 0.426 0.467 4e-49
P32363 452 Phosphatidylinositol N-ac yes N/A 0.642 0.358 0.491 4e-49
B5VSZ6 452 Phosphatidylinositol N-ac N/A N/A 0.642 0.358 0.491 4e-49
B3LKQ3 452 Phosphatidylinositol N-ac N/A N/A 0.642 0.358 0.491 4e-49
>sp|P37287|PIGA_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit A OS=Homo sapiens GN=PIGA PE=1 SV=1 Back     alignment and function desciption
 Score =  253 bits (647), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 118/193 (61%), Positives = 153/193 (79%)

Query: 1   MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKT 60
           MVSDFFYPN+GGVE HI+ LSQCL++RGHKVI++TH+Y +R GIRY+T+GLKVYY P+K 
Sbjct: 37  MVSDFFYPNMGGVESHIYQLSQCLIERGHKVIIVTHAYGNRKGIRYLTSGLKVYYLPLKV 96

Query: 61  FYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSL 120
            YNQS   T+  S+PL+R+I +RE ++I+H HS+FSA+AH+ +  A+ +GL+TVFTDHSL
Sbjct: 97  MYNQSTATTLFHSLPLLRYIFVRERVTIIHSHSSFSAMAHDALFHAKTMGLQTVFTDHSL 156

Query: 121 FGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFV 180
           FGFAD S+++TNK L +SL   NH ICVS+  KENTVLRA +N   VSVIPNAVD T F 
Sbjct: 157 FGFADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFT 216

Query: 181 PDVSRRSHNETLI 193
           PD  RR  + T++
Sbjct: 217 PDPFRRHDSITIV 229
Necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, the very early intermediate in GPI-anchor biosynthesis.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 9EC: 8
>sp|Q64323|PIGA_MOUSE N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein OS=Mus musculus GN=Piga PE=2 SV=1 Back     alignment and function description
>sp|P87172|GPI3_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase gpi3 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi3 PE=3 SV=1 Back     alignment and function description
>sp|A6ZW78|GPI3_YEAS7 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain YJM789) GN=SPT14 PE=3 SV=1 Back     alignment and function description
>sp|P32363|GPI3_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT14 PE=1 SV=4 Back     alignment and function description
>sp|B5VSZ6|GPI3_YEAS6 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SPT14 PE=3 SV=2 Back     alignment and function description
>sp|B3LKQ3|GPI3_YEAS1 Phosphatidylinositol N-acetylglucosaminyltransferase GPI3 subunit OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SPT14 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
380020389 442 PREDICTED: N-acetylglucosaminyl-phosphat 0.75 0.427 0.809 9e-90
66514528 442 PREDICTED: n-acetylglucosaminyl-phosphat 0.75 0.427 0.809 3e-89
340726823 442 PREDICTED: n-acetylglucosaminyl-phosphat 0.75 0.427 0.793 3e-88
350421672 476 PREDICTED: N-acetylglucosaminyl-phosphat 0.75 0.397 0.793 3e-88
345484852 447 PREDICTED: N-acetylglucosaminyl-phosphat 0.75 0.422 0.783 5e-88
328717704 446 PREDICTED: n-acetylglucosaminyl-phosphat 0.765 0.432 0.777 5e-88
307207344 472 N-acetylglucosaminyl-phosphatidylinosito 0.75 0.400 0.788 1e-87
383851262 442 PREDICTED: N-acetylglucosaminyl-phosphat 0.75 0.427 0.783 5e-87
332027776 441 N-acetylglucosaminyl-phosphatidylinosito 0.75 0.428 0.783 8e-87
307177158 444 N-acetylglucosaminyl-phosphatidylinosito 0.75 0.425 0.777 2e-86
>gi|380020389|ref|XP_003694069.1| PREDICTED: N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein-like [Apis florea] Back     alignment and taxonomy information
 Score =  335 bits (859), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 153/189 (80%), Positives = 174/189 (92%)

Query: 1   MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKT 60
           MVSDFFYPN+GGVEEHIFNLSQCLL+RGHKV+VLTHSY DR+GIRYMTNGLKVYY P+K 
Sbjct: 10  MVSDFFYPNMGGVEEHIFNLSQCLLERGHKVVVLTHSYGDRIGIRYMTNGLKVYYIPVKV 69

Query: 61  FYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSL 120
           FYNQ +LPTM+CSIPL+R+I LREEI IVHGHSAFSALAHE M+I RL+GLKT+FTDHSL
Sbjct: 70  FYNQCVLPTMICSIPLIRYIYLREEIQIVHGHSAFSALAHEGMLIGRLMGLKTIFTDHSL 129

Query: 121 FGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFV 180
           FGFAD+SAI+TNK LEISLA CNHCICVSHIGKENTVLRA+V    VSVIPNAVDTT+F+
Sbjct: 130 FGFADASAILTNKFLEISLADCNHCICVSHIGKENTVLRAKVLKEKVSVIPNAVDTTLFM 189

Query: 181 PDVSRRSHN 189
           PD+++R +N
Sbjct: 190 PDINKRDNN 198

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|66514528|ref|XP_397085.2| PREDICTED: n-acetylglucosaminyl-phosphatidylinositol biosynthetic protein-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340726823|ref|XP_003401752.1| PREDICTED: n-acetylglucosaminyl-phosphatidylinositol biosynthetic protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350421672|ref|XP_003492919.1| PREDICTED: N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|345484852|ref|XP_003425136.1| PREDICTED: N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328717704|ref|XP_001950553.2| PREDICTED: n-acetylglucosaminyl-phosphatidylinositol biosynthetic protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307207344|gb|EFN85094.1| N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383851262|ref|XP_003701153.1| PREDICTED: N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332027776|gb|EGI67843.1| N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307177158|gb|EFN66391.1| N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query252
FB|FBgn0034270 479 CG6401 [Drosophila melanogaste 0.761 0.400 0.677 2.2e-78
UNIPROTKB|P37287 484 PIGA "Phosphatidylinositol N-a 0.765 0.398 0.611 1.6e-73
DICTYBASE|DDB_G0283965 523 pigA "phosphatidylinositol gly 0.765 0.369 0.632 7.7e-70
WB|WBGene00008431 444 piga-1 [Caenorhabditis elegans 0.765 0.434 0.572 3.7e-66
TAIR|locus:2096875 447 SETH2 [Arabidopsis thaliana (t 0.742 0.418 0.588 3.3e-65
POMBASE|SPBC3D6.07 456 gpi3 "pig-A, phosphatidylinosi 0.742 0.410 0.577 8.7e-65
UNIPROTKB|F1SQU5 485 PIGA "Uncharacterized protein" 0.845 0.439 0.570 1.2e-63
UNIPROTKB|K7GPP7 449 PIGA "Uncharacterized protein" 0.845 0.474 0.570 1.2e-63
UNIPROTKB|E1B7B9 485 PIGA "Uncharacterized protein" 0.845 0.439 0.570 1.6e-63
UNIPROTKB|F1NHQ4 477 PIGA "Uncharacterized protein" 0.849 0.448 0.563 3.3e-63
FB|FBgn0034270 CG6401 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 702 (252.2 bits), Expect = 2.2e-78, Sum P(2) = 2.2e-78
 Identities = 130/192 (67%), Positives = 155/192 (80%)

Query:     1 MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKT 60
             MVSDFFYP++GGVEEH++NLSQ LL  GHK++VLTH+Y D  GIRY+T  LKVYY PIK 
Sbjct:     5 MVSDFFYPSIGGVEEHVYNLSQMLLSLGHKIVVLTHAYGDCSGIRYVTGYLKVYYLPIKV 64

Query:    61 FYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSL 120
              YNQ ILPT VC++P++R +LLRE + +VHGHSAFSALAHE +M+  LLGLKTVFTDHSL
Sbjct:    65 CYNQCILPTAVCNVPMLRAVLLRERVEVVHGHSAFSALAHEALMVGSLLGLKTVFTDHSL 124

Query:   121 FGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFV 180
             FGFAD SA +TN  LE++L   NH ICVSHIGKENTVLRARV  + VSVIPNAVDT +F 
Sbjct:   125 FGFADLSAALTNNLLEVNLGMVNHAICVSHIGKENTVLRARVAKHRVSVIPNAVDTALFT 184

Query:   181 PDVSRRSHNETL 192
             PD  +R  N+ +
Sbjct:   185 PDPQQRPSNDII 196
GO:0017176 "phosphatidylinositol N-acetylglucosaminyltransferase activity" evidence=ISS
GO:0030176 "integral to endoplasmic reticulum membrane" evidence=ISS
GO:0006506 "GPI anchor biosynthetic process" evidence=ISS
UNIPROTKB|P37287 PIGA "Phosphatidylinositol N-acetylglucosaminyltransferase subunit A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283965 pigA "phosphatidylinositol glycan, class A" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00008431 piga-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
TAIR|locus:2096875 SETH2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
POMBASE|SPBC3D6.07 gpi3 "pig-A, phosphatidylinositol N-acetylglucosaminyltransferase subunit Gpi3 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQU5 PIGA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GPP7 PIGA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7B9 PIGA "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHQ4 PIGA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q64323PIGA_MOUSENo assigned EC number0.62900.73800.3835yesN/A
P37287PIGA_HUMAN2, ., 4, ., 1, ., 1, 9, 80.61130.76580.3987yesN/A
P87172GPI3_SCHPO2, ., 4, ., 1, ., 1, 9, 80.57140.74600.4122yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
cd03796 398 cd03796, GT1_PIG-A_like, This family is most close 1e-122
pfam0828890 pfam08288, PIGA, PIGA (GPI anchor biosynthesis) 3e-53
cd03801 374 cd03801, GT1_YqgM_like, This family is most closel 1e-22
cd03817 374 cd03817, GT1_UGDG_like, This family is most closel 2e-14
pfam13439171 pfam13439, Glyco_transf_4, Glycosyltransferase Fam 1e-13
cd03794 394 cd03794, GT1_wbuB_like, This family is most closel 1e-12
pfam13579158 pfam13579, Glyco_trans_4_4, Glycosyl transferase 4 2e-11
cd03798 377 cd03798, GT1_wlbH_like, This family is most closel 4e-11
cd03796398 cd03796, GT1_PIG-A_like, This family is most close 2e-10
cd03795 357 cd03795, GT1_like_4, This family is most closely r 2e-09
cd03819 355 cd03819, GT1_WavL_like, This family is most closel 4e-08
cd03821 375 cd03821, GT1_Bme6_like, This family is most closel 7e-08
COG0438 381 COG0438, RfaG, Glycosyltransferase [Cell envelope 8e-08
cd03802335 cd03802, GT1_AviGT4_like, This family is most clos 1e-07
cd03811 353 cd03811, GT1_WabH_like, This family is most closel 3e-07
cd03807 365 cd03807, GT1_WbnK_like, This family is most closel 8e-06
cd03800 398 cd03800, GT1_Sucrose_synthase, This family is most 3e-05
cd04955 363 cd04955, GT1_like_6, This family is most closely r 6e-05
cd03812 358 cd03812, GT1_CapH_like, This family is most closel 7e-05
cd01635229 cd01635, Glycosyltransferase_GTB_type, Glycosyltra 1e-04
cd03808 359 cd03808, GT1_cap1E_like, This family is most close 4e-04
cd03799 355 cd03799, GT1_amsK_like, This is a family of GT1 gl 4e-04
cd03823 359 cd03823, GT1_ExpE7_like, This family is most close 0.001
cd03809 365 cd03809, GT1_mtfB_like, This family is most closel 0.001
>gnl|CDD|99970 cd03796, GT1_PIG-A_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information 
 Score =  352 bits (905), Expect = e-122
 Identities = 129/193 (66%), Positives = 157/193 (81%)

Query: 1   MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKT 60
           MVSDFFYPN+GGVE HI+ LSQCL++RGHKV+V+TH+Y +RVGIRY+TNGLKVYY P   
Sbjct: 4   MVSDFFYPNLGGVETHIYQLSQCLIKRGHKVVVITHAYGNRVGIRYLTNGLKVYYLPFVV 63

Query: 61  FYNQSILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSL 120
           FYNQS LPT   + PL+R+IL+RE I+IVHGH AFSALAHE ++ AR +GLKTVFTDHSL
Sbjct: 64  FYNQSTLPTFFGTFPLLRNILIRERITIVHGHQAFSALAHEALLHARTMGLKTVFTDHSL 123

Query: 121 FGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFV 180
           FGFAD+S+I TNK L  SLA  +H ICVSH  KENTVLRA ++   VSVIPNAVD++ F 
Sbjct: 124 FGFADASSIHTNKLLRFSLADVDHVICVSHTSKENTVLRASLDPERVSVIPNAVDSSDFT 183

Query: 181 PDVSRRSHNETLI 193
           PD S+R +++  I
Sbjct: 184 PDPSKRDNDKITI 196

Phosphatidylinositol glycan-class A (PIG-A), an X-linked gene in humans, is necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, a very early intermediate in glycosyl phosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is an important cellular structure that facilitates the attachment of many proteins to cell surfaces. Somatic mutations in PIG-A have been associated with Paroxysmal Nocturnal Hemoglobinuria (PNH), an acquired hematological disorder. Length = 398
>gnl|CDD|191988 pfam08288, PIGA, PIGA (GPI anchor biosynthesis) Back     alignment and domain information
>gnl|CDD|99974 cd03801, GT1_YqgM_like, This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>gnl|CDD|99987 cd03817, GT1_UGDG_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|222130 pfam13439, Glyco_transf_4, Glycosyltransferase Family 4 Back     alignment and domain information
>gnl|CDD|99968 cd03794, GT1_wbuB_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|222237 pfam13579, Glyco_trans_4_4, Glycosyl transferase 4-like domain Back     alignment and domain information
>gnl|CDD|99971 cd03798, GT1_wlbH_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99970 cd03796, GT1_PIG-A_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99969 cd03795, GT1_like_4, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99989 cd03819, GT1_WavL_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99991 cd03821, GT1_Bme6_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|223515 COG0438, RfaG, Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|99975 cd03802, GT1_AviGT4_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99982 cd03811, GT1_WabH_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99979 cd03807, GT1_WbnK_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99973 cd03800, GT1_Sucrose_synthase, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|100001 cd04955, GT1_like_6, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99983 cd03812, GT1_CapH_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99959 cd01635, Glycosyltransferase_GTB_type, Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>gnl|CDD|99980 cd03808, GT1_cap1E_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99972 cd03799, GT1_amsK_like, This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>gnl|CDD|99993 cd03823, GT1_ExpE7_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99981 cd03809, GT1_mtfB_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 252
KOG1111|consensus426 100.0
cd03796398 GT1_PIG-A_like This family is most closely related 100.0
PRK10307 412 putative glycosyl transferase; Provisional 99.95
PF13439177 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 99.94
PLN02871 465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 99.92
TIGR03449 405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 99.92
PF13579160 Glyco_trans_4_4: Glycosyl transferase 4-like domai 99.92
TIGR02472 439 sucr_P_syn_N sucrose-phosphate synthase, putative, 99.91
PRK00654 466 glgA glycogen synthase; Provisional 99.91
TIGR02149 388 glgA_Coryne glycogen synthase, Corynebacterium fam 99.91
TIGR03088 374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 99.9
cd04962 371 GT1_like_5 This family is most closely related to 99.89
TIGR02095 473 glgA glycogen/starch synthases, ADP-glucose type. 99.89
cd03800 398 GT1_Sucrose_synthase This family is most closely r 99.88
cd03791 476 GT1_Glycogen_synthase_DULL1_like This family is mo 99.88
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 99.87
cd04955 363 GT1_like_6 This family is most closely related to 99.86
PLN02316 1036 synthase/transferase 99.86
PRK10125 405 putative glycosyl transferase; Provisional 99.85
cd03802335 GT1_AviGT4_like This family is most closely relate 99.85
PRK14098 489 glycogen synthase; Provisional 99.84
cd03814 364 GT1_like_2 This family is most closely related to 99.84
cd03819 355 GT1_WavL_like This family is most closely related 99.83
cd03794 394 GT1_wbuB_like This family is most closely related 99.83
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.83
cd05844 367 GT1_like_7 Glycosyltransferases catalyze the trans 99.83
cd03795 357 GT1_like_4 This family is most closely related to 99.83
PRK14099 485 glycogen synthase; Provisional 99.83
cd03801 374 GT1_YqgM_like This family is most closely related 99.82
cd03798 377 GT1_wlbH_like This family is most closely related 99.82
cd03807 365 GT1_WbnK_like This family is most closely related 99.82
PRK15427 406 colanic acid biosynthesis glycosyltransferase WcaL 99.82
PF09314185 DUF1972: Domain of unknown function (DUF1972); Int 99.8
cd03825 365 GT1_wcfI_like This family is most closely related 99.8
cd03809 365 GT1_mtfB_like This family is most closely related 99.79
PRK15484 380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 99.79
cd03821 375 GT1_Bme6_like This family is most closely related 99.79
PLN02939 977 transferase, transferring glycosyl groups 99.79
cd04951 360 GT1_WbdM_like This family is most closely related 99.79
PLN02846 462 digalactosyldiacylglycerol synthase 99.78
TIGR02470 784 sucr_synth sucrose synthase. This model represents 99.78
cd03816 415 GT1_ALG1_like This family is most closely related 99.76
cd03823 359 GT1_ExpE7_like This family is most closely related 99.76
cd03817 374 GT1_UGDG_like This family is most closely related 99.75
cd03820 348 GT1_amsD_like This family is most closely related 99.75
cd03799 355 GT1_amsK_like This is a family of GT1 glycosyltran 99.75
cd03822 366 GT1_ecORF704_like This family is most closely rela 99.75
TIGR03087 397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 99.73
PRK15490 578 Vi polysaccharide biosynthesis protein TviE; Provi 99.7
cd03812 358 GT1_CapH_like This family is most closely related 99.7
cd03808 359 GT1_cap1E_like This family is most closely related 99.69
cd03818 396 GT1_ExpC_like This family is most closely related 99.69
PLN00142 815 sucrose synthase 99.69
PLN02275371 transferase, transferring glycosyl groups 99.68
cd03792 372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 99.67
PRK09922 359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 99.67
cd03813 475 GT1_like_3 This family is most closely related to 99.67
cd03805 392 GT1_ALG2_like This family is most closely related 99.66
PRK00726 357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.65
cd03811 353 GT1_WabH_like This family is most closely related 99.64
PF13477139 Glyco_trans_4_2: Glycosyl transferase 4-like 99.62
cd03785 350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.62
cd03806 419 GT1_ALG11_like This family is most closely related 99.57
PLN02949 463 transferase, transferring glycosyl groups 99.5
TIGR01133 348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.5
PF08323245 Glyco_transf_5: Starch synthase catalytic domain; 99.46
COG0297 487 GlgA Glycogen synthase [Carbohydrate transport and 99.45
cd03793 590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 99.4
PF0828890 PIGA: PIGA (GPI anchor biosynthesis); InterPro: IP 99.35
cd04946 407 GT1_AmsK_like This family is most closely related 99.32
PHA01630 331 putative group 1 glycosyl transferase 99.21
cd04950 373 GT1_like_1 Glycosyltransferases catalyze the trans 99.2
cd03804351 GT1_wbaZ_like This family is most closely related 99.09
PLN02501 794 digalactosyldiacylglycerol synthase 99.09
PRK05749 425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 99.06
PF00862550 Sucrose_synth: Sucrose synthase; InterPro: IPR0003 99.05
PRK13609 380 diacylglycerol glucosyltransferase; Provisional 98.87
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 98.86
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 98.83
cd03786 363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 98.8
TIGR00236 365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 98.76
TIGR02918 500 accessory Sec system glycosylation protein GtfA. M 98.69
KOG2941|consensus 444 98.69
PRK12446 352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 98.58
PF12000171 Glyco_trans_4_3: Gkycosyl transferase family 4 gro 98.56
cd04949 372 GT1_gtfA_like This family is most closely related 98.5
PLN02605 382 monogalactosyldiacylglycerol synthase 98.48
KOG1387|consensus 465 98.43
COG0707 357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 98.37
PRK00025 380 lpxB lipid-A-disaccharide synthase; Reviewed 98.37
PF04413186 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid 98.33
PF11997268 DUF3492: Domain of unknown function (DUF3492); Int 98.31
PRK13608 391 diacylglycerol glucosyltransferase; Provisional 98.23
TIGR00215 385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.18
KOG0853|consensus495 98.16
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 98.0
PF05693 633 Glycogen_syn: Glycogen synthase; InterPro: IPR0086 97.83
PF06925169 MGDG_synth: Monogalactosyldiacylglycerol (MGDG) sy 97.64
TIGR00661321 MJ1255 conserved hypothetical protein. This model 97.51
PHA01633 335 putative glycosyl transferase group 1 97.47
PF12038168 DUF3524: Domain of unknown function (DUF3524); Int 97.36
PF02350 346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 97.3
cd03788 460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 97.3
COG1519 419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 97.29
TIGR03568 365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 97.29
COG0381 383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 97.15
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 97.04
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 96.96
TIGR02400 456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 96.94
PF08660170 Alg14: Oligosaccharide biosynthesis protein Alg14 96.8
COG4641 373 Uncharacterized protein conserved in bacteria [Fun 96.68
TIGR03492 396 conserved hypothetical protein. This protein famil 96.64
TIGR02094 601 more_P_ylases alpha-glucan phosphorylases. This fa 96.62
cd03784 401 GT1_Gtf_like This family includes the Gtfs, a grou 96.56
TIGR01426 392 MGT glycosyltransferase, MGT family. This model de 96.33
COG1817 346 Uncharacterized protein conserved in archaea [Func 96.3
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 96.3
PRK10017 426 colanic acid biosynthesis protein; Provisional 95.78
PHA03392 507 egt ecdysteroid UDP-glucosyltransferase; Provision 95.66
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 95.52
PF03033139 Glyco_transf_28: Glycosyltransferase family 28 N-t 95.24
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 94.6
COG4671 400 Predicted glycosyl transferase [General function p 94.01
cd04299 778 GT1_Glycogen_Phosphorylase_like This family is mos 93.05
TIGR02398 487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 92.24
PLN02208 442 glycosyltransferase family protein 91.48
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 91.33
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 90.62
PF02684 373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 90.53
PLN02448 459 UDP-glycosyltransferase family protein 90.24
PRK01021 608 lpxB lipid-A-disaccharide synthase; Reviewed 89.97
COG0569225 TrkA K+ transport systems, NAD-binding component [ 89.77
PLN00016378 RNA-binding protein; Provisional 89.47
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 89.13
COG0380 486 OtsA Trehalose-6-phosphate synthase [Carbohydrate 88.99
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 88.82
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 88.77
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 87.75
COG0763 381 LpxB Lipid A disaccharide synthetase [Cell envelop 87.5
PLN02173 449 UDP-glucosyl transferase family protein 87.06
PLN02670 472 transferase, transferring glycosyl groups 86.96
PRK10117 474 trehalose-6-phosphate synthase; Provisional 86.54
PLN03007 482 UDP-glucosyltransferase family protein 86.36
PLN02210 456 UDP-glucosyl transferase 86.31
PLN00414 446 glycosyltransferase family protein 86.27
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 85.77
TIGR03609298 S_layer_CsaB polysaccharide pyruvyl transferase Cs 85.61
PF11440 355 AGT: DNA alpha-glucosyltransferase; InterPro: IPR0 84.67
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 82.29
PLN02992 481 coniferyl-alcohol glucosyltransferase 81.75
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 81.22
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 80.66
KOG3742|consensus 692 80.11
>KOG1111|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-37  Score=226.55  Aligned_cols=247  Identities=57%  Similarity=0.941  Sum_probs=225.8

Q ss_pred             CCCCCCCCCCCcHHHHHHHHHHHHHHCCcEEEEEeccCCCCcceeeeeCCeEEEEeecccccCCCcccccccchHHHHHH
Q psy8013           1 MVSDFFYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKTFYNQSILPTMVCSIPLVRHI   80 (252)
Q Consensus         1 ~v~~~~~P~~GG~~~~~~~l~~~L~~~G~~V~v~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~l~~~   80 (252)
                      +|+|+|+|..||+|.++.+|++.|.+.||.|.+++..+++..+.+...+|.+++.+|.....+...++..+..++.++.+
T Consensus         5 mVsdff~P~~ggveshiy~lSq~li~lghkVvvithayg~r~girylt~glkVyylp~~v~~n~tT~ptv~~~~Pllr~i   84 (426)
T KOG1111|consen    5 MVSDFFYPSTGGVESHIYALSQCLIRLGHKVVVITHAYGNRVGIRYLTNGLKVYYLPAVVGYNQTTFPTVFSDFPLLRPI   84 (426)
T ss_pred             eeCcccccCCCChhhhHHHhhcchhhcCCeEEEEeccccCccceeeecCCceEEEEeeeeeecccchhhhhccCcccchh
Confidence            68999999999999999999999999999999999998888888888999999999999988888899999999999999


Q ss_pred             HhhCCCcEEEecCchhHHHHHHHHHHHhcCCcEEEEecCCCCCCchhhHHHHHHHHHhhcCCCEEEEechhhhhhHHHhh
Q psy8013          81 LLREEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRA  160 (252)
Q Consensus        81 ~~~~~~Dvvh~~~~~~~~~~~~~~~~~~~~~p~v~~~h~~~~~~~~~~~~~~~~~~~~~~~~d~vi~~S~~~~~~~~~~~  160 (252)
                      +.+++..|||.|+.++.+...+.+.++..|.++|+|-|..+++.+..+.+.+++++..+...|++||+|...+++...+.
T Consensus        85 ~lrE~I~ivhghs~fS~lahe~l~hartMGlktVfTdHSlfGfad~~si~~n~ll~~sL~~id~~IcVshtskentvlr~  164 (426)
T KOG1111|consen   85 LLRERIEIVHGHSPFSYLAHEALMHARTMGLKTVFTDHSLFGFADIGSILTNKLLPLSLANIDRIICVSHTSKENTVLRG  164 (426)
T ss_pred             hhhhceEEEecCChHHHHHHHHHHHHHhcCceEEEeccccccccchhhhhhcceeeeeecCCCcEEEEeecCCCceEEEe
Confidence            99999999999999998888899999999999999999999999999888888888999999999999999999877777


Q ss_pred             ccCCCceEEccCCccCCCCCCCccccccc---------------------------------------------------
Q psy8013         161 RVNHYNVSVIPNAVDTTVFVPDVSRRSHN---------------------------------------------------  189 (252)
Q Consensus       161 ~~~~~~i~vI~ngvd~~~f~~~~~~~~~~---------------------------------------------------  189 (252)
                      .++++++.+|||.++.+.|.|++......                                                   
T Consensus       165 ~L~p~kvsvIPnAv~~~~f~P~~~~~~S~~i~~ivv~sRLvyrKGiDll~~iIp~vc~~~p~vrfii~GDGPk~i~lee~  244 (426)
T KOG1111|consen  165 ALAPAKVSVIPNAVVTHTFTPDAADKPSADIITIVVASRLVYRKGIDLLLEIIPSVCDKHPEVRFIIIGDGPKRIDLEEM  244 (426)
T ss_pred             ccCHhHeeeccceeeccccccCccccCCCCeeEEEEEeeeeeccchHHHHHHHHHHHhcCCCeeEEEecCCcccchHHHH
Confidence            78899999999999999999965433221                                                   


Q ss_pred             ------------------------------------------------------------------------------hh
Q psy8013         190 ------------------------------------------------------------------------------ET  191 (252)
Q Consensus       190 ------------------------------------------------------------------------------~~  191 (252)
                                                                                                    ++
T Consensus       245 lEk~~l~~rV~~lG~v~h~~Vr~vl~~G~IFlntSlTEafc~~ivEAaScGL~VVsTrVGGIpeVLP~d~i~~~~~~~~d  324 (426)
T KOG1111|consen  245 LEKLFLQDRVVMLGTVPHDRVRDVLVRGDIFLNTSLTEAFCMVIVEAASCGLPVVSTRVGGIPEVLPEDMITLGEPGPDD  324 (426)
T ss_pred             HHHhhccCceEEecccchHHHHHHHhcCcEEeccHHHHHHHHHHHHHHhCCCEEEEeecCCccccCCccceeccCCChHH
Confidence                                                                                          88


Q ss_pred             HHHHHHHHHhhccCCCCCChhhhHHHHHhcCChHHHHHHHHHHHHHHhhccccChhhhcC
Q psy8013         192 LIAGIESAISDLKNGRAISPFKCHETVKSLYNWVDVSERTEIVYKRVTQEETKSVSEILK  251 (252)
Q Consensus       192 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~sw~~~a~~~~~~y~~~~~~~~~~~~~~~~  251 (252)
                      +++++.+++.++..    .+...++++++.|+|+++|++++++|.++..++..+..++++
T Consensus       325 l~~~v~~ai~~~~~----~p~~~h~~v~~~y~w~dVa~rTekvy~r~~~t~~~~~~~r~~  380 (426)
T KOG1111|consen  325 LVGAVEKAITKLRT----LPLEFHDRVKKMYSWKDVAERTEKVYDRAATTSIRNEQDRLK  380 (426)
T ss_pred             HHHHHHHHHHHhcc----CchhHHHHHHHhccHHHHHHHHHHHHHHHhhccCcCHHHHHH
Confidence            99999999998876    477899999999999999999999999999998888877765

>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>PF13439 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>PF13579 Glyco_trans_4_4: Glycosyl transferase 4-like domain; PDB: 3C4Q_B 3C4V_A 3C48_B 1Z2T_A Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>PF09314 DUF1972: Domain of unknown function (DUF1972); InterPro: IPR015393 This domain is functionally uncharacterised and found in bacterial glycosyltransferases and rhamnosyltransferases Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13477 Glyco_trans_4_2: Glycosyl transferase 4-like Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>PF08323 Glyco_transf_5: Starch synthase catalytic domain; InterPro: IPR013534 This region represents the catalytic domain of glycogen (or starch) synthases that use ADP-glucose (2 Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>PF08288 PIGA: PIGA (GPI anchor biosynthesis); InterPro: IPR013234 This domain is found on phosphatidylinositol N-acetylglucosaminyltransferase proteins Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>PF00862 Sucrose_synth: Sucrose synthase; InterPro: IPR000368 Sucrose synthases catalyse the synthesis of sucrose 2 Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>KOG2941|consensus Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PF12000 Glyco_trans_4_3: Gkycosyl transferase family 4 group; InterPro: IPR022623 This presumed domain is functionally uncharacterised and found in bacteria Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>KOG1387|consensus Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PF04413 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase); InterPro: IPR007507 This is a domain found in proteins that transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides Back     alignment and domain information
>PF11997 DUF3492: Domain of unknown function (DUF3492); InterPro: IPR022622 This domain is functionally uncharacterised and is found in bacteria, archaea and eukaryotes Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>KOG0853|consensus Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 Back     alignment and domain information
>PF06925 MGDG_synth: Monogalactosyldiacylglycerol (MGDG) synthase; InterPro: IPR009695 This entry represents a conserved region of approximately 180 residues found towirds the N terminus of a number of plant and bacterial diacylglycerol glucosyltransferases, such as monogalactosyldiacylglycerol synthase [] Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PF12038 DUF3524: Domain of unknown function (DUF3524); InterPro: IPR022701 This domain is functionally uncharacterised and is found in bacteria and eukaryotes Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PF08660 Alg14: Oligosaccharide biosynthesis protein Alg14 like; InterPro: IPR013969 Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane [] Back     alignment and domain information
>COG4641 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>PF03033 Glyco_transf_28: Glycosyltransferase family 28 N-terminal domain; InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK10117 trehalose-6-phosphate synthase; Provisional Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03609 S_layer_CsaB polysaccharide pyruvyl transferase CsaB Back     alignment and domain information
>PF11440 AGT: DNA alpha-glucosyltransferase; InterPro: IPR016223 The T4 bacteriophage of E Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>KOG3742|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query252
2jjm_A 394 Glycosyl transferase, group 1 family protein; anth 2e-22
2gek_A 406 Phosphatidylinositol mannosyltransferase (PIMA); G 8e-22
3okp_A 394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 4e-21
2iw1_A 374 Lipopolysaccharide core biosynthesis protein RFAG; 1e-15
3c48_A 438 Predicted glycosyltransferases; retaining glycosyl 4e-15
2r60_A 499 Glycosyl transferase, group 1; rossmann-fold; 1.80 6e-10
2x6q_A 416 Trehalose-synthase TRET; biosynthetic protein; 2.2 9e-09
2iuy_A 342 Avigt4, glycosyltransferase; antibiotics, family G 9e-08
3s28_A 816 Sucrose synthase 1; glycosyltransferase, sucrose m 3e-06
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Length = 394 Back     alignment and structure
 Score = 93.9 bits (234), Expect = 2e-22
 Identities = 35/179 (19%), Positives = 65/179 (36%), Gaps = 6/179 (3%)

Query: 6   FYPNVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGIRYMTNGLKVYYCPIKTFYNQS 65
            YP+VGG       L + L +RGH++  +T     R+   Y    +  +   +  +    
Sbjct: 22  CYPSVGGSGVVGTELGKQLAERGHEIHFITSGLPFRLNKVY--PNIYFHEVTVNQYSVFQ 79

Query: 66  ILPTMVCSIPLVRHILLREEISIVHGHSAFSALAHETMMIARLLG--LKTVFTDHSLFGF 123
             P  +     +  +  RE + I+H H A    A    +  +++G  +K V T H     
Sbjct: 80  YPPYDLALASKMAEVAQRENLDILHVHYAIPH-AICAYLAKQMIGERIKIVTTLHGTDIT 138

Query: 124 ADSSAIVTNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPD 182
              S    N  +   +   +    VSH     T       + ++  + N +D  V+   
Sbjct: 139 VLGSDPSLNNLIRFGIEQSDVVTAVSHSLINET-HELVKPNKDIQTVYNFIDERVYFKR 196
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Length = 406 Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Length = 394 Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Length = 374 Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Length = 438 Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Length = 499 Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Length = 416 Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Length = 342 Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Length = 816 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
3fro_A 439 GLGA glycogen synthase; glycosyltransferase family 99.94
2jjm_A 394 Glycosyl transferase, group 1 family protein; anth 99.94
3c48_A 438 Predicted glycosyltransferases; retaining glycosyl 99.93
2r60_A 499 Glycosyl transferase, group 1; rossmann-fold; 1.80 99.92
3okp_A 394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 99.9
3vue_A 536 GBSS-I, granule-bound starch synthase 1, chloropla 99.9
3s28_A 816 Sucrose synthase 1; glycosyltransferase, sucrose m 99.89
1rzu_A 485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 99.89
2qzs_A 485 Glycogen synthase; glycosyl-transferase, GT-B fold 99.88
2gek_A 406 Phosphatidylinositol mannosyltransferase (PIMA); G 99.88
2iw1_A 374 Lipopolysaccharide core biosynthesis protein RFAG; 99.83
2iuy_A 342 Avigt4, glycosyltransferase; antibiotics, family G 99.81
2x6q_A 416 Trehalose-synthase TRET; biosynthetic protein; 2.2 99.75
3oy2_A 413 Glycosyltransferase B736L; rossmann fold, GDP-mann 99.72
2x0d_A 413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 99.54
1f0k_A 364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.51
2hy7_A 406 Glucuronosyltransferase GUMK; glycosyltransferases 99.5
1vgv_A 384 UDP-N-acetylglucosamine 2-epimerase; structural ge 99.28
3beo_A 375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 99.24
1v4v_A 376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 99.11
3s2u_A 365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.05
3otg_A 412 CALG1; calicheamicin, TDP, structural genomics, PS 99.0
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.97
3nb0_A 725 Glycogen [starch] synthase isoform 2; glycogen syn 98.95
2xci_A 374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 98.71
3dzc_A 396 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.62
3ot5_A 403 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.52
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 98.33
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 98.3
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 98.3
4hwg_A 385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 98.15
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 98.12
3tsa_A 391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 98.1
4fzr_A 398 SSFS6; structural genomics, PSI-biology, protein s 97.99
3oti_A 398 CALG3; calicheamicin, TDP, structural genomics, PS 97.92
2p6p_A 384 Glycosyl transferase; X-RAY-diffraction,urdamycina 97.87
1uqt_A 482 Alpha, alpha-trehalose-phosphate synthase; glycosy 97.84
3h4t_A 404 Glycosyltransferase GTFA, glycosyltransferase; van 97.46
3t5t_A 496 Putative glycosyltransferase; GTB fold, pseudoglyc 97.29
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 97.07
4amg_A 400 Snogd; transferase, polyketide biosynthesis, GT1 f 96.83
2yjn_A 441 ERYCIII, glycosyltransferase; transferase, cytochr 96.76
1rrv_A 416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 96.58
1iir_A 415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 95.88
2acv_A 463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 94.7
2pq6_A 482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 93.71
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 93.57
2c4m_A 796 Glycogen phosphorylase; allosteric control, phosph 92.88
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen syn 92.02
1l5w_A 796 Maltodextrin phosphorylase; enzymatic catalysis, s 91.16
2gj4_A 824 Glycogen phosphorylase, muscle form; transferase; 89.45
1xv5_A 401 AGT, DNA alpha-glucosyltransferase; HET: DNA CME U 88.67
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosy 88.22
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 87.55
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 86.6
3av3_A212 Phosphoribosylglycinamide formyltransferase; struc 85.08
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 82.94
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 81.58
2yvq_A143 Carbamoyl-phosphate synthase; conserved hypothetic 81.52
3hbf_A 454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 81.12
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 80.65
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 80.58
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
Probab=99.94  E-value=8.4e-25  Score=174.39  Aligned_cols=180  Identities=19%  Similarity=0.126  Sum_probs=125.4

Q ss_pred             CCCCCCCC-CCCcHHHHHHHHHHHHHHCCcEEEEEeccCCCCcce-----------------eeeeCCeEEEEeeccccc
Q psy8013           1 MVSDFFYP-NVGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGI-----------------RYMTNGLKVYYCPIKTFY   62 (252)
Q Consensus         1 ~v~~~~~P-~~GG~~~~~~~l~~~L~~~G~~V~v~~~~~~~~~~~-----------------~~~~~~~~v~~~~~~~~~   62 (252)
                      ++++.|+| ..||+++++.+|+++|.++||+|+|+++..+.....                 .....|+++++++.....
T Consensus         7 ~v~~~~~p~~~gG~~~~~~~la~~L~~~G~~V~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gv~v~~~~~~~~~   86 (439)
T 3fro_A            7 LLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVKVSYEERGNLRIYRIGGGLLD   86 (439)
T ss_dssp             EECSCCTTSCSSSHHHHHHHHHHHHHHTTCEEEEEEECTTCSCCEEEEEEEETTEEEEEEEEEEEETTEEEEEEESGGGG
T ss_pred             EEecccCCcccCCHHHHHHHHHHHHHHCCCeEEEEecCCCCchhhhhccccccCcccceeeeeccCCCceEEEecchhcc
Confidence            36777877 899999999999999999999999999875443211                 115688999999872211


Q ss_pred             CCCccc--------ccccchHHHHHHHh-----hCCCcEEEecCchhHHHHHHHHHHHhcCCcEEEEecCCCCCCchhhH
Q psy8013          63 NQSILP--------TMVCSIPLVRHILL-----REEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAI  129 (252)
Q Consensus        63 ~~~~~~--------~~~~~~~~l~~~~~-----~~~~Dvvh~~~~~~~~~~~~~~~~~~~~~p~v~~~h~~~~~~~~~~~  129 (252)
                      ....+.        ........+.++++     ..+|||||+|.+...+.  +..+++..++|+|++.|+.+........
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dii~~~~~~~~~~--~~~~~~~~~~~~v~~~h~~~~~~~~~~~  164 (439)
T 3fro_A           87 SEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREEPLPDVVHFHDWHTVFA--GALIKKYFKIPAVFTIHRLNKSKLPAFY  164 (439)
T ss_dssp             CSSTTCSHHHHHHHHHHHHHHHHHHHHHHHTTTSCCCSEEEEESGGGHHH--HHHHHHHHCCCEEEEESCCCCCCEEHHH
T ss_pred             ccccccCCcchhhhhhHHHHHHHHHHHHHHhccCCCCeEEEecchhhhhh--HHHHhhccCCCEEEEecccccccCchHH
Confidence            111111        01111122233333     45999999998766443  5666788899999999998643211111


Q ss_pred             H------------HHHHHHHhhcCCCEEEEechhhhhhHHHhhccCCCceEEccCCccCCCCCCC
Q psy8013         130 V------------TNKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPD  182 (252)
Q Consensus       130 ~------------~~~~~~~~~~~~d~vi~~S~~~~~~~~~~~~~~~~~i~vI~ngvd~~~f~~~  182 (252)
                      +            ...+.+..++.+|.++++|+..++.....++.+..++.+||||+|.+.|.+.
T Consensus       165 ~~~~~~~~~~~~~~~~~~~~~~~~ad~ii~~S~~~~~~~~~~~~~~~~~i~vi~ngvd~~~~~~~  229 (439)
T 3fro_A          165 FHEAGLSELAPYPDIDPEHTGGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNES  229 (439)
T ss_dssp             HHHTTCGGGCCSSEECHHHHHHHHCSEEEESCHHHHHHTHHHHGGGTTSEEECCCCCCTTTSCGG
T ss_pred             hCccccccccccceeeHhhhhhhhccEEEecCHHHHHHHhhhhhhcCCceeecCCCCCchhcCcc
Confidence            0            1144677788899999999999887555556778999999999999988765
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae} Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A* Back     alignment and structure
>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ... Back     alignment and structure
>1xv5_A AGT, DNA alpha-glucosyltransferase; HET: DNA CME UDP; 1.73A {Enterobacteria phage T4} PDB: 1y6f_A* 1y6g_A* 1ya6_A* 1y8z_A* Back     alignment and structure
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2yvq_A Carbamoyl-phosphate synthase; conserved hypothetical protein, structural genomics, NPPSFA; 1.98A {Homo sapiens} Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 252
d2bisa1 437 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyro 1e-09
d1rzua_ 477 c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacte 9e-08
d2iw1a1 370 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynt 2e-07
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Length = 437 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: Glycogen synthase 1, GlgA
species: Pyrococcus abyssi [TaxId: 29292]

 Score = 55.6 bits (132), Expect = 1e-09
 Identities = 37/233 (15%), Positives = 72/233 (30%), Gaps = 45/233 (19%)

Query: 1   MVSDFFYPN-VGGVEEHIFNLSQCLLQRGHKVIVLTHSYKD----------------RVG 43
           ++   F P  VGG+ E +  +S+ L   GH+V+V T S+                  +V 
Sbjct: 5   LLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVK 64

Query: 44  IRY-MTNGLKVYYCPIKTFYNQSILPTM-------------VCSIPLVRHILLREEISIV 89
           + Y     L++Y        ++ +                    + L   +       +V
Sbjct: 65  VSYEERGNLRIYRIGGGLLDSEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREEPLPDVV 124

Query: 90  HGHSAFSALAHETMMIARLLGLKTVFTDHSLF------------GFADSSAIVTNKCLEI 137
           H H   +  A    +I +   +  VFT H L             G ++ +          
Sbjct: 125 HFHDWHTVFAG--ALIKKYFKIPAVFTIHRLNKSKLPAFYFHEAGLSELAPYPDIDPEHT 182

Query: 138 SLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPDVSRRSHNE 190
                +    VS     +     R     ++ + N +D + +       S +E
Sbjct: 183 GGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNESYLTGSRDE 235
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Length = 477 Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Length = 370 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query252
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.93
d1rzua_ 477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 99.91
d2iw1a1 370 Lipopolysaccharide core biosynthesis protein RfaG 99.72
d1uqta_ 456 Trehalose-6-phosphate synthase, OtsA {Escherichia 97.32
d1o6ca_ 377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 97.26
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 97.19
d1v4va_ 373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 97.14
d1f6da_ 376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 97.04
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 96.15
d1rrva_ 401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 96.06
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 93.23
d2c1xa1 450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 92.58
d2pq6a1 473 (Iso)flavonoid glycosyltransferase {Medicago trunc 92.54
d2acva1 461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 92.0
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 90.75
d2vcha1 471 Hydroquinone glucosyltransferase {Thale cress (Ara 89.58
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 87.64
d1uana_227 Hypothetical protein TT1542 {Thermus thermophilus 87.17
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 86.37
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 86.19
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 84.1
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 84.0
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 83.35
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 83.11
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 82.77
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 82.48
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 82.11
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 81.49
d2d1pa1128 tRNA 2-thiouridine synthesizing protein D, TusD {E 81.33
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 81.21
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 80.28
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: Glycogen synthase 1, GlgA
species: Pyrococcus abyssi [TaxId: 29292]

Probab=99.93  E-value=1.1e-23  Score=165.86  Aligned_cols=180  Identities=19%  Similarity=0.164  Sum_probs=116.3

Q ss_pred             CCCCCCCCC-CCcHHHHHHHHHHHHHHCCcEEEEEeccCCCCcce-----------------eeeeCCeEEEEeeccccc
Q psy8013           1 MVSDFFYPN-VGGVEEHIFNLSQCLLQRGHKVIVLTHSYKDRVGI-----------------RYMTNGLKVYYCPIKTFY   62 (252)
Q Consensus         1 ~v~~~~~P~-~GG~~~~~~~l~~~L~~~G~~V~v~~~~~~~~~~~-----------------~~~~~~~~v~~~~~~~~~   62 (252)
                      ++|..|||. .||+++++..|+++|+++||+|+|+++..+.....                 .....++.++++......
T Consensus         5 ~~~~~~pP~~~GG~~~~~~~La~~L~~~Gh~V~Vvtp~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   84 (437)
T d2bisa1           5 LLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVKVSYEERGNLRIYRIGGGLLD   84 (437)
T ss_dssp             EECSCCTTCCSSSHHHHHHHHHHHHHHTTCEEEEEEECTTSSCCEEEEEEECSSSEEEEEEEEEEETTEEEEEEESSGGG
T ss_pred             EECCccCCcccCCHHHHHHHHHHHHHHcCCEEEEEecCCCccchhhccceeecccccceeeeeeccCCeEEEecCccccc
Confidence            468889998 79999999999999999999999999754321111                 012344555555432221


Q ss_pred             CCCccc-cc---c--------cchHHHHHHHh-hCCCcEEEecCchhHHHHHHHHHHHhcCCcEEEEecCCCCCCchhhH
Q psy8013          63 NQSILP-TM---V--------CSIPLVRHILL-REEISIVHGHSAFSALAHETMMIARLLGLKTVFTDHSLFGFADSSAI  129 (252)
Q Consensus        63 ~~~~~~-~~---~--------~~~~~l~~~~~-~~~~Dvvh~~~~~~~~~~~~~~~~~~~~~p~v~~~h~~~~~~~~~~~  129 (252)
                      ...... ..   .        .....+..+++ ...|||||+|.+...+.  +..+++..++|+|++.|+..........
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pDiIh~~~~~~~~~--~~~~~~~~~~~~v~~~h~~~~~~~~~~~  162 (437)
T d2bisa1          85 SEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREEPLPDVVHFHDWHTVFA--GALIKKYFKIPAVFTIHRLNKSKLPAFY  162 (437)
T ss_dssp             CSCTTCSHHHHHHHHHHHHHHHHHHHHHHHTTSSCCCSEEEEETGGGHHH--HHHHHHHHCCCEEEEESSCCCCCEEHHH
T ss_pred             cccccccchhhHHHHHHHHHHHHHHHHHHHHhcCCCCCEEEECChhhhhH--hhhhhccccCceeEEEeeccccccchhh
Confidence            111100 00   0        00112223333 34689999998876554  6777888899999999997542211111


Q ss_pred             HH------------HHHHHHhhcCCCEEEEechhhhhhHHHhhccCCCceEEccCCccCCCCCCC
Q psy8013         130 VT------------NKCLEISLAGCNHCICVSHIGKENTVLRARVNHYNVSVIPNAVDTTVFVPD  182 (252)
Q Consensus       130 ~~------------~~~~~~~~~~~d~vi~~S~~~~~~~~~~~~~~~~~i~vI~ngvd~~~f~~~  182 (252)
                      +.            ....+.....+|.+++++.....+....++....++.+||||+|.+.|.+.
T Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~d~v~~~~~~~~~~~~~~~~~~~~ki~vi~~g~d~~~~~~~  227 (437)
T d2bisa1         163 FHEAGLSELAPYPDIDPEHTGGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNES  227 (437)
T ss_dssp             HHHTTCGGGCCSSEECHHHHHHHHSSEEEESCHHHHHHTHHHHGGGTTTEEECCCCCCTTTSCGG
T ss_pred             hhhccchhhhhHHHHHHHHHHHHhhhhhcccchhhhhhhhhhhccccCceEEEeccccccccccc
Confidence            10            011334455699999999988876656666778899999999999988764
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1pa1 c.114.1.1 (A:1-128) tRNA 2-thiouridine synthesizing protein D, TusD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure