Psyllid ID: psy8073

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590---
MSDLQLEELFKTCDKKGTGQIGPEEFRELCTGFDIQPTDSDAIFADLDHDGDGKVSLEDFAYGFREFLNSDARRLKSNVNAGAMSSEGPERRNSDVQNAWSLLLAGIGEANVHKFLNTSGKKLADLYHELRTSSNCPEIVTHFEGALSSLLDDVKRLHEDNEKLEEMFNREREVHLERLKGLEEELDVQVAKVVTQAKEEARAKYEQEKAILMRKMEHETQELQAHLNLFQKVNNVLKEKKIEKQQDPTSDHNFSFENEELKITLEKTKNNLDLVHAEMAQLKSEYEGKCQELNQLVGDYLELDQGSDKQFAIQRLMEDIDSGRSTMRDCMDCSSDYKSNNEENMSSLSEYDYNKRDYPELRRQHSNKSDSQSTPLLSLSNSLEPTGEPDRAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHVYVFIPCVYLKDLPYTSVLIFIPFQKQISDIFDSP
cccHHHHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHcccccccHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccEEEEEEEEccccccHHHHHHHHccccccccccccccccccEEEEEEccEEEEEEEEccccccHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHccccccccHHHHHHHHHHHcccEEEccccccccHHHHHHHHHHHHHHHcccccccccccccEEEccccccccccccccc
cccHcHHHHHHHHcccccccccHHHHHHHHccccccccHHHHHHHHHcccccccEEHHHHHHHHHHHHHccccccccccccccccccccccccccHcHHccccEEEEccccHcccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHHccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccEEEEEEEEEcccccHHHHHHHHHHccccccccccccEEEEEEEEEEccEEEEEEEEEEcccHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHccccccEEccHHHHHHHHHHccccEEEcccHHcccHHHHHHHHHHHHHHHHcHcHccccccccccccccccccEEEccccc
MSDLQLEELFKTCdkkgtgqigpeefrelctgfdiqptdsdaifadldhdgdgkvsLEDFAYGFREFLNSDARRLKSNvnagamssegperrnsdVQNAWSLLLAGIGEANVHKFLNTSGKKLADLYHELrtssncpeiVTHFEGALSSLLDDVKRLHEDNEKLEEMFNREREVHLERLKGLEEELDVQVAKVVTQAKEEARAKYEQEKAILMRKMEHETQELQAHLNLFQKVNNVLKEKkiekqqdptsdhnfsfeNEELKITLEKTKNNLDLVHAEMAQLKSEYEGKCQELNQLVGDYleldqgsdKQFAIQRLMEDIdsgrstmrdcmdcssdyksnneenmsslseydynkrdypelrrqhsnksdsqstpllslsnsleptgepdrafKIVFAGDAAVGKSCFIYRFSKEVFLNKLgstlgvdfqmktIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVtensipivicANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHVYVFIpcvylkdlpytsvlifipfqkqisdifdsp
MSDLQLEELFktcdkkgtgqigpEEFRELCTGFDIQPTDSDAIFADLDHDGDGKVSLEDFAYGFREFLNSDARRLKSNVNagamssegperrnSDVQNAWSLLLAGIGEANVHKFLNTSGKKLADLYHELRTSSNCPEIVTHFEGALSSLLDDVKRLHEDNEKLEEMFNREREVHLERLkgleeeldVQVAKVVTQAKEEARAKYEQEKAILMRKMEHETQELQAHLNLFQKVNNVLKEKKiekqqdptsdhnfsFENEELKITLEKTKNNLDLVHAEMAQLKSEYEGKCQELNQLVGDYLELDQGSDKQFAIQRLMEdidsgrstmrDCMDCSSdyksnneenmsslSEYDYNKRDYPELRRqhsnksdsqstpllsLSNSLEPTGEPDRAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEevtensipiviCANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHVYVFIPCVYLKDLPYTSVLIFIPFQKQISDIFDSP
MSDLQLEELFKTCDKKGTGQIGPEEFRELCTGFDIQPTDSDAIFADLDHDGDGKVSLEDFAYGFREFLNSDARRLKSNVNAGAMSSEGPERRNSDVQNAWSLLLAGIGEANVHKFLNTSGKKLADLYHELRTSSNCPEIVTHFEGALSSLLDDVKRLHEDNEKLEEMFNREREVHLERLKGLEEELDVQVAKVVTQAKEEARAKYEQEKAILMRKMEHETQELQAHLNLFQKVNNVLKEKKIEKQQDPTSDHNFSFENEELKITLEKTKNNLDLVHAEMAQLKSEYEGKCQELNQLVGDYLELDQGSDKQFAIQRLMEDIDSGRSTMRDCMDCSSDYKsnneenmsslseYDYNKRDYPELRRQHSNKSDSQSTPLLSLSNSLEPTGEPDRAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHVYVFIPCVYLKDLPYTSVLIFIPFQKQISDIFDSP
********************IGPEEFRELCTGFDIQPTDSDAIFADLDHDGDGKVSLEDFAYGFREFLN****************************NAWSLLLAGIGEANVHKFLNTSGKKLADLYHELRTSSNCPEIVTHFEGALSSLLDDV*******************************LDVQVAKVV******************************AHLNLFQKVNN***********************************NLDLVHAEMAQLKSEYEGKCQELNQLVGDYLELDQ*****FAI******************************************************************************AFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHVYVFIPCVYLKDLPYTSVLIFIPFQKQISDI****
***LQLEELFKTCDKKGTGQIGPEEFRELCTGFDIQPTDSDAIFADLDHDGDGKVSLEDFAYGF******************************************************SGKKLADLYH**R***********FEGALSSLL************************************************************************************************************************************************************************************************************************************************AFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHVY*********************************
MSDLQLEELFKTCDKKGTGQIGPEEFRELCTGFDIQPTDSDAIFADLDHDGDGKVSLEDFAYGFREFLNSDARRLKSNVNA*************DVQNAWSLLLAGIGEANVHKFLNTSGKKLADLYHELRTSSNCPEIVTHFEGALSSLLDDVKRLHEDNEKLEEMFNREREVHLERLKGLEEELDVQVAKVVTQAKEEARAKYEQEKAILMRKMEHETQELQAHLNLFQKVNNVLKEKKI********DHNFSFENEELKITLEKTKNNLDLVHAEMAQLKSEYEGKCQELNQLVGDYLELDQGSDKQFAIQRLMEDIDSGRSTMRDCMDCSSDYKSNNEENMSSLSEYDYNKRDYPEL***************LSLSNSLEPTGEPDRAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHVYVFIPCVYLKDLPYTSVLIFIPFQKQISDIFDSP
*SDLQLEELFKTCDKKGTGQIGPEEFRELCTGFDIQPTDSDAIFADLDHDGDGKVSLEDFAYGFREFLNSD*******************RRNSDVQNAWSLLLAGIGEANVHKFLNTSGKKLADLYHELRTSSNCPEIVTHFEGALSSLLDDVKRLHEDNEKLEEMFNREREVHLERLKGLEEELDVQVAKVVTQAKEEARAKYEQEKAILMRKMEHETQELQAHLNLFQKVNNVLKEKKIEKQQDPTSDHNFSFENEELKITLEKTKNNLDLVHAEMAQLKSEYEGKCQELNQLVGDYLELDQGSDKQFAIQRLMEDIDSGR*************************************************************TGEPDRAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHVYVFIPCV***************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDLQLEELFKTCDKKGTGQIGPEEFRELCTGFDIQPTDSDAIFADLDHDGDGKVSLEDFAYGFREFLNSDARRLKSNVNAGAMSSEGPERRNSDVQNAWSLLLAGIGEANVHKFLNTSGKKLADLYHELRTSSNCPEIVTHFEGAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLDVQVAKVVxxxxxxxxxxxxxxxxxxxxxxxxxxxxLQAHLNLFQKVNNVLKEKKIEKQQDPTSDHNFSFExxxxxxxxxxxxxxxxxxxxxxxxxxxxYEGKCQELNQLVGDYLELDQGSDKQFAIQRLMEDIDSGRSTMRDCMDCSSDYKSNNEENMSSLSEYDYNKRDYPELRRQHSNKSDSQSTPLLSLSNSLEPTGEPDRAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHVYVFIPCVYLKDLPYTSVLIFIPFQKQISDIFDSP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query593 2.2.26 [Sep-21-2011]
Q22908656 Ras and EF-hand domain-co yes N/A 0.922 0.833 0.308 2e-68
Q619T5634 Ras and EF-hand domain-co N/A N/A 0.920 0.861 0.308 6e-66
Q5RI75627 Ras and EF-hand domain-co yes N/A 0.401 0.379 0.450 7e-54
Q8IZ41740 Ras and EF-hand domain-co yes N/A 0.231 0.185 0.550 5e-52
Q08CX1722 Ras and EF-hand domain-co yes N/A 0.404 0.332 0.423 2e-51
A5WW21663 Ras and EF-hand domain-co no N/A 0.279 0.250 0.511 4e-44
P70550207 Ras-related protein Rab-8 no N/A 0.276 0.792 0.441 2e-40
P61028207 Ras-related protein Rab-8 no N/A 0.276 0.792 0.441 2e-40
Q5REC9207 Ras-related protein Rab-8 no N/A 0.276 0.792 0.441 2e-40
Q92930207 Ras-related protein Rab-8 no N/A 0.276 0.792 0.441 3e-40
>sp|Q22908|RASEF_CAEEL Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis elegans GN=tag-312 PE=3 SV=2 Back     alignment and function desciption
 Score =  261 bits (666), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 196/636 (30%), Positives = 310/636 (48%), Gaps = 89/636 (13%)

Query: 1   MSDLQLEELFKTCDKKGTGQIGPEEFRELCTGFDIQPTDSDAIFADLDHDGDGKVSLEDF 60
           MS  ++E LF  CD +  G +  E+ R++C   D    D   IF +LD DG GK+   +F
Sbjct: 1   MSKPEVENLFSLCDSESKGYLTMEDLRKVCPQLD--DNDLRFIFTELDQDGSGKIEKLEF 58

Query: 61  AYGFREF--------LNSDARRLKSNVNAGAM--------------SSEGPERRNSDVQN 98
             GF++         LN   RR    V    M              +S  P  R  D ++
Sbjct: 59  LRGFQDTVQHGESHGLNGMQRRASVAVEDPPMFLRDEQMFDSESDSTSSRPAIRVFDEEH 118

Query: 99  AWSLLLAGIGEANVH-KFLNTSGKKLADLYHELRTSSNCPEIVTHFEGALSSLLDDVKRL 157
             S       + N++  F     +++  LY +L+ SS  P ++  FE  + S   ++   
Sbjct: 119 YHSE-----SDTNINIDFSVPCQEEVLVLYEQLQ-SSGVPALLRKFERVVGSFHKELSEK 172

Query: 158 HEDNEKLEEMFNREREVHLERLKGLEEELDVQVAKVVTQAKEEARAKYEQEKAILMRKME 217
             +NE+L+ ++  ERE++  R++ +E E+D Q+     +A++E R +  +EK  + ++M 
Sbjct: 173 KHENERLQRIYASEREMYNRRMEEMESEVDQQLELTEMKARQEERDRLTKEKEEMRQRMS 232

Query: 218 HETQELQAHLNLFQKVNNVL-KEKKIEKQQDPTSDH--NFSFENEELKITLEKTKNNLDL 274
            E  E++ ++   QK+   L +E +    Q   SD     + EN +L+  L +    L +
Sbjct: 233 DEMSEMRNNIERLQKMEKALERENERLNHQKELSDKLKVVNEENNDLRQNLAENHLELAM 292

Query: 275 VHAEMAQLKSEYEGKCQELNQLVGDYLELDQGSDKQFAIQ--RLMEDIDSGRSTMRDCMD 332
           + +E+AQ++ E++ K  EL+   G   +L+  +    + Q     E+ +S R  ++   D
Sbjct: 293 IKSELAQVRCEFDQKQDELSARRGILFQLEPINSLSSSDQASHATEESESVRKQLQLLFD 352

Query: 333 CSSDYKSNNEENMSSLSEYDYNKRDY------PELRRQHSNKSDS--------QSTPLLS 378
            +      NE    +L       R +      P L   + N  ++        +S PL +
Sbjct: 353 ANRKLHETNESLRDALDSRASVLRQFNLRTPSPGLLSSNRNSVENFQTSTNVFRSVPLHA 412

Query: 379 LSNSLEPT-----------------------------------GEPDRAFKIVFAGDAAV 403
           +S   + T                                   G  +R F+IV  GDAAV
Sbjct: 413 ISTEEQGTIFGTIEEKTSLILDDAHSLQGLDTPGDLMGLNDANGPAERTFRIVMCGDAAV 472

Query: 404 GKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFR 463
           GKS F+ R  +  F N+L STLGVDF +KT+ VD RNVALQLWDTAGQERFRS+ K+YFR
Sbjct: 473 GKSSFVMRVIRRQFTNQLPSTLGVDFHVKTVNVDGRNVALQLWDTAGQERFRSLCKSYFR 532

Query: 464 RADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDR 523
           RADG +L+YDV  E+SF  V++W+E ++E TE SIPI++  NKVD+R        K    
Sbjct: 533 RADGAILVYDVCAEQSFLRVRDWIETIKESTERSIPIILVGNKVDMRISTPGSVAKTD-- 590

Query: 524 EVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHV 559
             G  +A   G +FMETS+  G NI +A++AL+R +
Sbjct: 591 --GASMAAAMGVLFMETSALDGSNIDNAMLALTREL 624
May bind GTP and GDP.
Caenorhabditis elegans (taxid: 6239)
>sp|Q619T5|RASEF_CAEBR Ras and EF-hand domain-containing protein homolog OS=Caenorhabditis briggsae GN=tag-312 PE=3 SV=1 Back     alignment and function description
>sp|Q5RI75|RASEF_MOUSE Ras and EF-hand domain-containing protein homolog OS=Mus musculus GN=Rasef PE=2 SV=1 Back     alignment and function description
>sp|Q8IZ41|RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens GN=RASEF PE=1 SV=1 Back     alignment and function description
>sp|Q08CX1|RASEF_XENTR Ras and EF-hand domain-containing protein OS=Xenopus tropicalis GN=rasef PE=2 SV=1 Back     alignment and function description
>sp|A5WW21|RASEF_DANRE Ras and EF-hand domain-containing protein OS=Danio rerio GN=rasef PE=2 SV=1 Back     alignment and function description
>sp|P70550|RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 Back     alignment and function description
>sp|P61028|RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 Back     alignment and function description
>sp|Q5REC9|RAB8B_PONAB Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 Back     alignment and function description
>sp|Q92930|RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query593
328700247582 PREDICTED: ras and EF-hand domain-contai 0.919 0.936 0.541 1e-164
341874611632 CBN-TAG-312 protein [Caenorhabditis bren 0.922 0.865 0.305 8e-67
17550768656 Protein TAG-312 [Caenorhabditis elegans] 0.922 0.833 0.308 1e-66
399163173633 rab-45, partial [Caenorhabditis elegans] 0.919 0.860 0.314 2e-66
268578667634 C. briggsae CBR-TAG-312 protein [Caenorh 0.920 0.861 0.308 4e-64
195996203630 hypothetical protein TRIADDRAFT_51991 [T 0.902 0.849 0.328 4e-62
390332103 750 PREDICTED: ras and EF-hand domain-contai 0.322 0.254 0.548 3e-59
390332107 776 PREDICTED: ras and EF-hand domain-contai 0.322 0.246 0.548 5e-59
390332105 790 PREDICTED: ras and EF-hand domain-contai 0.322 0.241 0.548 5e-59
308512109650 CRE-TAG-312 protein [Caenorhabditis rema 0.912 0.832 0.295 2e-57
>gi|328700247|ref|XP_001948288.2| PREDICTED: ras and EF-hand domain-containing protein homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 310/573 (54%), Positives = 412/573 (71%), Gaps = 28/573 (4%)

Query: 1   MSDLQLEELFKTCDKKGTGQIGPEEFRELCTGFDIQPTDSDAIFADLDHDGDGKVSLEDF 60
           MSD+ LE+LF  CD+ G G+IGPEEF+ELC  FDI+P+DSD IF+DLD DGDG++ LEDF
Sbjct: 1   MSDVHLEDLFYECDRNGQGKIGPEEFQELCAKFDIEPSDSDVIFSDLDRDGDGQICLEDF 60

Query: 61  AYGFREFLNSDARRLKSNVNAGAMSSEGP-ERRNSDVQNAWSLLLAGIGEANVHKFLNTS 119
           A+GFR+FL S  ++ K N N     + G  ERRNS    AWS  ++ IGE  + K  +TS
Sbjct: 61  AWGFRDFL-SPGKQDKPNEN----RTRGELERRNS---QAWSNFVSVIGEPALKKLFHTS 112

Query: 120 GKKLADLYHELRTSSNCPEIVTHFEGALSSLLDDVKRLHEDNEKLEEMFNREREVHLERL 179
           GKKLADLY E++  S   E++THFEGALSSL++DVKRLHEDNEKLE MFNRER+ HL RL
Sbjct: 113 GKKLADLYMEIQNCSPSSELITHFEGALSSLMEDVKRLHEDNEKLESMFNRERQTHLTRL 172

Query: 180 KGLEEELDVQVAKVVTQAKEEARAKYEQEKAILMRKMEHETQELQAHLNLFQKVNNVLKE 239
           +GLEEE+D QVAKV  QA++EAR ++E EK  LM+KME ET EL+ HL LFQKVN VL +
Sbjct: 173 RGLEEEIDAQVAKVEAQARDEAREQFEFEKKELMKKMEAETIELKTHLKLFQKVNTVLSQ 232

Query: 240 KKIEKQ-QDPTSDHNFSFENEELKITLEKTKNNLDLVHAEMAQLKSEYEGKCQELNQLVG 298
           KK++K   D T +     E+ EL+  L  T+ NL +V +EM +L+SEYE KC+E N  + 
Sbjct: 233 KKVDKNDMDETIE-----ESRELRRKLIDTQTNLAVVRSEMEKLRSEYEIKCEEFNNTMQ 287

Query: 299 DYLE-LDQGSDKQFAIQRLMEDIDSGRSTMRDCMDCSSDYKSNNEENMSSLSEYD--YNK 355
             ++ L++ S  Q+ I+RLM+DIDSGRST+   ++ ++ Y+ + ++ +S+ S  +  Y+ 
Sbjct: 288 VNIDPLEEQSGAQYTIKRLMDDIDSGRSTL---IESNNYYQRDLQDELSNASSINAPYHS 344

Query: 356 RDYPELRRQHSNKSDSQS-----TPL--LSLSNSLEPTGEPDRAFKIVFAGDAAVGKSCF 408
               E      +  DSQ+     TP   +S+S+     G+P+R +KIVFAGDAAVGK+CF
Sbjct: 345 AKTIEFEEMSLSGRDSQNMMHFHTPASAMSISSYDMIGGDPERTYKIVFAGDAAVGKTCF 404

Query: 409 IYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGV 468
           I+RF K  F  KLGSTLGVDFQ+KTIRVD+RNVALQLWDTAGQERFRS+TK YFRRADGV
Sbjct: 405 IHRFCKGTFTTKLGSTLGVDFQVKTIRVDDRNVALQLWDTAGQERFRSITKAYFRRADGV 464

Query: 469 MLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEK 528
           +LLYDVTNERSF +++ WV ++ EV +  +P+ IC NK+DLR +A+ +G+ C+  + GE 
Sbjct: 465 ILLYDVTNERSFINIRQWVLSITEVADKQLPLCICGNKLDLRREAELQGLTCVSTDHGEL 524

Query: 529 LAQQYGAIFMETSSKSGDNILDALIALSRHVYV 561
           LA+ Y A+F ETSSK G NI +AL+ L R + +
Sbjct: 525 LAKDYNAVFFETSSKLGTNINNALVTLCREMLI 557

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|341874611|gb|EGT30546.1| CBN-TAG-312 protein [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|17550768|ref|NP_508523.1| Protein TAG-312 [Caenorhabditis elegans] gi|74966415|sp|Q22908.2|RASEF_CAEEL RecName: Full=Ras and EF-hand domain-containing protein homolog; Flags: Precursor gi|373254121|emb|CCD66473.1| Protein TAG-312 [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|399163173|gb|AFP33162.1| rab-45, partial [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|268578667|ref|XP_002644316.1| C. briggsae CBR-TAG-312 protein [Caenorhabditis briggsae] gi|74790193|sp|Q619T5.1|RASEF_CAEBR RecName: Full=Ras and EF-hand domain-containing protein homolog; Flags: Precursor Back     alignment and taxonomy information
>gi|195996203|ref|XP_002107970.1| hypothetical protein TRIADDRAFT_51991 [Trichoplax adhaerens] gi|190588746|gb|EDV28768.1| hypothetical protein TRIADDRAFT_51991 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|390332103|ref|XP_785593.3| PREDICTED: ras and EF-hand domain-containing protein homolog isoform 3 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|390332107|ref|XP_003723420.1| PREDICTED: ras and EF-hand domain-containing protein homolog isoform 2 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|390332105|ref|XP_003723419.1| PREDICTED: ras and EF-hand domain-containing protein homolog isoform 1 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|308512109|ref|XP_003118237.1| CRE-TAG-312 protein [Caenorhabditis remanei] gi|308238883|gb|EFO82835.1| CRE-TAG-312 protein [Caenorhabditis remanei] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query593
UNIPROTKB|Q8IZ41740 RASEF "Ras and EF-hand domain- 0.327 0.262 0.505 6.2e-76
UNIPROTKB|A7Z031740 RASEF "Uncharacterized protein 0.327 0.262 0.525 6.1e-75
ZFIN|ZDB-GENE-081105-157706 rasef "RAS and EF-hand domain 0.286 0.240 0.570 1.2e-68
ZFIN|ZDB-GENE-070424-92663 zgc:162879 "zgc:162879" [Danio 0.308 0.276 0.481 1.5e-65
MGI|MGI:2448565627 Rasef "RAS and EF hand domain 0.301 0.285 0.546 2.9e-64
UNIPROTKB|E2RKF3818 RASEF "Uncharacterized protein 0.634 0.459 0.343 1.2e-61
UNIPROTKB|F1P2F8629 F1P2F8 "Uncharacterized protei 0.261 0.246 0.535 2.9e-54
UNIPROTKB|E2RDZ0718 EFCAB4B "Uncharacterized prote 0.293 0.242 0.444 1.2e-52
ZFIN|ZDB-GENE-041210-94773 efcab4bb "EF-hand calcium bind 0.279 0.214 0.383 1.4e-49
WB|WBGene00016344656 tag-312 [Caenorhabditis elegan 0.655 0.592 0.322 4.2e-47
UNIPROTKB|Q8IZ41 RASEF "Ras and EF-hand domain-containing protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 510 (184.6 bits), Expect = 6.2e-76, Sum P(3) = 6.2e-76
 Identities = 98/194 (50%), Positives = 132/194 (68%)

Query:   366 SNKSDSQSTPLLSLSNSLEPTGEPDRAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTL 425
             S K  S  +P   L +    +    +A+KIV AGDAAVGKS F+ R  K  F   + +TL
Sbjct:   515 SRKPISALSPQTDLVDDNAKSFSSQKAYKIVLAGDAAVGKSSFLMRLCKNEFRENISATL 574

Query:   426 GVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKN 485
             GVDFQMKT+ VD     LQLWDTAGQERFRS+ K+YFR+ADGV+LLYDVT E+SF +++ 
Sbjct:   575 GVDFQMKTLIVDGERTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNIRE 634

Query:   486 WVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSG 545
             WV+ +E+    ++PI++  NK D+R  A  +G KC+    GEKLA  YGA+F ETS+K G
Sbjct:   635 WVDMIEDAAHETVPIMLVGNKADIRDTAATEGQKCVPGHFGEKLAMTYGALFCETSAKDG 694

Query:   546 DNILDALIALSRHV 559
              NI++A++ L+R V
Sbjct:   695 SNIVEAVLHLAREV 708
GO:0005509 "calcium ion binding" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0015031 "protein transport" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0048471 "perinuclear region of cytoplasm" evidence=IEA
UNIPROTKB|A7Z031 RASEF "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081105-157 rasef "RAS and EF-hand domain containing" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070424-92 zgc:162879 "zgc:162879" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:2448565 Rasef "RAS and EF hand domain containing" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKF3 RASEF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2F8 F1P2F8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDZ0 EFCAB4B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041210-94 efcab4bb "EF-hand calcium binding domain 4Bb" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00016344 tag-312 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q22908RASEF_CAEELNo assigned EC number0.30810.92240.8338yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 2e-68
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 9e-64
pfam00071162 pfam00071, Ras, Ras family 2e-60
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 1e-53
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 1e-48
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 3e-48
cd01861161 cd01861, Rab6, Rab GTPase family 6 (Rab6) 2e-47
cd01868165 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)- 9e-46
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 2e-45
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 4e-45
cd01864165 cd01864, Rab19, Rab GTPase family 19 (Rab19) 8e-45
cd04123162 cd04123, Rab21, Rab GTPase family 21 (Rab21) 2e-44
cd01866168 cd01866, Rab2, Rab GTPase family 2 (Rab2) 5e-42
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 8e-42
cd04112191 cd04112, Rab26, Rab GTPase family 26 (Rab26) 1e-41
cd04117164 cd04117, Rab15, Rab GTPase family 15 (Rab15) 7e-41
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 1e-39
cd04122166 cd04122, Rab14, Rab GTPase family 14 (Rab14) 4e-39
cd04115170 cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu 8e-39
PLN03108210 PLN03108, PLN03108, Rab family protein; Provisiona 1e-37
cd01865165 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, 2e-37
cd04107201 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 8e-37
cd00876160 cd00876, Ras, Rat sarcoma (Ras) family of small gu 1e-35
cd01862172 cd01862, Rab7, Rab GTPase family 7 (Rab7) 2e-35
cd04106162 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)- 3e-35
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 2e-33
PLN03110216 PLN03110, PLN03110, Rab GTPase; Provisional 2e-33
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 3e-33
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 2e-32
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 3e-31
smart00010166 smart00010, small_GTPase, Small GTPase of the Ras 4e-31
smart00173164 smart00173, RAS, Ras subfamily of RAS small GTPase 5e-31
cd00157171 cd00157, Rho, Ras homology family (Rho) of small g 2e-30
PLN03118211 PLN03118, PLN03118, Rab family protein; Provisiona 2e-29
cd04118193 cd04118, Rab24, Rab GTPase family 24 (Rab24) 2e-29
cd04120202 cd04120, Rab12, Rab GTPase family 12 (Rab12) 3e-28
cd04116170 cd04116, Rab9, Rab GTPase family 9 (Rab9) 4e-27
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 1e-26
cd04108170 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 3e-26
smart00174174 smart00174, RHO, Rho (Ras homology) subfamily of R 6e-25
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 7e-25
cd04177168 cd04177, RSR1, RSR1/Bud1p family GTPase 1e-24
cd04176163 cd04176, Rap2, Rap2 family GTPase consists of Rap2 3e-24
cd00877166 cd00877, Ran, Ras-related nuclear proteins (Ran)/T 4e-24
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 6e-24
cd04175164 cd04175, Rap1, Rap1 family GTPase consists of Rap1 6e-24
cd04101167 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like 2e-23
cd04138162 cd04138, H_N_K_Ras_like, Ras GTPase family contain 2e-23
cd04136164 cd04136, Rap_like, Rap-like family consists of Rap 6e-23
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-22
cd04121189 cd04121, Rab40, Rab GTPase family 40 (Rab40) conta 2e-22
cd04139163 cd04139, RalA_RalB, Ral (Ras-like) family containi 9e-22
cd04141172 cd04141, Rit_Rin_Ric, Ras-like protein in all tiss 1e-21
PTZ00132215 PTZ00132, PTZ00132, GTP-binding nuclear protein Ra 1e-21
cd04137180 cd04137, RheB, Ras Homolog Enriched in Brain (RheB 7e-21
cd04146166 cd04146, RERG_RasL11_like, Ras-related and Estroge 1e-20
cd04132197 cd04132, Rho4_like, Ras homology family 4 (Rho4) o 2e-20
cd04145164 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 4e-20
cd04124161 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like 1e-19
PTZ00369189 PTZ00369, PTZ00369, Ras-like protein; Provisional 1e-19
PLN03071219 PLN03071, PLN03071, GTP-binding nuclear protein Ra 2e-19
cd04129190 cd04129, Rho2, Ras homology family 2 (Rho2) of sma 1e-18
cd01870175 cd01870, RhoA_like, Ras homology family A (RhoA)-l 1e-18
smart00176200 smart00176, RAN, Ran (Ras-related nuclear proteins 1e-17
cd04144190 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small 7e-17
cd04147197 cd04147, Ras_dva, Ras - dorsal-ventral anterior lo 1e-16
cd04133173 cd04133, Rop_like, Rho-related protein from plants 2e-16
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 2e-15
pfam08477116 pfam08477, Miro, Miro-like protein 2e-15
cd09914161 cd09914, RocCOR, Ras of complex proteins (Roc) C-t 8e-15
cd01875191 cd01875, RhoG, Ras homolog family, member G (RhoG) 9e-15
cd04134185 cd04134, Rho3, Ras homology family 3 (Rho3) of sma 1e-14
cd04131176 cd04131, Rnd, Rho family GTPase subfamily Rnd incl 1e-14
cd04130173 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (W 3e-14
cd04135174 cd04135, Tc10, Rho GTPase TC10 (Tc10) 4e-14
cd01871174 cd01871, Rac1_like, Ras-related C3 botulinum toxin 4e-14
cd04140165 cd04140, ARHI_like, A Ras homolog member I (ARHI) 8e-14
cd04128182 cd04128, Spg1, Septum-promoting GTPase (Spg1) 1e-13
cd01874175 cd01874, Cdc42, cell division cycle 42 (Cdc42) is 4e-13
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 5e-13
cd04148219 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfam 9e-13
cd04126220 cd04126, Rab20, Rab GTPase family 20 (Rab20) 4e-12
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 4e-12
cd04152183 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) 4e-12
cd04173221 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases 5e-11
cd04172182 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases 2e-10
cd01893168 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1) 3e-10
COG2229187 COG2229, COG2229, Predicted GTPase [General functi 1e-09
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 2e-09
cd04102204 cd04102, RabL3, Rab GTPase-like family 3 (Rab-like 2e-09
cd01873195 cd01873, RhoBTB, RhoBTB protein is an atypical mem 1e-08
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 1e-08
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 1e-08
cd04143247 cd04143, Rhes_like, Ras homolog enriched in striat 1e-08
cd04174232 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases 7e-08
cd04160168 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) 1e-07
PLN00023334 PLN00023, PLN00023, GTP-binding protein; Provision 1e-07
PTZ00133182 PTZ00133, PTZ00133, ADP-ribosylation factor; Provi 5e-07
cd04154173 cd04154, Arl2, Arf-like 2 (Arl2) GTPase 6e-07
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 7e-07
smart00177175 smart00177, ARF, ARF-like small GTPases; ARF, ADP- 7e-07
cd04157162 cd04157, Arl6, Arf-like 6 (Arl6) GTPase 1e-06
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-06
cd04150159 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A 3e-06
cd00879191 cd00879, Sar1, Sar1 is an essential component of C 7e-06
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 1e-05
PLN00223181 PLN00223, PLN00223, ADP-ribosylation factor; Provi 1e-05
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 2e-05
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 3e-05
cd04149168 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) 5e-05
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 6e-04
cd04158169 cd04158, ARD1, (ADP-ribosylation factor domain pro 8e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 8e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
cd04161167 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (A 0.002
cd04151158 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) 0.002
smart00178184 smart00178, SAR, Sar1p-like members of the Ras-fam 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
PRK12309391 PRK12309, PRK12309, transaldolase/EF-hand domain-c 0.004
COG5185622 COG5185, HEC1, Protein involved in chromosome segr 0.004
pfam09731493 pfam09731, Mitofilin, Mitochondrial inner membrane 0.004
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information 
 Score =  218 bits (557), Expect = 2e-68
 Identities = 72/165 (43%), Positives = 107/165 (64%), Gaps = 6/165 (3%)

Query: 393 FKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQE 452
           FKIV  GD+ VGK+  + RF    F     ST+GVDF+ KTI VD + V LQ+WDTAGQE
Sbjct: 1   FKIVLIGDSGVGKTSLLLRFVDNKFSENYKSTIGVDFKSKTIEVDGKKVKLQIWDTAGQE 60

Query: 453 RFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRAD 512
           RFRS+T +Y+R A G +L+YDVTN  SF ++  W+  ++E    +IPI++  NK DL  +
Sbjct: 61  RFRSITSSYYRGAHGAILVYDVTNRESFENLDKWLNELKEYAPPNIPIILVGNKSDLEDE 120

Query: 513 AQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSR 557
                 + +  E  ++ A++ G +F ETS+K+G+N+ +A  +L+R
Sbjct: 121 ------RQVSTEEAQQFAKENGLLFFETSAKTGENVDEAFESLAR 159

Rab GTPases form the largest family within the Ras superfamily. There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways. The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which mask C-terminal lipid binding and promote cytosolic localization. While most unicellular organisms possess 5-20 Rab members, several have been found to possess 60 or more Rabs; for many of these Rab isoforms, homologous proteins are not found in other organisms. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Since crystal structures often lack C-terminal residues, the lipid modification site is not available for annotation in many of the CDs in the hierarchy, but is included where possible. Length = 159
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) Back     alignment and domain information
>gnl|CDD|206660 cd01868, Rab11_like, Rab GTPase family 11 (Rab11)-like includes Rab11a, Rab11b, and Rab25 Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) Back     alignment and domain information
>gnl|CDD|133323 cd04123, Rab21, Rab GTPase family 21 (Rab21) Back     alignment and domain information
>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) Back     alignment and domain information
>gnl|CDD|206698 cd04117, Rab15, Rab GTPase family 15 (Rab15) Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information
>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) Back     alignment and domain information
>gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B Back     alignment and domain information
>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D Back     alignment and domain information
>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) Back     alignment and domain information
>gnl|CDD|206642 cd00876, Ras, Rat sarcoma (Ras) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206655 cd01862, Rab7, Rab GTPase family 7 (Rab7) Back     alignment and domain information
>gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|178657 PLN03110, PLN03110, Rab GTPase; Provisional Back     alignment and domain information
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|197466 smart00010, small_GTPase, Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>gnl|CDD|214541 smart00173, RAS, Ras subfamily of RAS small GTPases Back     alignment and domain information
>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|133318 cd04118, Rab24, Rab GTPase family 24 (Rab24) Back     alignment and domain information
>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) Back     alignment and domain information
>gnl|CDD|206697 cd04116, Rab9, Rab GTPase family 9 (Rab9) Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information
>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) Back     alignment and domain information
>gnl|CDD|197554 smart00174, RHO, Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase Back     alignment and domain information
>gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c Back     alignment and domain information
>gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|133375 cd04175, Rap1, Rap1 family GTPase consists of Rap1a and Rap1b isoforms Back     alignment and domain information
>gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4) Back     alignment and domain information
>gnl|CDD|133338 cd04138, H_N_K_Ras_like, Ras GTPase family containing H-Ras,N-Ras and K-Ras4A/4B Back     alignment and domain information
>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|133321 cd04121, Rab40, Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c Back     alignment and domain information
>gnl|CDD|206710 cd04139, RalA_RalB, Ral (Ras-like) family containing highly homologous RalA and RalB Back     alignment and domain information
>gnl|CDD|206712 cd04141, Rit_Rin_Ric, Ras-like protein in all tissues (Rit), Ras-like protein in neurons (Rin) and Ras-related protein which interacts with calmodulin (Ric) Back     alignment and domain information
>gnl|CDD|240284 PTZ00132, PTZ00132, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase Back     alignment and domain information
>gnl|CDD|206713 cd04146, RERG_RasL11_like, Ras-related and Estrogen-Regulated Growth inhibitor (RERG) and Ras-like 11 (RasL11)-like families Back     alignment and domain information
>gnl|CDD|206704 cd04132, Rho4_like, Ras homology family 4 (Rho4) of small guanosine triphosphatases (GTPases)-like Back     alignment and domain information
>gnl|CDD|133345 cd04145, M_R_Ras_like, R-Ras2/TC21, M-Ras/R-Ras3 Back     alignment and domain information
>gnl|CDD|133324 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like2) Back     alignment and domain information
>gnl|CDD|240385 PTZ00369, PTZ00369, Ras-like protein; Provisional Back     alignment and domain information
>gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|206702 cd04129, Rho2, Ras homology family 2 (Rho2) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206662 cd01870, RhoA_like, Ras homology family A (RhoA)-like includes RhoA, RhoB and RhoC Back     alignment and domain information
>gnl|CDD|128473 smart00176, RAN, Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|133344 cd04144, Ras2, Rat sarcoma (Ras) family 2 of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206714 cd04147, Ras_dva, Ras - dorsal-ventral anterior localization (Ras-dva) family Back     alignment and domain information
>gnl|CDD|206705 cd04133, Rop_like, Rho-related protein from plants (Rop)-like Back     alignment and domain information
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|206741 cd09914, RocCOR, Ras of complex proteins (Roc) C-terminal of Roc (COR) domain family Back     alignment and domain information
>gnl|CDD|133277 cd01875, RhoG, Ras homolog family, member G (RhoG) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206706 cd04134, Rho3, Ras homology family 3 (Rho3) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206703 cd04131, Rnd, Rho family GTPase subfamily Rnd includes Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8 Back     alignment and domain information
>gnl|CDD|133330 cd04130, Wrch_1, Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42 Back     alignment and domain information
>gnl|CDD|206707 cd04135, Tc10, Rho GTPase TC10 (Tc10) Back     alignment and domain information
>gnl|CDD|206663 cd01871, Rac1_like, Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)-like consists of Rac1, Rac2 and Rac3 Back     alignment and domain information
>gnl|CDD|206711 cd04140, ARHI_like, A Ras homolog member I (ARHI) Back     alignment and domain information
>gnl|CDD|206701 cd04128, Spg1, Septum-promoting GTPase (Spg1) Back     alignment and domain information
>gnl|CDD|206664 cd01874, Cdc42, cell division cycle 42 (Cdc42) is a small GTPase of the Rho family Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|206715 cd04148, RGK, Rem, Rem2, Rad, Gem/Kir (RGK) subfamily of Ras GTPases Back     alignment and domain information
>gnl|CDD|133326 cd04126, Rab20, Rab GTPase family 20 (Rab20) Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases Back     alignment and domain information
>gnl|CDD|206736 cd04173, Rnd2_Rho7, Rnd2/Rho7 GTPases Back     alignment and domain information
>gnl|CDD|206735 cd04172, Rnd3_RhoE_Rho8, Rnd3/RhoE/Rho8 GTPases Back     alignment and domain information
>gnl|CDD|206680 cd01893, Miro1, Mitochondrial Rho family 1 (Miro1), N-terminal Back     alignment and domain information
>gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|206689 cd04102, RabL3, Rab GTPase-like family 3 (Rab-like3) Back     alignment and domain information
>gnl|CDD|133275 cd01873, RhoBTB, RhoBTB protein is an atypical member of the Rho family of small GTPases Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|133343 cd04143, Rhes_like, Ras homolog enriched in striatum (Rhes) and activator of G-protein signaling 1 (Dexras1/AGS1) Back     alignment and domain information
>gnl|CDD|206737 cd04174, Rnd1_Rho6, Rnd1/Rho6 GTPases Back     alignment and domain information
>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) Back     alignment and domain information
>gnl|CDD|177661 PLN00023, PLN00023, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) Back     alignment and domain information
>gnl|CDD|206645 cd00879, Sar1, Sar1 is an essential component of COPII vesicle coats Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|165788 PLN00223, PLN00223, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|133361 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (Arl2l1) and Arl13 Back     alignment and domain information
>gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) Back     alignment and domain information
>gnl|CDD|197556 smart00178, SAR, Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|183426 PRK12309, PRK12309, transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|220369 pfam09731, Mitofilin, Mitochondrial inner membrane protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 593
KOG0084|consensus205 100.0
KOG0078|consensus207 100.0
KOG0094|consensus221 100.0
KOG0098|consensus216 100.0
KOG0092|consensus200 100.0
KOG0080|consensus209 100.0
KOG0087|consensus222 100.0
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 100.0
KOG0394|consensus210 99.98
KOG0079|consensus198 99.98
KOG0095|consensus213 99.98
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.98
KOG0093|consensus193 99.97
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.97
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.97
KOG0086|consensus214 99.97
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.97
KOG0091|consensus213 99.97
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.97
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.97
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.97
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.97
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.97
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.97
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.97
KOG0083|consensus192 99.97
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.97
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.97
KOG0088|consensus218 99.97
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.96
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.96
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.96
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.96
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.96
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.96
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.96
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.96
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.96
KOG0081|consensus219 99.96
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.96
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.96
PLN03110216 Rab GTPase; Provisional 99.96
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.96
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.96
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.96
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.96
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.96
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.96
PTZ00369189 Ras-like protein; Provisional 99.96
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.96
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.96
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.96
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.96
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.96
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.96
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.96
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.96
PLN03108210 Rab family protein; Provisional 99.96
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.96
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.96
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.96
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.95
KOG0097|consensus215 99.95
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.95
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.95
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.95
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.95
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.95
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.95
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.95
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.95
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.95
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.95
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.95
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.95
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.95
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.95
PLN03118211 Rab family protein; Provisional 99.95
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.95
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.95
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.95
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.95
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.95
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.94
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.94
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.94
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.94
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.94
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.94
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.94
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.94
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.94
KOG0395|consensus196 99.94
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.93
KOG0393|consensus198 99.93
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.93
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.93
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.93
PLN00223181 ADP-ribosylation factor; Provisional 99.93
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.93
PTZ00133182 ADP-ribosylation factor; Provisional 99.93
KOG4252|consensus246 99.93
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.93
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.93
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.92
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.92
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.92
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.92
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.92
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.92
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.92
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.92
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.92
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.92
COG0486454 ThdF Predicted GTPase [General function prediction 99.91
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.91
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.91
PLN00023334 GTP-binding protein; Provisional 99.91
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.91
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.9
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.9
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.9
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.89
PTZ00099176 rab6; Provisional 99.89
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.89
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.89
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.89
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.89
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.89
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.88
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.87
PRK11058426 GTPase HflX; Provisional 99.87
KOG0073|consensus185 99.87
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.87
KOG1029|consensus 1118 99.87
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.87
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.87
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.86
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.86
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.86
COG1100219 GTPase SAR1 and related small G proteins [General 99.86
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.86
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.85
PRK12299335 obgE GTPase CgtA; Reviewed 99.85
PRK15494339 era GTPase Era; Provisional 99.84
PRK04213201 GTP-binding protein; Provisional 99.84
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.84
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.84
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.84
PRK03003472 GTP-binding protein Der; Reviewed 99.84
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.83
PRK03003 472 GTP-binding protein Der; Reviewed 99.82
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.82
KOG1673|consensus205 99.82
COG1159298 Era GTPase [General function prediction only] 99.81
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.81
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.81
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.81
COG1160444 Predicted GTPases [General function prediction onl 99.81
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.81
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.81
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.81
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.8
KOG0070|consensus181 99.8
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.8
cd00881189 GTP_translation_factor GTP translation factor fami 99.8
PRK12297424 obgE GTPase CgtA; Reviewed 99.8
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.8
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.8
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.79
PRK00089292 era GTPase Era; Reviewed 99.79
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.79
COG2262411 HflX GTPases [General function prediction only] 99.78
PRK00093435 GTP-binding protein Der; Reviewed 99.78
PRK12296 500 obgE GTPase CgtA; Reviewed 99.78
KOG0075|consensus186 99.78
KOG1191|consensus531 99.78
PRK12298390 obgE GTPase CgtA; Reviewed 99.78
COG1160 444 Predicted GTPases [General function prediction onl 99.78
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.77
KOG0096|consensus216 99.77
cd04105203 SR_beta Signal recognition particle receptor, beta 99.77
CHL00189 742 infB translation initiation factor 2; Provisional 99.77
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.76
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.76
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.76
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.76
PRK05306 787 infB translation initiation factor IF-2; Validated 99.76
PRK00093 435 GTP-binding protein Der; Reviewed 99.76
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.75
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.75
KOG1423|consensus379 99.74
KOG4423|consensus229 99.74
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.74
KOG3883|consensus198 99.74
PRK05433 600 GTP-binding protein LepA; Provisional 99.74
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.72
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.72
KOG0071|consensus180 99.72
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.71
KOG0076|consensus197 99.71
cd01896233 DRG The developmentally regulated GTP-binding prot 99.71
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.7
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.7
COG2229187 Predicted GTPase [General function prediction only 99.7
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.7
PRK12317 425 elongation factor 1-alpha; Reviewed 99.68
COG0218200 Predicted GTPase [General function prediction only 99.68
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.68
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.67
PRK10218 607 GTP-binding protein; Provisional 99.67
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.65
KOG1707|consensus 625 99.65
PRK04004 586 translation initiation factor IF-2; Validated 99.65
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.65
KOG0074|consensus185 99.64
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.63
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.63
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.63
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.62
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.61
PRK12735 396 elongation factor Tu; Reviewed 99.61
COG1163365 DRG Predicted GTPase [General function prediction 99.6
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.59
PRK12736 394 elongation factor Tu; Reviewed 99.59
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.58
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.58
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.58
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.57
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.56
COG1084346 Predicted GTPase [General function prediction only 99.56
KOG1489|consensus366 99.56
CHL00071 409 tufA elongation factor Tu 99.56
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.55
KOG0072|consensus182 99.55
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.54
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.54
KOG0030|consensus152 99.53
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.52
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.51
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.51
PLN03126 478 Elongation factor Tu; Provisional 99.51
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.5
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.5
PRK00049 396 elongation factor Tu; Reviewed 99.5
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.49
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.49
PRK13351 687 elongation factor G; Reviewed 99.47
COG3596296 Predicted GTPase [General function prediction only 99.47
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.47
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.47
PLN00043 447 elongation factor 1-alpha; Provisional 99.47
PLN03127 447 Elongation factor Tu; Provisional 99.46
PRK09602 396 translation-associated GTPase; Reviewed 99.46
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.46
KOG1145|consensus 683 99.45
PTZ00141 446 elongation factor 1- alpha; Provisional 99.42
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.41
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.41
PRK12739 691 elongation factor G; Reviewed 99.4
KOG0031|consensus171 99.4
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.39
COG0536369 Obg Predicted GTPase [General function prediction 99.38
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.35
KOG1144|consensus 1064 99.34
KOG0077|consensus193 99.33
PRK09866 741 hypothetical protein; Provisional 99.32
KOG0462|consensus 650 99.32
KOG0090|consensus238 99.32
PTZ00258 390 GTP-binding protein; Provisional 99.31
PRK12740 668 elongation factor G; Reviewed 99.3
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.3
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.3
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.29
KOG0410|consensus410 99.28
PRK00007 693 elongation factor G; Reviewed 99.28
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 99.27
KOG0027|consensus151 99.27
PRK14845 1049 translation initiation factor IF-2; Provisional 99.25
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 99.23
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.21
KOG3905|consensus 473 99.2
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 99.2
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.2
KOG1490|consensus 620 99.19
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.17
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.16
PRK13768253 GTPase; Provisional 99.15
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 99.15
PRK09601 364 GTP-binding protein YchF; Reviewed 99.14
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.13
KOG1532|consensus366 99.09
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.08
PRK09435332 membrane ATPase/protein kinase; Provisional 99.06
KOG0458|consensus 603 99.03
TIGR00101199 ureG urease accessory protein UreG. This model rep 99.03
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 99.02
PRK07560 731 elongation factor EF-2; Reviewed 99.02
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.02
PTZ00416 836 elongation factor 2; Provisional 99.01
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.0
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.0
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.98
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 98.98
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.97
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 98.96
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 98.95
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 98.94
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 98.93
KOG0028|consensus172 98.92
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.92
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 98.91
KOG0461|consensus 522 98.91
COG0012 372 Predicted GTPase, probable translation factor [Tra 98.9
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.88
KOG1486|consensus364 98.87
KOG3886|consensus295 98.87
cd0005267 EH Eps15 homology domain; found in proteins implic 98.86
KOG0027|consensus151 98.84
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.84
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 98.83
KOG2486|consensus320 98.81
COG3276 447 SelB Selenocysteine-specific translation elongatio 98.81
PTZ00183158 centrin; Provisional 98.79
KOG1707|consensus625 98.79
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.78
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 98.75
COG0050 394 TufB GTPases - translation elongation factors [Tra 98.75
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 98.73
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.72
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.71
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 98.71
KOG0468|consensus 971 98.69
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 98.68
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 98.67
KOG0705|consensus 749 98.66
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.65
COG5258 527 GTPBP1 GTPase [General function prediction only] 98.65
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.64
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.62
PTZ00184149 calmodulin; Provisional 98.62
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.59
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.59
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.58
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.57
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 98.56
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.54
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.52
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 98.52
PRK12289 352 GTPase RsgA; Reviewed 98.5
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.5
KOG1954|consensus 532 98.48
KOG1029|consensus 1118 98.48
KOG0447|consensus 980 98.47
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 98.47
PF1465866 EF-hand_9: EF-hand domain 98.46
PRK09563287 rbgA GTPase YlqF; Reviewed 98.46
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.44
COG1161322 Predicted GTPases [General function prediction onl 98.44
PRK00098298 GTPase RsgA; Reviewed 98.42
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.42
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.4
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 98.4
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.39
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.38
COG5019 373 CDC3 Septin family protein [Cell division and chro 98.36
KOG0028|consensus172 98.35
KOG2655|consensus 366 98.35
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.34
KOG0041|consensus244 98.34
KOG0082|consensus354 98.3
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.29
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.29
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.28
KOG0034|consensus187 98.27
PTZ00183158 centrin; Provisional 98.26
PRK12288 347 GTPase RsgA; Reviewed 98.25
KOG1491|consensus 391 98.23
KOG1424|consensus562 98.21
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 98.2
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 98.2
KOG1143|consensus 591 98.19
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 98.19
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.17
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.14
KOG0448|consensus 749 98.12
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.09
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.08
PRK12288347 GTPase RsgA; Reviewed 98.07
PRK12289352 GTPase RsgA; Reviewed 98.07
PTZ00184149 calmodulin; Provisional 98.06
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.04
PRK13796365 GTPase YqeH; Provisional 98.03
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.03
KOG0460|consensus 449 98.02
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.0
KOG0998|consensus847 98.0
KOG2484|consensus435 97.99
PRK10416318 signal recognition particle-docking protein FtsY; 97.97
KOG1487|consensus358 97.96
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.96
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 97.96
KOG3887|consensus 347 97.96
KOG0463|consensus 641 97.95
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.94
PRK14974336 cell division protein FtsY; Provisional 97.92
KOG0467|consensus 887 97.92
KOG0466|consensus 466 97.9
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 97.9
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.89
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.88
KOG0044|consensus193 97.87
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.87
KOG0031|consensus171 97.86
PRK09563 287 rbgA GTPase YlqF; Reviewed 97.85
KOG0464|consensus 753 97.85
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.8
PLN02964644 phosphatidylserine decarboxylase 97.8
KOG0037|consensus221 97.8
TIGR00064272 ftsY signal recognition particle-docking protein F 97.77
KOG1547|consensus336 97.72
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.69
PRK13796 365 GTPase YqeH; Provisional 97.68
PRK00098298 GTPase RsgA; Reviewed 97.67
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.67
COG1162301 Predicted GTPases [General function prediction onl 97.67
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 97.64
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.62
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.61
cd03112158 CobW_like The function of this protein family is u 97.6
KOG0038|consensus189 97.6
KOG0037|consensus221 97.57
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 97.56
cd03110179 Fer4_NifH_child This protein family's function is 97.56
PRK13695174 putative NTPase; Provisional 97.55
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 97.52
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 97.51
KOG0030|consensus152 97.49
KOG0459|consensus 501 97.47
KOG4251|consensus362 97.47
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.46
KOG2485|consensus335 97.45
PRK01889 356 GTPase RsgA; Reviewed 97.44
PLN02964644 phosphatidylserine decarboxylase 97.41
cd03115173 SRP The signal recognition particle (SRP) mediates 97.4
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.39
KOG0377|consensus631 97.37
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.34
KOG0044|consensus193 97.3
KOG0036|consensus463 97.29
COG3523 1188 IcmF Type VI protein secretion system component Va 97.27
cd03114148 ArgK-like The function of this protein family is u 97.24
KOG3859|consensus 406 97.21
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 97.17
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.17
KOG1955|consensus737 97.17
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.16
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.15
KOG0036|consensus463 97.14
PRK10867 433 signal recognition particle protein; Provisional 97.13
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.12
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.08
KOG4273|consensus 418 97.08
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.08
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 97.07
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.07
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.02
TIGR00959 428 ffh signal recognition particle protein. This mode 97.0
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 96.94
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 96.92
COG5185622 HEC1 Protein involved in chromosome segregation, i 96.92
cd03111106 CpaE_like This protein family consists of proteins 96.92
KOG0465|consensus 721 96.91
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 96.91
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 96.81
KOG0034|consensus187 96.8
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 96.79
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.76
KOG2423|consensus572 96.75
COG0523 323 Putative GTPases (G3E family) [General function pr 96.75
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 96.74
KOG0469|consensus 842 96.68
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.65
cd02036179 MinD Bacterial cell division requires the formatio 96.62
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 96.6
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.54
KOG0046|consensus627 96.54
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.49
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.47
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.46
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.45
KOG0995|consensus581 96.34
PRK11537 318 putative GTP-binding protein YjiA; Provisional 96.31
PRK01889356 GTPase RsgA; Reviewed 96.29
COG1162 301 Predicted GTPases [General function prediction onl 96.26
KOG0161|consensus 1930 96.24
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.23
KOG1533|consensus290 96.21
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 96.17
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 96.16
>KOG0084|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.2e-36  Score=276.16  Aligned_cols=177  Identities=37%  Similarity=0.735  Sum_probs=167.3

Q ss_pred             CCCcceEEEEEcCCCCcHHHHHHHHhcCccccCCCCccceeeEEEEEEECCeeEEEEEEecCCchhhhhhhHhhccCCCE
Q psy8073         388 EPDRAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADG  467 (593)
Q Consensus       388 ~~~~~~kI~ivG~~nvGKSSLln~l~~~~~~~~~~~t~g~~~~~~~~~~~~~~~~~~l~DTaG~e~~~~~~~~~~~~ad~  467 (593)
                      ...+.+||+|+|+.|||||.|+.||+...|...+.+|+|+||..+++.++|..+.++||||||||||++++.+||++||+
T Consensus         5 ~~dylFKiiliGds~VGKtCL~~Rf~~~~f~e~~~sTIGVDf~~rt~e~~gk~iKlQIWDTAGQERFrtit~syYR~ahG   84 (205)
T KOG0084|consen    5 EYDYLFKIILIGDSGVGKTCLLLRFKDDTFTESYISTIGVDFKIRTVELDGKTIKLQIWDTAGQERFRTITSSYYRGAHG   84 (205)
T ss_pred             ccceEEEEEEECCCCcChhhhhhhhccCCcchhhcceeeeEEEEEEeeecceEEEEEeeeccccHHHhhhhHhhccCCCe
Confidence            34677999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEeCCChhcHHHHHHHHHHHHHHcCCCCcEEEEEeCCCCCCccccccccccCHHHHHHHHHHhCCe-EEEEcCCCCC
Q psy8073         468 VMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAI-FMETSSKSGD  546 (593)
Q Consensus       468 vi~v~D~~~~~s~~~~~~~~~~i~~~~~~~~piivV~NK~Dl~~~~~~~~~~~v~~~~~~~l~~~~~~~-~~e~Sa~~g~  546 (593)
                      ||+|||+|+..||.++..|+.++..+...++|.++||||||+.+.      +.++.++++.++..++.+ |+++|||++.
T Consensus        85 ii~vyDiT~~~SF~~v~~Wi~Ei~~~~~~~v~~lLVGNK~Dl~~~------~~v~~~~a~~fa~~~~~~~f~ETSAK~~~  158 (205)
T KOG0084|consen   85 IIFVYDITKQESFNNVKRWIQEIDRYASENVPKLLVGNKCDLTEK------RVVSTEEAQEFADELGIPIFLETSAKDST  158 (205)
T ss_pred             EEEEEEcccHHHhhhHHHHHHHhhhhccCCCCeEEEeeccccHhh------eecCHHHHHHHHHhcCCcceeecccCCcc
Confidence            999999999999999999999999999999999999999999865      679999999999999998 9999999999


Q ss_pred             CHHHHHHHHHHHHHhhccccccCC
Q psy8073         547 NILDALIALSRHVYVFIPCVYLKD  570 (593)
Q Consensus       547 gi~~l~~~L~~~l~~~~~~~~~~~  570 (593)
                      ||++.|..|+..+..+........
T Consensus       159 NVe~~F~~la~~lk~~~~~~~~~~  182 (205)
T KOG0084|consen  159 NVEDAFLTLAKELKQRKGLHVKWS  182 (205)
T ss_pred             CHHHHHHHHHHHHHHhcccCCCCC
Confidence            999999999999998776654444

>KOG0078|consensus Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG0447|consensus Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>KOG0082|consensus Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>KOG0448|consensus Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG0998|consensus Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>KOG1487|consensus Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG3887|consensus Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>KOG3859|consensus Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG4273|consensus Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG1533|consensus Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
2p5s_A199 Rab Domain Of Human Rasef In Complex With Gdp Lengt 3e-52
3qbt_A174 Crystal Structure Of Ocrl1 540-678 In Complex With 1e-39
2fu5_C183 Structure Of Rab8 In Complex With Mss4 Length = 183 2e-39
2g6b_A180 Crystal Structure Of Human Rab26 In Complex With A 3e-37
1yzn_A185 Gppnhp-Bound Ypt1p Gtpase Length = 185 6e-36
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 7e-36
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 1e-35
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 2e-35
1ukv_Y206 Structure Of Rabgdp-Dissociation Inhibitor In Compl 4e-35
2bcg_Y206 Structure Of Doubly Prenylated Ypt1:gdi Complex Len 4e-35
4fmc_B171 Espg-Rab1 Complex Length = 171 1e-34
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 1e-34
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 3e-34
3cph_A213 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 6e-34
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 7e-34
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 7e-34
2wwx_A175 Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra 1e-33
2eqb_A174 Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 2e-33
1g17_A170 Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) 2e-33
2rhd_A175 Crystal Structure Of Cryptosporidium Parvum Small G 4e-33
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 4e-33
1z0a_A174 Gdp-Bound Rab2a Gtpase Length = 174 8e-33
2a5j_A191 Crystal Structure Of Human Rab2b Length = 191 1e-32
2ew1_A201 Crystal Structure Of Rab30 In Complex With A Gtp An 2e-32
2ocy_C170 Complex Of The Guanine Exchange Factor Sec2p And Th 3e-32
2hup_A201 Crystal Structure Of Human Rab43 In Complex With Gd 4e-32
1g16_A170 Crystal Structure Of Sec4-Gdp Length = 170 6e-32
1z0f_A179 Gdp-Bound Rab14 Gtpase Length = 179 1e-31
2bmd_A186 High Resolution Structure Of Gdp-Bound Human Rab4a 1e-31
3dz8_A191 Crystal Structure Of Human Rab3b Gtpase Bound With 1e-31
1z06_A189 Gppnhp-Bound Rab33 Gtpase Length = 189 4e-31
1yu9_A175 Gppnhp-Bound Rab4a Length = 175 5e-31
4drz_A196 Crystal Structure Of Human Rab14 Length = 196 7e-31
2y8e_A179 Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo 8e-31
3rab_A169 Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 3e-30
1z0k_A172 Structure Of Gtp-Bound Rab4q67l Gtpase In Complex W 5e-30
1yzq_A170 Gppnhp-Bound Rab6 Gtpase Length = 170 1e-29
3cwz_A188 Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 1e-29
4dkx_A216 Crystal Structure Of The Rab 6a'(Q72l) Length = 216 1e-29
3bbp_A211 Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 2e-29
2g77_B198 Crystal Structure Of Gyp1 Tbc Domain In Complex Wit 2e-29
1zbd_A203 Structural Basis Of Rab Effector Specificity: Cryst 2e-29
1x3s_A195 Crystal Structure Of Human Rab18 In Complex With Gp 4e-29
2o52_A200 Crystal Structure Of Human Rab4b In Complex With Gd 5e-29
1ek0_A170 Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 17 6e-29
2gf9_A189 Crystal Structure Of Human Rab3d In Complex With Gd 1e-28
1d5c_A162 Crystal Structure Of Plasmodium Falciparum Rab6 Com 2e-28
2fe4_A171 The Crystal Structure Of Human Neuronal Rab6b In It 2e-28
2il1_A192 Crystal Structure Of A Predicted Human Gtpase In Co 2e-28
2gil_A162 Structure Of The Extremely Slow Gtpase Rab6a In The 2e-28
1yzk_A184 Gppnhp Bound Rab11 Gtpase Length = 184 2e-28
4fmc_F117 Espg-Rab1 Complex Length = 117 9e-28
1oiv_A191 X-Ray Structure Of The Small G Protein Rab11a In Co 1e-26
3bc1_A195 Crystal Structure Of The Complex Rab27a-slp2a Lengt 1e-26
1n6h_A170 Crystal Structure Of Human Rab5a Length = 170 1e-26
1tu3_A171 Crystal Structure Of Rab5 Complex With Rabaptin5 C- 2e-26
3tw8_B181 Gef Domain Of Dennd 1b In Complex With Rab Gtpase R 3e-26
1yvd_A169 Gppnhp-Bound Rab22 Gtpase Length = 169 3e-26
2hei_A179 Crystal Structure Of Human Rab5b In Complex With Gd 3e-26
2f7s_A217 The Crystal Structure Of Human Rab27b Bound To Gdp 4e-26
1n6i_A170 Crystal Structure Of Human Rab5a A30p Mutant Comple 5e-26
1yzt_A184 Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng 5e-26
2if0_A200 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 6e-26
2iez_A220 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 7e-26
1n6p_A170 Crystal Structure Of Human Rab5a A30e Mutant Comple 7e-26
1n6o_A170 Crystal Structure Of Human Rab5a A30k Mutant Comple 7e-26
1n6r_A170 Crystal Structure Of Human Rab5a A30l Mutant Comple 8e-26
1oiw_A191 X-ray Structure Of The Small G Protein Rab11a In Co 8e-26
1tu4_A171 Crystal Structure Of Rab5-Gdp Complex Length = 171 9e-26
1n6n_A170 Crystal Structure Of Human Rab5a A30r Mutant Comple 9e-26
3cpj_B223 Crystal Structure Of Ypt31 In Complex With Yeast Ra 9e-26
3mjh_A168 Crystal Structure Of Human Rab5a In Complex With Th 1e-25
2f9l_A199 3d Structure Of Inactive Human Rab11b Gtpase Length 1e-25
2iey_A195 Crystal Structure Of Mouse Rab27b Bound To Gdp In H 2e-25
1z0j_A170 Structure Of Gtp-Bound Rab22q64l Gtpase In Complex 2e-25
1huq_A164 1.8a Crystal Structure Of The Monomeric Gtpase Rab5 2e-25
2zet_A203 Crystal Structure Of The Small Gtpase Rab27b Comple 2e-25
1z08_A170 Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 2e-25
2hv8_A172 Crystal Structure Of Gtp-Bound Rab11 In Complex Wit 4e-25
3bfk_A181 Crystal Structure Of Plasmodium Falciparum Rab11a I 4e-25
2d7c_A167 Crystal Structure Of Human Rab11 In Complex With Fi 5e-25
2gzd_A173 Crystal Structure Of Rab11 In Complex With Rab11-Fi 7e-25
2fg5_A192 Crystal Structure Of Human Rab31 In Complex With A 9e-25
1z0d_A167 Gdp-bound Rab5c Gtpase Length = 167 2e-24
1z07_A166 Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 2e-24
1yzu_A170 Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng 2e-24
1z22_A168 Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Spac 3e-24
2efc_B181 Ara7-GdpATVPS9A Length = 181 6e-24
3rwm_B185 Crystal Structure Of Ypt32 In Complex With Gppnhp L 9e-24
1vg0_B207 The Crystal Structures Of The Rep-1 Protein In Comp 6e-23
2oil_A193 Crystal Structure Of Human Rab25 In Complex With Gd 1e-22
1vg1_A185 Gdp-bound Rab7 Length = 185 1e-22
3law_A207 Structure Of Gtp-Bound L129f Mutant Rab7 Length = 2 2e-22
3tso_A178 Structure Of The Cancer Associated Rab25 Protein In 5e-22
1t91_A207 Crystal Structure Of Human Small Gtpase Rab7(Gtp) L 5e-22
3ea5_A216 Kap95p Binding Induces The Switch Loops Of Rangdp T 1e-21
1ky2_A182 Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 1e-21
3gj0_A221 Crystal Structure Of Human Rangdp Length = 221 5e-21
1a2k_C216 Gdpran-Ntf2 Complex Length = 216 6e-21
1qg2_A216 Canine Gdp-Ran R76e Mutant Length = 216 6e-21
1yzl_A179 Gppnhp-Bound Rab9 Gtpase Length = 179 7e-21
1byu_A216 Canine Gdp-Ran Length = 216 8e-21
1qg4_A216 Canine Gdp-Ran F72y Mutant Length = 216 1e-20
1qbk_C216 Structure Of The Karyopherin Beta2-ran Gppnhp Nucle 1e-20
1wms_A177 High Resolution Crystal Structure Of Human Rab9 Gtp 1e-20
1wa5_A176 Crystal Structure Of The Exportin Cse1p Complexed W 2e-20
1s8f_A177 Crystal Structure Of Rab9 Complexed To Gdp Reveals 2e-20
2bku_A177 Kap95p:rangtp Complex Length = 177 2e-20
3nc1_C182 Crystal Structure Of The Crm1-Rangtp Complex Length 4e-20
3ran_A216 Canine Gdp-Ran Q69l Mutant Length = 216 5e-20
3gj4_A221 Crystal Structure Of Human Rangdp-Nup153znf3 Comple 6e-20
3nby_C176 Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclea 1e-19
1rrp_A204 Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 4e-19
2ocb_A180 Crystal Structure Of Human Rab9b In Complex With A 5e-19
2hxs_A178 Crystal Structure Of Rab28a Gtpase In The Inactive 9e-19
3brw_D167 Structure Of The Rap-Rapgap Complex Length = 167 2e-17
4epr_A170 Discovery Of Small Molecules That Bind To K-Ras And 2e-17
4dso_A189 Small-Molecule Ligands Bind To A Distinct Pocket In 3e-17
4dxa_A169 Co-Crystal Structure Of Rap1 In Complex With Krit1 3e-17
1c1y_A167 Crystal Structure Of Rap.Gmppnp In Complex With The 5e-17
1clu_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 5e-17
3m1i_A219 Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex 6e-17
421p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 9e-17
2wbl_C180 Three-Dimensional Structure Of A Binary Rop-Prone C 9e-17
1agp_A166 Three-Dimensional Structures And Properties Of A Tr 1e-16
2x19_A172 Crystal Structure Of Importin13 - Rangtp Complex Le 1e-16
1gua_A167 Human Rap1a, Residues 1-167, Double Mutant (E30d,K3 1e-16
3icq_B171 Karyopherin Nuclear State Length = 171 1e-16
1jah_A166 H-Ras P21 Protein Mutant G12p, Complexed With Guano 1e-16
3kkp_A183 Crystal Structure Of M-Ras P40d In Complex With Gpp 4e-16
2nty_C180 Rop4-Gdp-Prone8 Length = 180 5e-16
3pir_A183 Crystal Structure Of M-Rasd41e In Complex With Gppn 5e-16
3kko_A183 Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX 7e-16
3clv_A208 Crystal Structure Of Rab5a From Plasmodium Falcipar 8e-16
4djt_A218 Crystal Structure Of A Nuclear Gtp-Binding Protein 9e-16
3bwd_D182 Crystal Structure Of The Plant Rho Protein Rop5 Len 1e-15
2j1l_A214 Crystal Structure Of Human Rho-Related Gtp-Binding 6e-15
3lw8_A185 Shigella Ipgb2 In Complex With Human Rhoa, Gdp And 7e-15
2j0v_A212 The Crystal Structure Of Arabidopsis Thaliana Rac7- 8e-15
1cxz_A182 Crystal Structure Of Human Rhoa Complexed With The 9e-15
1x1r_A178 Crystal Structure Of M-Ras In Complex With Gdp Leng 9e-15
3kz1_E182 Crystal Structure Of The Complex Of Pdz-Rhogef DhPH 9e-15
1s1c_A183 Crystal Structure Of The Complex Between The Human 9e-15
4f38_A195 Crystal Structure Of Geranylgeranylated Rhoa In Com 1e-14
1lb1_B192 Crystal Structure Of The Dbl And Pleckstrin Homolog 1e-14
3tvd_A193 Crystal Structure Of Mouse Rhoa-Gtp Complex Length 1e-14
1x86_B196 Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-A 1e-14
3rap_R167 The Small G Protein Rap2 In A Non Catalytic Complex 1e-14
4epx_A170 Discovery Of Small Molecules That Bind To K-Ras And 3e-14
4ept_A170 Discovery Of Small Molecules That Bind To K-Ras And 3e-14
2kwi_A178 Ralb-Rlip76 (Ralbp1) Complex Length = 178 4e-14
1lfd_B167 Crystal Structure Of The Active Ras Protein Complex 4e-14
2ke5_A174 Solution Structure And Dynamics Of The Small Gtpase 4e-14
3kkm_A172 Crystal Structure Of H-Ras T35s In Complex With Gpp 5e-14
3ddc_A166 Crystal Structure Of Nore1a In Complex With Ras Len 6e-14
2bov_A206 Molecular Recognition Of An Adp-Ribosylating Clostr 6e-14
3gft_A187 Human K-Ras In Complex With A Gtp Analogue Length = 7e-14
4q21_A189 Molecular Switch For Signal Transduction: Structura 8e-14
2fv8_A207 The Crystal Structure Of Rhob In The Gdp-Bound Stat 8e-14
3k9n_A166 Allosteric Modulation Of H-Ras Gtpase Length = 166 9e-14
4efm_A171 Crystal Structure Of H-Ras G12v In Complex With Gpp 9e-14
4efl_A171 Crystal Structure Of H-Ras Wt In Complex With Gppnh 9e-14
1xcg_B178 Crystal Structure Of Human Rhoa In Complex With DhP 9e-14
1tx4_B177 RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 1e-13
1dpf_A180 Crystal Structure Of A Mg-Free Form Of Rhoa Complex 1e-13
221p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 1e-13
3msx_A180 Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With 1e-13
1wq1_R166 Ras-Rasgap Complex Length = 166 1e-13
1rvd_A166 H-Ras Complexed With Diaminobenzophenone-Beta,Gamma 1e-13
6q21_A171 Molecular Switch For Signal Transduction: Structura 1e-13
2q21_A171 Crystal Structures At 2.2 Angstroms Resolution Of T 1e-13
2c5l_A173 Structure Of Plc Epsilon Ras Association Domain Wit 1e-13
3con_A190 Crystal Structure Of The Human Nras Gtpase Bound Wi 1e-13
3v4f_A166 H-Ras Peg 400CACL2, ORDERED OFF Length = 166 1e-13
3a58_B188 Crystal Structure Of Sec3p - Rho1p Complex From Sac 1e-13
2cld_X166 Crystal Structure Analysis Of A Fluorescent Form Of 1e-13
1cc0_A190 Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Le 1e-13
2cl0_X166 Crystal Structure Analysis Of A Fluorescent Form Of 2e-13
1ow3_B193 Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With 2e-13
1iaq_A166 C-H-Ras P21 Protein Mutant With Thr 35 Replaced By 2e-13
2a78_A187 Crystal Structure Of The C3bot-Rala Complex Reveals 2e-13
2atx_A194 Crystal Structure Of The Tc10 Gppnhp Complex Length 2e-13
1uad_A175 Crystal Structure Of The Rala-gppnhp-sec5 Ral-bindi 2e-13
3lo5_A166 Crystal Structure Of The Dominant Negative S17n Mut 2e-13
2x1v_A166 Crystal Structure Of The Activating H-Ras I163f Mut 2e-13
2quz_A166 Crystal Structure Of The Activating H-Rask117r Muta 2e-13
3i3s_R166 Crystal Structure Of H-Ras With Thr50 Replaced By I 3e-13
1he1_C176 Crystal Structure Of The Complex Between The Gap Do 3e-13
1lf0_A166 Crystal Structure Of Rasa59g In The Gtp-Bound Form 3e-13
521p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 3e-13
3th5_A204 Crystal Structure Of Wild-Type Rac1 Length = 204 3e-13
1kmq_A184 Crystal Structure Of A Constitutively Activated Rho 4e-13
2fju_A178 Activated Rac1 Bound To Its Effector Phospholipase 4e-13
2rgb_A166 Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 4e-13
621p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 4e-13
1foe_B177 Crystal Structure Of Rac1 In Complex With The Guani 4e-13
3sua_A184 Crystal Structure Of The Intracellular Domain Of Pl 4e-13
2gcn_A201 Crystal Structure Of The Human Rhoc-Gdp Complex Len 5e-13
2yin_C196 Structure Of The Complex Between Dock2 And Rac1. Le 5e-13
2gco_A201 Crystal Structure Of The Human Rhoc-gppnhp Complex 5e-13
1nvv_Q166 Structural Evidence For Feedback Activation By Rasg 5e-13
3sbd_A187 Crystal Structure Of Rac1 P29s Mutant Length = 187 5e-13
1u8y_A168 Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal 5e-13
3b13_B184 Crystal Structure Of The Dhr-2 Domain Of Dock2 In C 5e-13
1xcm_A167 Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mu 6e-13
1xj0_A166 Crystal Structure Of The Gdp-Bound Form Of The Rasg 6e-13
4efn_A171 Crystal Structure Of H-Ras Q61l In Complex With Gpp 8e-13
1zvq_A166 Structure Of The Q61g Mutant Of Ras In The Gdp-Boun 9e-13
1zw6_A166 Crystal Structure Of The Gtp-Bound Form Of Rasq61g 9e-13
721p_A166 Three-Dimensional Structures Of H-Ras P21 Mutants: 9e-13
2rgc_A166 Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 1e-12
1xtq_A177 Structure Of Small Gtpase Human Rheb In Complex Wit 1e-12
3ref_B194 Crystal Structure Of Ehrho1 Bound To Gdp And Magnes 1e-12
2rga_A166 Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 1e-12
3t5g_A181 Structure Of Fully Modified Farnesylated Rheb In Co 1e-12
4gzm_A204 Crystal Structure Of Rac1 F28l Mutant Length = 204 1e-12
1zc3_A175 Crystal Structure Of The Ral-Binding Domain Of Exo8 1e-12
4dvg_A188 Crystal Structure Of E. Histolytica Formin1 Bound T 2e-12
2ery_A172 The Crystal Structure Of The Ras Related Protein Rr 2e-12
2l0x_A169 Solution Structure Of The 21 Kda Gtpase Rheb Bound 2e-12
3ryt_C180 The Plexin A1 Intracellular Region In Complex With 2e-12
3sea_A167 Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bo 2e-12
4gzl_A204 Crystal Structure Of Rac1 Q61l Mutant Length = 204 2e-12
1mh1_A186 Small G-Protein Length = 186 3e-12
2vrw_A184 Critical Structural Role For The Ph And C1 Domains 4e-12
1i4d_D192 Crystal Structure Analysis Of Rac1-Gdp Complexed Wi 4e-12
2atv_A196 The Crystal Structure Of Human Rerg In The Gdp Boun 4e-12
1hh4_A192 Rac1-Rhogdi Complex Involved In Nadph Oxidase Activ 5e-12
2h7v_A188 Co-crystal Structure Of Ypka-rac1 Length = 188 5e-12
1g4u_R184 Crystal Structure Of The Salmonella Tyrosine Phosph 5e-12
1z2c_A193 Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With 7e-12
2wkr_A332 Structure Of A Photoactivatable Rac1 Containing The 7e-12
2wkp_A332 Structure Of A Photoactivatable Rac1 Containing Lov 7e-12
2wkq_A332 Structure Of A Photoactivatable Rac1 Containing The 7e-12
2ic5_A180 Crystal Structure Of Human Rac3 Grown In The Presen 8e-12
2g0n_A179 The Crystal Structure Of The Human Rac3 In Complex 8e-12
3oes_A201 Crystal Structure Of The Small Gtpase Rhebl1 Length 8e-12
2c2h_A192 Crystal Structure Of The Human Rac3 In Complex With 9e-12
2erx_A172 Crystal Structure Of Diras2 In Complex With Gdp And 1e-11
1ds6_A192 Crystal Structure Of A Rac-Rhogdi Complex Length = 1e-11
2w2v_A184 Rac2 (G12v) In Complex With Gtpgs Length = 184 2e-11
2w2t_A185 Rac2 (G12v) In Complex With Gdp Length = 185 2e-11
1i4t_D192 Crystal Structure Analysis Of Rac1-Gmppnp In Comple 4e-11
1e96_A192 Structure Of The RacP67PHOX COMPLEX Length = 192 4e-11
1ryf_A203 Alternative Splicing Of Rac1 Generates Rac1b, A Sel 6e-11
2wm9_B190 Structure Of The Complex Between Dock9 And Cdc42. L 1e-10
1doa_A191 Structure Of The Rho Family Gtp-Binding Protein Cdc 1e-10
1kz7_B188 Crystal Structure Of The DhPH FRAGMENT OF MURINE DB 1e-10
2dfk_B194 Crystal Structure Of The Cdc42-Collybistin Ii Compl 1e-10
4did_A193 Crystal Structure Of Salmonella Effector N-Terminal 1e-10
1grn_A191 Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX. 1e-10
2odb_A192 The Crystal Structure Of Human Cdc42 In Complex Wit 1e-10
1aje_A194 Cdc42 From Human, Nmr, 20 Structures Length = 194 2e-10
3vhl_B195 Crystal Structure Of The Dhr-2 Domain Of Dock8 In C 2e-10
1ees_A178 Solution Structure Of Cdc42hs Complexed With A Pept 2e-10
1gzs_A180 Crystal Structure Of The Complex Between The Gef Do 2e-10
2v55_B200 Mechanism Of Multi-site Phosphorylation From A Rock 5e-10
3eg5_A178 Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex W 5e-10
1gwn_A205 The Crystal Structure Of The Core Domain Of RhoeRND 5e-10
2fn4_A181 The Crystal Structure Of Human Ras-Related Protein, 5e-10
1m7b_A184 Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATI 6e-10
3qbv_A178 Structure Of Designed Orthogonal Interaction Betwee 6e-10
2kb0_A178 Cdc42(T35a) Length = 178 9e-10
2ase_A178 Nmr Structure Of The F28l Mutant Of Cdc42hs Length 9e-10
2q3h_A201 The Crystal Structure Of Rhoua In The Gdp-bound Sta 1e-09
2pmy_A91 Ef-Hand Domain Of Human Rasef Length = 91 2e-09
3gcg_A182 Crystal Structure Of Map And Cdc42 Complex Length = 3e-09
1cee_A179 Solution Structure Of Cdc42 In Complex With The Gtp 4e-09
1an0_A190 Cdc42hs-Gdp Complex Length = 190 4e-09
1a4r_B191 G12v Mutant Of Human Placental Cdc42 Gtpase In The 4e-09
2qrz_A189 Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is 4e-09
2yc2_C208 Intraflagellar Transport Complex 25-27 From Chlamyd 5e-09
1am4_D177 Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. S 7e-09
1nf3_A195 Structure Of Cdc42 In A Complex With The Gtpase-Bin 2e-08
1zd9_A188 Structure Of Human Adp-Ribosylation Factor-Like 10b 3e-08
1cf4_A184 Cdc42ACK GTPASE-Binding Domain Complex Length = 184 3e-08
2cls_A198 The Crystal Structure Of The Human Rnd1 Gtpase In T 4e-08
3q3j_B214 Crystal Structure Of Plexin A2 Rbd In Complex With 4e-08
2al7_A186 Structure Of Human Adp-Ribosylation Factor-Like 10c 6e-08
2h18_A193 Structure Of Human Adp-Ribosylation Factor-Like 10b 9e-08
3doe_A192 Complex Of Arl2 And Bart, Crystal Form 1 Length = 1 2e-07
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 4e-07
1ksh_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Nati 4e-07
1ksg_A186 Complex Of Arl2 And Pde Delta, Crystal Form 1 Lengt 4e-07
2gf0_A199 The Crystal Structure Of The Human Diras1 Gtpase In 4e-07
2rex_B197 Crystal Structure Of The Effector Domain Of Plxnb1 5e-07
3o47_A329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 7e-07
1re0_A164 Structure Of Arf1-Gdp Bound To Sec7 Domain Complexe 7e-07
3lrp_A181 Crystal Structure Of Plasmodium Falciparum Adp-Ribo 9e-07
1hur_A180 Human Adp-Ribosylation Factor 1 Complexed With Gdp, 1e-06
1rrg_A181 Non-Myristoylated Rat Adp-Ribosylation Factor-1 Com 1e-06
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 1e-06
3tjz_A164 Crystal Structure Of Arf1 Bound To The GammaZETA-Co 1e-06
1j2j_A166 Crystal Structure Of Gga1 Gat N-terminal Region In 5e-06
1z6x_A180 Structure Of Human Adp-Ribosylation Factor 4 Length 6e-06
3lvr_E497 The Crystal Structure Of Asap3 In Complex With Arf6 6e-06
3aq4_A184 Molecular Insights Into Plant Cell Proliferation Di 9e-06
1ksj_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Seme 2e-05
4goj_A189 The Crystal Structure Of Full Length Arl3gppnhp In 3e-05
2b6h_A192 Structure Of Human Adp-Ribosylation Factor 5 Length 3e-05
1fzq_A181 Crystal Structure Of Murine Arl3-Gdp Length = 181 3e-05
4gok_B169 The Crystal Structure Of Arl2gppnhp In Complex With 4e-05
3rd1_A178 Structure Of An Adp Ribosylation Factor From Entamo 7e-05
2a5d_A175 Structural Basis For The Activation Of Cholera Toxi 1e-04
1e0s_A174 Small G Protein Arf6-Gdp Length = 174 1e-04
2ksq_A181 The Myristoylated Yeast Arf1 In A Gtp And Bicelle B 1e-04
4fme_C160 Espg-Rab1-Arf6 Complex Length = 160 2e-04
3n5c_A162 Crystal Structure Of Arf6delta13 Complexed With Gdp 2e-04
3d6t_B171 Structure Of The Roc Domain From The Parkinson's Di 2e-04
2zej_A184 Structure Of The Roc Domain From The Parkinson's Di 3e-04
3pcr_B162 Structure Of Espg-Arf6 Complex Length = 162 3e-04
3dpu_A 535 Roccor Domain Tandem Of Rab Family Protein (Roco) L 3e-04
2x77_A189 Crystal Structure Of Leishmania Major Adp Ribosylat 3e-04
3cbq_A195 Crystal Structure Of The Human Rem2 Gtpase With Bou 6e-04
2gao_A208 Crystal Structure Of Human Sar1a In Complex With Gd 7e-04
1r4a_A165 Crystal Structure Of Gtp-Bound Adp-Ribosylation Fac 8e-04
2a5g_A175 Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length 9e-04
3vhx_A172 The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesi 9e-04
>pdb|2P5S|A Chain A, Rab Domain Of Human Rasef In Complex With Gdp Length = 199 Back     alignment and structure 
Iteration: 1

 Score =  202 bits (515), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 124/169 (73%)
Query: 391 RAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAG 450
           +A+KIV AGDAAVGKS F+ R  K  F   + +TLGVDFQMKT+ VD     LQLWDTAG
Sbjct: 27  KAYKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAG 86
Query: 451 QERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLR 510
           QERFRS+ K+YFR+ADGV+LLYDVT E+SF +++ WV+ +E+    ++PI++  NK D+R
Sbjct: 87  QERFRSIAKSYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDAAHETVPIMLVGNKADIR 146
Query: 511 ADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHV 559
             A  +G KC+    GEKLA  YGA+F ETS+K G NI++A++ L+R V
Sbjct: 147 DTAATEGQKCVPGHFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREV 195
>pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 Back     alignment and structure
>pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 Back     alignment and structure
>pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 Back     alignment and structure
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 Back     alignment and structure
>pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 Back     alignment and structure
>pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 Back     alignment and structure
>pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 Back     alignment and structure
>pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 Back     alignment and structure
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|1Z0A|A Chain A, Gdp-Bound Rab2a Gtpase Length = 174 Back     alignment and structure
>pdb|2A5J|A Chain A, Crystal Structure Of Human Rab2b Length = 191 Back     alignment and structure
>pdb|2EW1|A Chain A, Crystal Structure Of Rab30 In Complex With A Gtp Analogue Length = 201 Back     alignment and structure
>pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 Back     alignment and structure
>pdb|2HUP|A Chain A, Crystal Structure Of Human Rab43 In Complex With Gdp Length = 201 Back     alignment and structure
>pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 Back     alignment and structure
>pdb|1Z0F|A Chain A, Gdp-Bound Rab14 Gtpase Length = 179 Back     alignment and structure
>pdb|2BMD|A Chain A, High Resolution Structure Of Gdp-Bound Human Rab4a Length = 186 Back     alignment and structure
>pdb|3DZ8|A Chain A, Crystal Structure Of Human Rab3b Gtpase Bound With Gdp Length = 191 Back     alignment and structure
>pdb|1Z06|A Chain A, Gppnhp-Bound Rab33 Gtpase Length = 189 Back     alignment and structure
>pdb|1YU9|A Chain A, Gppnhp-Bound Rab4a Length = 175 Back     alignment and structure
>pdb|4DRZ|A Chain A, Crystal Structure Of Human Rab14 Length = 196 Back     alignment and structure
>pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 Back     alignment and structure
>pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 Back     alignment and structure
>pdb|1Z0K|A Chain A, Structure Of Gtp-Bound Rab4q67l Gtpase In Complex With The Central Rab Binding Domain Of Rabenosyn-5 Length = 172 Back     alignment and structure
>pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 Back     alignment and structure
>pdb|3CWZ|A Chain A, Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 Back     alignment and structure
>pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 Back     alignment and structure
>pdb|3BBP|A Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 211 Back     alignment and structure
>pdb|2G77|B Chain B, Crystal Structure Of Gyp1 Tbc Domain In Complex With Rab33 Gtpase Bound To Gdp And Alf3 Length = 198 Back     alignment and structure
>pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector Specificity: Crystal Structure Of The Small G Protein Rab3a Complexed With The Effector Domain Of Rabphilin-3a Length = 203 Back     alignment and structure
>pdb|1X3S|A Chain A, Crystal Structure Of Human Rab18 In Complex With Gppnhp Length = 195 Back     alignment and structure
>pdb|2O52|A Chain A, Crystal Structure Of Human Rab4b In Complex With Gdp Length = 200 Back     alignment and structure
>pdb|1EK0|A Chain A, Gppnhp-Bound Ypt51 At 1.48 A Resolution Length = 170 Back     alignment and structure
>pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 Back     alignment and structure
>pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|2FE4|A Chain A, The Crystal Structure Of Human Neuronal Rab6b In Its Inactive Gdp-Bound Form Length = 171 Back     alignment and structure
>pdb|2IL1|A Chain A, Crystal Structure Of A Predicted Human Gtpase In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 Back     alignment and structure
>pdb|1YZK|A Chain A, Gppnhp Bound Rab11 Gtpase Length = 184 Back     alignment and structure
>pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 Back     alignment and structure
>pdb|1OIV|A Chain A, X-Ray Structure Of The Small G Protein Rab11a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|3BC1|A Chain A, Crystal Structure Of The Complex Rab27a-slp2a Length = 195 Back     alignment and structure
>pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a Length = 170 Back     alignment and structure
>pdb|1TU3|A Chain A, Crystal Structure Of Rab5 Complex With Rabaptin5 C-Terminal Domain Length = 171 Back     alignment and structure
>pdb|3TW8|B Chain B, Gef Domain Of Dennd 1b In Complex With Rab Gtpase Rab35 Length = 181 Back     alignment and structure
>pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 Back     alignment and structure
>pdb|2HEI|A Chain A, Crystal Structure Of Human Rab5b In Complex With Gdp Length = 179 Back     alignment and structure
>pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 Back     alignment and structure
>pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a A30p Mutant Complex With Gdp Length = 170 Back     alignment and structure
>pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 Back     alignment and structure
>pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 Back     alignment and structure
>pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 Back     alignment and structure
>pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a A30e Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a A30k Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a A30l Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1OIW|A Chain A, X-ray Structure Of The Small G Protein Rab11a In Complex With Gtpgammas Length = 191 Back     alignment and structure
>pdb|1TU4|A Chain A, Crystal Structure Of Rab5-Gdp Complex Length = 171 Back     alignment and structure
>pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a A30r Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 Back     alignment and structure
>pdb|3MJH|A Chain A, Crystal Structure Of Human Rab5a In Complex With The C2h2 Zinc Finger Of Eea1 Length = 168 Back     alignment and structure
>pdb|2F9L|A Chain A, 3d Structure Of Inactive Human Rab11b Gtpase Length = 199 Back     alignment and structure
>pdb|2IEY|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Hexagonal Space Group Length = 195 Back     alignment and structure
>pdb|1Z0J|A Chain A, Structure Of Gtp-Bound Rab22q64l Gtpase In Complex With The Minimal Rab Binding Domain Of Rabenosyn-5 Length = 170 Back     alignment and structure
>pdb|1HUQ|A Chain A, 1.8a Crystal Structure Of The Monomeric Gtpase Rab5c (Mouse) Length = 164 Back     alignment and structure
>pdb|2ZET|A Chain A, Crystal Structure Of The Small Gtpase Rab27b Complexed With The Slp Homology Domain Of Slac2-AMELANOPHILIN Length = 203 Back     alignment and structure
>pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 Back     alignment and structure
>pdb|2HV8|A Chain A, Crystal Structure Of Gtp-Bound Rab11 In Complex With Fip3 Length = 172 Back     alignment and structure
>pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 Back     alignment and structure
>pdb|2D7C|A Chain A, Crystal Structure Of Human Rab11 In Complex With Fip3 Rab- Binding Domain Length = 167 Back     alignment and structure
>pdb|2GZD|A Chain A, Crystal Structure Of Rab11 In Complex With Rab11-Fip2 Length = 173 Back     alignment and structure
>pdb|2FG5|A Chain A, Crystal Structure Of Human Rab31 In Complex With A Gtp Analogue Length = 192 Back     alignment and structure
>pdb|1Z0D|A Chain A, Gdp-bound Rab5c Gtpase Length = 167 Back     alignment and structure
>pdb|1Z07|A Chain A, Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 Back     alignment and structure
>pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 Back     alignment and structure
>pdb|1Z22|A Chain A, Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Space Group Length = 168 Back     alignment and structure
>pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 Back     alignment and structure
>pdb|3RWM|B Chain B, Crystal Structure Of Ypt32 In Complex With Gppnhp Length = 185 Back     alignment and structure
>pdb|1VG0|B Chain B, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 207 Back     alignment and structure
>pdb|2OIL|A Chain A, Crystal Structure Of Human Rab25 In Complex With Gdp Length = 193 Back     alignment and structure
>pdb|1VG1|A Chain A, Gdp-bound Rab7 Length = 185 Back     alignment and structure
>pdb|3LAW|A Chain A, Structure Of Gtp-Bound L129f Mutant Rab7 Length = 207 Back     alignment and structure
>pdb|3TSO|A Chain A, Structure Of The Cancer Associated Rab25 Protein In Complex With Fip2 Length = 178 Back     alignment and structure
>pdb|1T91|A Chain A, Crystal Structure Of Human Small Gtpase Rab7(Gtp) Length = 207 Back     alignment and structure
>pdb|3EA5|A Chain A, Kap95p Binding Induces The Switch Loops Of Rangdp To Adopt The Gtp- Bound Conformation: Implications For Nuclear Import Complex Assembly Dynamics Length = 216 Back     alignment and structure
>pdb|1KY2|A Chain A, Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 Back     alignment and structure
>pdb|3GJ0|A Chain A, Crystal Structure Of Human Rangdp Length = 221 Back     alignment and structure
>pdb|1A2K|C Chain C, Gdpran-Ntf2 Complex Length = 216 Back     alignment and structure
>pdb|1QG2|A Chain A, Canine Gdp-Ran R76e Mutant Length = 216 Back     alignment and structure
>pdb|1YZL|A Chain A, Gppnhp-Bound Rab9 Gtpase Length = 179 Back     alignment and structure
>pdb|1BYU|A Chain A, Canine Gdp-Ran Length = 216 Back     alignment and structure
>pdb|1QG4|A Chain A, Canine Gdp-Ran F72y Mutant Length = 216 Back     alignment and structure
>pdb|1QBK|C Chain C, Structure Of The Karyopherin Beta2-ran Gppnhp Nuclear Transport Complex Length = 216 Back     alignment and structure
>pdb|1WMS|A Chain A, High Resolution Crystal Structure Of Human Rab9 Gtpase: A Novel Antiviral Drug Target Length = 177 Back     alignment and structure
>pdb|1WA5|A Chain A, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 176 Back     alignment and structure
>pdb|1S8F|A Chain A, Crystal Structure Of Rab9 Complexed To Gdp Reveals A Dimer With An Active Conformation Of Switch Ii Length = 177 Back     alignment and structure
>pdb|2BKU|A Chain A, Kap95p:rangtp Complex Length = 177 Back     alignment and structure
>pdb|3NC1|C Chain C, Crystal Structure Of The Crm1-Rangtp Complex Length = 182 Back     alignment and structure
>pdb|3RAN|A Chain A, Canine Gdp-Ran Q69l Mutant Length = 216 Back     alignment and structure
>pdb|3GJ4|A Chain A, Crystal Structure Of Human Rangdp-Nup153znf3 Complex Length = 221 Back     alignment and structure
>pdb|3NBY|C Chain C, Crystal Structure Of The Pki Nes-Crm1-Rangtp Nuclear Export Complex Length = 176 Back     alignment and structure
>pdb|1RRP|A Chain A, Structure Of The Ran-Gppnhp-Ranbd1 Complex Length = 204 Back     alignment and structure
>pdb|2OCB|A Chain A, Crystal Structure Of Human Rab9b In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|2HXS|A Chain A, Crystal Structure Of Rab28a Gtpase In The Inactive (Gdp-3'p- Bound) Form Length = 178 Back     alignment and structure
>pdb|3BRW|D Chain D, Structure Of The Rap-Rapgap Complex Length = 167 Back     alignment and structure
>pdb|4EPR|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4DSO|A Chain A, Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity Length = 189 Back     alignment and structure
>pdb|4DXA|A Chain A, Co-Crystal Structure Of Rap1 In Complex With Krit1 Length = 169 Back     alignment and structure
>pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp In Complex With The Ras- Binding-Domain Of C-Raf1 Kinase (Rafrbd) Length = 167 Back     alignment and structure
>pdb|1CLU|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|3M1I|A Chain A, Crystal Structure Of Yeast Crm1 (Xpo1p) In Complex With Yeas (Yrb1p) And Yeast Rangtp (Gsp1pgtp) Length = 219 Back     alignment and structure
>pdb|421P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|2WBL|C Chain C, Three-Dimensional Structure Of A Binary Rop-Prone Complex Length = 180 Back     alignment and structure
>pdb|1AGP|A Chain A, Three-Dimensional Structures And Properties Of A Transforming And A Nontransforming Gly-12 Mutant Of P21-H-Ras Length = 166 Back     alignment and structure
>pdb|2X19|A Chain A, Crystal Structure Of Importin13 - Rangtp Complex Length = 172 Back     alignment and structure
>pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Double Mutant (E30d,K31e) Complexed With Gppnhp And The Ras-Binding-Domain Of Human C-Raf1, Residues 51-131 Length = 167 Back     alignment and structure
>pdb|3ICQ|B Chain B, Karyopherin Nuclear State Length = 171 Back     alignment and structure
>pdb|1JAH|A Chain A, H-Ras P21 Protein Mutant G12p, Complexed With Guanosine-5'- [beta,Gamma-Methylene] Triphosphate And Magnesium Length = 166 Back     alignment and structure
>pdb|3KKP|A Chain A, Crystal Structure Of M-Ras P40d In Complex With Gppnhp Length = 183 Back     alignment and structure
>pdb|2NTY|C Chain C, Rop4-Gdp-Prone8 Length = 180 Back     alignment and structure
>pdb|3PIR|A Chain A, Crystal Structure Of M-Rasd41e In Complex With Gppnhp (Type 1) Length = 183 Back     alignment and structure
>pdb|3KKO|A Chain A, Crystal Structure Of M-Ras P40dD41EL51R IN COMPLEX WITH GP Length = 183 Back     alignment and structure
>pdb|3CLV|A Chain A, Crystal Structure Of Rab5a From Plasmodium Falciparum, Pfb0500c Length = 208 Back     alignment and structure
>pdb|4DJT|A Chain A, Crystal Structure Of A Nuclear Gtp-Binding Protein From Encephalitozoon Cuniculi Bound To Gdp-Mg2+ Length = 218 Back     alignment and structure
>pdb|3BWD|D Chain D, Crystal Structure Of The Plant Rho Protein Rop5 Length = 182 Back     alignment and structure
>pdb|2J1L|A Chain A, Crystal Structure Of Human Rho-Related Gtp-Binding Protein Rhod Length = 214 Back     alignment and structure
>pdb|3LW8|A Chain A, Shigella Ipgb2 In Complex With Human Rhoa, Gdp And Mg2+ (Complex A) Length = 185 Back     alignment and structure
>pdb|2J0V|A Chain A, The Crystal Structure Of Arabidopsis Thaliana Rac7-Rop9: The First Ras Superfamily Gtpase From The Plant Kingdom Length = 212 Back     alignment and structure
>pdb|1CXZ|A Chain A, Crystal Structure Of Human Rhoa Complexed With The Effector Domain Of The Protein Kinase PknPRK1 Length = 182 Back     alignment and structure
>pdb|1X1R|A Chain A, Crystal Structure Of M-Ras In Complex With Gdp Length = 178 Back     alignment and structure
>pdb|3KZ1|E Chain E, Crystal Structure Of The Complex Of Pdz-Rhogef DhPH DOMAINS WITH GTP- Gamma-S Activated Rhoa Length = 182 Back     alignment and structure
>pdb|1S1C|A Chain A, Crystal Structure Of The Complex Between The Human Rhoa And Rho-Binding Domain Of Human Rocki Length = 183 Back     alignment and structure
>pdb|4F38|A Chain A, Crystal Structure Of Geranylgeranylated Rhoa In Complex With Rhogdi In Its Active Gppnhp-Bound Form Length = 195 Back     alignment and structure
>pdb|1LB1|B Chain B, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 192 Back     alignment and structure
>pdb|3TVD|A Chain A, Crystal Structure Of Mouse Rhoa-Gtp Complex Length = 193 Back     alignment and structure
>pdb|1X86|B Chain B, Crystal Structure Of The DhPH DOMAINS OF LEUKEMIA-Associated Rhogef In Complex With Rhoa Length = 196 Back     alignment and structure
>pdb|3RAP|R Chain R, The Small G Protein Rap2 In A Non Catalytic Complex With Gtp Length = 167 Back     alignment and structure
>pdb|4EPX|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|4EPT|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|2KWI|A Chain A, Ralb-Rlip76 (Ralbp1) Complex Length = 178 Back     alignment and structure
>pdb|1LFD|B Chain B, Crystal Structure Of The Active Ras Protein Complexed With The Ras-interacting Domain Of Ralgds Length = 167 Back     alignment and structure
>pdb|2KE5|A Chain A, Solution Structure And Dynamics Of The Small Gtpase Ralb In Its Active Conformation: Significance For Effector Protein Binding Length = 174 Back     alignment and structure
>pdb|3KKM|A Chain A, Crystal Structure Of H-Ras T35s In Complex With Gppnhp Length = 172 Back     alignment and structure
>pdb|3DDC|A Chain A, Crystal Structure Of Nore1a In Complex With Ras Length = 166 Back     alignment and structure
>pdb|2BOV|A Chain A, Molecular Recognition Of An Adp-Ribosylating Clostridium Botulinum C3 Exoenzyme By Rala Gtpase Length = 206 Back     alignment and structure
>pdb|3GFT|A Chain A, Human K-Ras In Complex With A Gtp Analogue Length = 187 Back     alignment and structure
>pdb|4Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 189 Back     alignment and structure
>pdb|2FV8|A Chain A, The Crystal Structure Of Rhob In The Gdp-Bound State Length = 207 Back     alignment and structure
>pdb|3K9N|A Chain A, Allosteric Modulation Of H-Ras Gtpase Length = 166 Back     alignment and structure
>pdb|4EFM|A Chain A, Crystal Structure Of H-Ras G12v In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|4EFL|A Chain A, Crystal Structure Of H-Ras Wt In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|1XCG|B Chain B, Crystal Structure Of Human Rhoa In Complex With DhPH Fragment Of Pdzrhogef Length = 178 Back     alignment and structure
>pdb|1TX4|B Chain B, RhoRHOGAPGDP(DOT)ALF4 COMPLEX Length = 177 Back     alignment and structure
>pdb|1DPF|A Chain A, Crystal Structure Of A Mg-Free Form Of Rhoa Complexed With Gdp Length = 180 Back     alignment and structure
>pdb|221P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|3MSX|A Chain A, Crystal Structure Of Rhoa.Gdp.Mgf3 In Complex With Gap Domain Of Arhgap20 Length = 180 Back     alignment and structure
>pdb|1WQ1|R Chain R, Ras-Rasgap Complex Length = 166 Back     alignment and structure
>pdb|1RVD|A Chain A, H-Ras Complexed With Diaminobenzophenone-Beta,Gamma-Imido- Gtp Length = 166 Back     alignment and structure
>pdb|6Q21|A Chain A, Molecular Switch For Signal Transduction: Structural Differences Between Active And Inactive Forms Of Protooncogenic Ras Proteins Length = 171 Back     alignment and structure
>pdb|2Q21|A Chain A, Crystal Structures At 2.2 Angstroms Resolution Of The Catalytic Domains Of Normal Ras Protein And An Oncogenic Mutant Complexed With Gsp Length = 171 Back     alignment and structure
>pdb|2C5L|A Chain A, Structure Of Plc Epsilon Ras Association Domain With Hras Length = 173 Back     alignment and structure
>pdb|3CON|A Chain A, Crystal Structure Of The Human Nras Gtpase Bound With Gdp Length = 190 Back     alignment and structure
>pdb|3V4F|A Chain A, H-Ras Peg 400CACL2, ORDERED OFF Length = 166 Back     alignment and structure
>pdb|3A58|B Chain B, Crystal Structure Of Sec3p - Rho1p Complex From Saccharomyces Cerevisiae Length = 188 Back     alignment and structure
>pdb|1CC0|A Chain A, Crystal Structure Of The Rhoa.Gdp-Rhogdi Complex Length = 190 Back     alignment and structure
>pdb|2CL0|X Chain X, Crystal Structure Analysis Of A Fluorescent Form Of H-Ras P21 In Complex With Gppnhp Length = 166 Back     alignment and structure
>pdb|1OW3|B Chain B, Crystal Structure Of Rhoa.Gdp.Mgf3-In Complex With Rhogap Length = 193 Back     alignment and structure
>pdb|1IAQ|A Chain A, C-H-Ras P21 Protein Mutant With Thr 35 Replaced By Ser (T35s) Complexed With Guanosine-5'-[b,G-Imido] Triphosphate Length = 166 Back     alignment and structure
>pdb|2A78|A Chain A, Crystal Structure Of The C3bot-Rala Complex Reveals A Novel Type Of Action Of A Bacterial Exoenzyme Length = 187 Back     alignment and structure
>pdb|2ATX|A Chain A, Crystal Structure Of The Tc10 Gppnhp Complex Length = 194 Back     alignment and structure
>pdb|1UAD|A Chain A, Crystal Structure Of The Rala-gppnhp-sec5 Ral-binding Domain Complex Length = 175 Back     alignment and structure
>pdb|3LO5|A Chain A, Crystal Structure Of The Dominant Negative S17n Mutant Of Ras Length = 166 Back     alignment and structure
>pdb|2X1V|A Chain A, Crystal Structure Of The Activating H-Ras I163f Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|2QUZ|A Chain A, Crystal Structure Of The Activating H-Rask117r Mutant In Costello Syndrome, Bound To Mg-Gdp Length = 166 Back     alignment and structure
>pdb|3I3S|R Chain R, Crystal Structure Of H-Ras With Thr50 Replaced By Isoleucine Length = 166 Back     alignment and structure
>pdb|1HE1|C Chain C, Crystal Structure Of The Complex Between The Gap Domain Of The Pseudomonas Aeruginosa Exos Toxin And Human Rac Length = 176 Back     alignment and structure
>pdb|1LF0|A Chain A, Crystal Structure Of Rasa59g In The Gtp-Bound Form Length = 166 Back     alignment and structure
>pdb|521P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|3TH5|A Chain A, Crystal Structure Of Wild-Type Rac1 Length = 204 Back     alignment and structure
>pdb|1KMQ|A Chain A, Crystal Structure Of A Constitutively Activated Rhoa Mutant (Q63l) Length = 184 Back     alignment and structure
>pdb|2FJU|A Chain A, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 178 Back     alignment and structure
>pdb|2RGB|A Chain A, Crystal Structure Of H-Rasq61k-Gppnhp Length = 166 Back     alignment and structure
>pdb|621P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|1FOE|B Chain B, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 177 Back     alignment and structure
>pdb|3SUA|A Chain A, Crystal Structure Of The Intracellular Domain Of Plexin-B1 In Complex With Rac1 Length = 184 Back     alignment and structure
>pdb|2GCN|A Chain A, Crystal Structure Of The Human Rhoc-Gdp Complex Length = 201 Back     alignment and structure
>pdb|2YIN|C Chain C, Structure Of The Complex Between Dock2 And Rac1. Length = 196 Back     alignment and structure
>pdb|2GCO|A Chain A, Crystal Structure Of The Human Rhoc-gppnhp Complex Length = 201 Back     alignment and structure
>pdb|1NVV|Q Chain Q, Structural Evidence For Feedback Activation By Rasgtp Of The Ras-specific Nucleotide Exchange Factor Sos Length = 166 Back     alignment and structure
>pdb|3SBD|A Chain A, Crystal Structure Of Rac1 P29s Mutant Length = 187 Back     alignment and structure
>pdb|1U8Y|A Chain A, Crystal Structures Of Ral-Gppnhp And Ral-Gdp Reveal Two Novel Binding Sites That Are Also Present In Ras And Rap Length = 168 Back     alignment and structure
>pdb|3B13|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock2 In Complex With Rac1 (T17n Mutant) Length = 184 Back     alignment and structure
>pdb|1XCM|A Chain A, Crystal Structure Of The Gppnhp-Bound H-Ras G60a Mutant Length = 167 Back     alignment and structure
>pdb|1XJ0|A Chain A, Crystal Structure Of The Gdp-Bound Form Of The Rasg60a Mutant Length = 166 Back     alignment and structure
>pdb|4EFN|A Chain A, Crystal Structure Of H-Ras Q61l In Complex With Gppnhp (State 1) Length = 171 Back     alignment and structure
>pdb|1ZVQ|A Chain A, Structure Of The Q61g Mutant Of Ras In The Gdp-Bound Form Length = 166 Back     alignment and structure
>pdb|1ZW6|A Chain A, Crystal Structure Of The Gtp-Bound Form Of Rasq61g Length = 166 Back     alignment and structure
>pdb|721P|A Chain A, Three-Dimensional Structures Of H-Ras P21 Mutants: Molecular Basis For Their Inability To Function As Signal Switch Molecules Length = 166 Back     alignment and structure
>pdb|2RGC|A Chain A, Crystal Structure Of H-Rasq61v-Gppnhp Length = 166 Back     alignment and structure
>pdb|1XTQ|A Chain A, Structure Of Small Gtpase Human Rheb In Complex With Gdp Length = 177 Back     alignment and structure
>pdb|3REF|B Chain B, Crystal Structure Of Ehrho1 Bound To Gdp And Magnesium Length = 194 Back     alignment and structure
>pdb|2RGA|A Chain A, Crystal Structure Of H-Rasq61i-Gppnhp Length = 166 Back     alignment and structure
>pdb|3T5G|A Chain A, Structure Of Fully Modified Farnesylated Rheb In Complex With Pde6d Length = 181 Back     alignment and structure
>pdb|4GZM|A Chain A, Crystal Structure Of Rac1 F28l Mutant Length = 204 Back     alignment and structure
>pdb|1ZC3|A Chain A, Crystal Structure Of The Ral-Binding Domain Of Exo84 In Complex With The Active Rala Length = 175 Back     alignment and structure
>pdb|4DVG|A Chain A, Crystal Structure Of E. Histolytica Formin1 Bound To Ehrho1-Gtpgammas Length = 188 Back     alignment and structure
>pdb|2ERY|A Chain A, The Crystal Structure Of The Ras Related Protein Rras2 (Rras2) In The Gdp Bound State Length = 172 Back     alignment and structure
>pdb|2L0X|A Chain A, Solution Structure Of The 21 Kda Gtpase Rheb Bound To Gdp Length = 169 Back     alignment and structure
>pdb|3RYT|C Chain C, The Plexin A1 Intracellular Region In Complex With Rac1 Length = 180 Back     alignment and structure
>pdb|3SEA|A Chain A, Structure Of Rheb-Y35a Mutant In Gdp- And Gmppnp-Bound Forms Length = 167 Back     alignment and structure
>pdb|4GZL|A Chain A, Crystal Structure Of Rac1 Q61l Mutant Length = 204 Back     alignment and structure
>pdb|1MH1|A Chain A, Small G-Protein Length = 186 Back     alignment and structure
>pdb|2VRW|A Chain A, Critical Structural Role For The Ph And C1 Domains Of The Vav1 Exchange Factor Length = 184 Back     alignment and structure
>pdb|1I4D|D Chain D, Crystal Structure Analysis Of Rac1-Gdp Complexed With Arfaptin (P21) Length = 192 Back     alignment and structure
>pdb|2ATV|A Chain A, The Crystal Structure Of Human Rerg In The Gdp Bound State Length = 196 Back     alignment and structure
>pdb|1HH4|A Chain A, Rac1-Rhogdi Complex Involved In Nadph Oxidase Activation Length = 192 Back     alignment and structure
>pdb|2H7V|A Chain A, Co-crystal Structure Of Ypka-rac1 Length = 188 Back     alignment and structure
>pdb|1G4U|R Chain R, Crystal Structure Of The Salmonella Tyrosine Phosphatase And Gtpase Activating Protein Sptp Bound To Rac1 Length = 184 Back     alignment and structure
>pdb|1Z2C|A Chain A, Crystal Structure Of Mdia1 Gbd-Fh3 In Complex With Rhoc- Gmppnp Length = 193 Back     alignment and structure
>pdb|2WKR|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450m Mutant Length = 332 Back     alignment and structure
>pdb|2WKP|A Chain A, Structure Of A Photoactivatable Rac1 Containing Lov2 Wildtype Length = 332 Back     alignment and structure
>pdb|2WKQ|A Chain A, Structure Of A Photoactivatable Rac1 Containing The Lov2 C450a Mutant Length = 332 Back     alignment and structure
>pdb|2IC5|A Chain A, Crystal Structure Of Human Rac3 Grown In The Presence Of Gpp(Nh)p. Length = 180 Back     alignment and structure
>pdb|2G0N|A Chain A, The Crystal Structure Of The Human Rac3 In Complex With Gdp And Chloride Length = 179 Back     alignment and structure
>pdb|3OES|A Chain A, Crystal Structure Of The Small Gtpase Rhebl1 Length = 201 Back     alignment and structure
>pdb|2C2H|A Chain A, Crystal Structure Of The Human Rac3 In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|2ERX|A Chain A, Crystal Structure Of Diras2 In Complex With Gdp And Inorganic Phosphate Length = 172 Back     alignment and structure
>pdb|1DS6|A Chain A, Crystal Structure Of A Rac-Rhogdi Complex Length = 192 Back     alignment and structure
>pdb|2W2V|A Chain A, Rac2 (G12v) In Complex With Gtpgs Length = 184 Back     alignment and structure
>pdb|2W2T|A Chain A, Rac2 (G12v) In Complex With Gdp Length = 185 Back     alignment and structure
>pdb|1I4T|D Chain D, Crystal Structure Analysis Of Rac1-Gmppnp In Complex With Arfaptin Length = 192 Back     alignment and structure
>pdb|1E96|A Chain A, Structure Of The RacP67PHOX COMPLEX Length = 192 Back     alignment and structure
>pdb|1RYF|A Chain A, Alternative Splicing Of Rac1 Generates Rac1b, A Self-Activating Gtpase Length = 203 Back     alignment and structure
>pdb|2WM9|B Chain B, Structure Of The Complex Between Dock9 And Cdc42. Length = 190 Back     alignment and structure
>pdb|1DOA|A Chain A, Structure Of The Rho Family Gtp-Binding Protein Cdc42 In Complex With The Multifunctional Regulator Rhogdi Length = 191 Back     alignment and structure
>pdb|1KZ7|B Chain B, Crystal Structure Of The DhPH FRAGMENT OF MURINE DBS IN Complex With The Placental Isoform Of Human Cdc42 Length = 188 Back     alignment and structure
>pdb|2DFK|B Chain B, Crystal Structure Of The Cdc42-Collybistin Ii Complex Length = 194 Back     alignment and structure
>pdb|4DID|A Chain A, Crystal Structure Of Salmonella Effector N-Terminal Domain Sopb In Complex With Cdc42 Length = 193 Back     alignment and structure
>pdb|1GRN|A Chain A, Crystal Structure Of The Cdc42CDC42GAPALF3 COMPLEX. Length = 191 Back     alignment and structure
>pdb|2ODB|A Chain A, The Crystal Structure Of Human Cdc42 In Complex With The Crib Domain Of Human P21-Activated Kinase 6 (Pak6) Length = 192 Back     alignment and structure
>pdb|1AJE|A Chain A, Cdc42 From Human, Nmr, 20 Structures Length = 194 Back     alignment and structure
>pdb|3VHL|B Chain B, Crystal Structure Of The Dhr-2 Domain Of Dock8 In Complex With Cdc42 (T17n Mutant) Length = 195 Back     alignment and structure
>pdb|1EES|A Chain A, Solution Structure Of Cdc42hs Complexed With A Peptide Derived From P-21 Activated Kinase, Nmr, 20 Structures Length = 178 Back     alignment and structure
>pdb|1GZS|A Chain A, Crystal Structure Of The Complex Between The Gef Domain Of The Salmonella Typhimurium Sope Toxin And Human Cdc42 Length = 180 Back     alignment and structure
>pdb|2V55|B Chain B, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 200 Back     alignment and structure
>pdb|3EG5|A Chain A, Crystal Structure Of Mdia1-Tsh Gbd-Fh3 In Complex With Cdc42-Gmppnp Length = 178 Back     alignment and structure
>pdb|1GWN|A Chain A, The Crystal Structure Of The Core Domain Of RhoeRND3 - A Constitutively Activated Small G Protein Length = 205 Back     alignment and structure
>pdb|2FN4|A Chain A, The Crystal Structure Of Human Ras-Related Protein, Rras, In The Gdp- Bound State Length = 181 Back     alignment and structure
>pdb|1M7B|A Chain A, Crystal Structure Of Rnd3RHOE: FUNCTIONAL IMPLICATIONS Length = 184 Back     alignment and structure
>pdb|3QBV|A Chain A, Structure Of Designed Orthogonal Interaction Between Cdc42 And Nucleotide Exchange Domains Of Intersectin Length = 178 Back     alignment and structure
>pdb|2KB0|A Chain A, Cdc42(T35a) Length = 178 Back     alignment and structure
>pdb|2ASE|A Chain A, Nmr Structure Of The F28l Mutant Of Cdc42hs Length = 178 Back     alignment and structure
>pdb|2Q3H|A Chain A, The Crystal Structure Of Rhoua In The Gdp-bound State Length = 201 Back     alignment and structure
>pdb|2PMY|A Chain A, Ef-Hand Domain Of Human Rasef Length = 91 Back     alignment and structure
>pdb|3GCG|A Chain A, Crystal Structure Of Map And Cdc42 Complex Length = 182 Back     alignment and structure
>pdb|1CEE|A Chain A, Solution Structure Of Cdc42 In Complex With The Gtpase Binding Domain Of Wasp Length = 179 Back     alignment and structure
>pdb|1AN0|A Chain A, Cdc42hs-Gdp Complex Length = 190 Back     alignment and structure
>pdb|1A4R|B Chain B, G12v Mutant Of Human Placental Cdc42 Gtpase In The Gdp Form Length = 191 Back     alignment and structure
>pdb|2QRZ|A Chain A, Cdc42 Bound To Gmp-Pcp: Induced Fit By Effector Is Required Length = 189 Back     alignment and structure
>pdb|2YC2|C Chain C, Intraflagellar Transport Complex 25-27 From Chlamydomonas Length = 208 Back     alignment and structure
>pdb|1AM4|D Chain D, Complex Between Cdc42hs.Gmppnp And P50 Rhogap (H. Sapiens) Length = 177 Back     alignment and structure
>pdb|1NF3|A Chain A, Structure Of Cdc42 In A Complex With The Gtpase-Binding Domain Of The Cell Polarity Protein, Par6 Length = 195 Back     alignment and structure
>pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 Back     alignment and structure
>pdb|1CF4|A Chain A, Cdc42ACK GTPASE-Binding Domain Complex Length = 184 Back     alignment and structure
>pdb|2CLS|A Chain A, The Crystal Structure Of The Human Rnd1 Gtpase In The Active Gtp Bound State Length = 198 Back     alignment and structure
>pdb|3Q3J|B Chain B, Crystal Structure Of Plexin A2 Rbd In Complex With Rnd1 Length = 214 Back     alignment and structure
>pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 Back     alignment and structure
>pdb|2H18|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b (Arl10b) Length = 193 Back     alignment and structure
>pdb|3DOE|A Chain A, Complex Of Arl2 And Bart, Crystal Form 1 Length = 192 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|1KSH|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Native) Length = 186 Back     alignment and structure
>pdb|1KSG|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 1 Length = 186 Back     alignment and structure
>pdb|2GF0|A Chain A, The Crystal Structure Of The Human Diras1 Gtpase In The Inactive Gdp Bound State Length = 199 Back     alignment and structure
>pdb|2REX|B Chain B, Crystal Structure Of The Effector Domain Of Plxnb1 Bound With Rnd1 Gtpase Length = 197 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|1RE0|A Chain A, Structure Of Arf1-Gdp Bound To Sec7 Domain Complexed With Brefeldin A Length = 164 Back     alignment and structure
>pdb|3LRP|A Chain A, Crystal Structure Of Plasmodium Falciparum Adp-Ribosylation Factor 1 Length = 181 Back     alignment and structure
>pdb|1HUR|A Chain A, Human Adp-Ribosylation Factor 1 Complexed With Gdp, Full Length = 180 Back     alignment and structure
>pdb|1RRG|A Chain A, Non-Myristoylated Rat Adp-Ribosylation Factor-1 Complexed With Gdp, Dimeric Crystal Form Length = 181 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure
>pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 Back     alignment and structure
>pdb|1J2J|A Chain A, Crystal Structure Of Gga1 Gat N-terminal Region In Complex With Arf1 Gtp Form Length = 166 Back     alignment and structure
>pdb|1Z6X|A Chain A, Structure Of Human Adp-Ribosylation Factor 4 Length = 180 Back     alignment and structure
>pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Soaked With Calcium Length = 497 Back     alignment and structure
>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance By Agrobacterium Protein 6b Length = 184 Back     alignment and structure
>pdb|1KSJ|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Semet) Length = 186 Back     alignment and structure
>pdb|4GOJ|A Chain A, The Crystal Structure Of Full Length Arl3gppnhp In Complex With Unc119a Length = 189 Back     alignment and structure
>pdb|2B6H|A Chain A, Structure Of Human Adp-Ribosylation Factor 5 Length = 192 Back     alignment and structure
>pdb|1FZQ|A Chain A, Crystal Structure Of Murine Arl3-Gdp Length = 181 Back     alignment and structure
>pdb|4GOK|B Chain B, The Crystal Structure Of Arl2gppnhp In Complex With Unc119a Length = 169 Back     alignment and structure
>pdb|3RD1|A Chain A, Structure Of An Adp Ribosylation Factor From Entamoeba Histolytica Hm- 1:imss Bound To Mg-Gdp Length = 178 Back     alignment and structure
>pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By Human Arf6-Gtp Length = 175 Back     alignment and structure
>pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp Length = 174 Back     alignment and structure
>pdb|2KSQ|A Chain A, The Myristoylated Yeast Arf1 In A Gtp And Bicelle Bound Conformation Length = 181 Back     alignment and structure
>pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex Length = 160 Back     alignment and structure
>pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta13 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|3D6T|B Chain B, Structure Of The Roc Domain From The Parkinson's Disease-Associated Leucine-Rich Repeat Kinase 2 Reveals A Dimeric Gtpase Length = 171 Back     alignment and structure
>pdb|2ZEJ|A Chain A, Structure Of The Roc Domain From The Parkinson's Disease-associated Leucine-rich Repeat Kinase 2 Reveals A Dimeric Gtpase Length = 184 Back     alignment and structure
>pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex Length = 162 Back     alignment and structure
>pdb|3DPU|A Chain A, Roccor Domain Tandem Of Rab Family Protein (Roco) Length = 535 Back     alignment and structure
>pdb|2X77|A Chain A, Crystal Structure Of Leishmania Major Adp Ribosylation Factor-Like 1. Length = 189 Back     alignment and structure
>pdb|3CBQ|A Chain A, Crystal Structure Of The Human Rem2 Gtpase With Bound Gdp Length = 195 Back     alignment and structure
>pdb|2GAO|A Chain A, Crystal Structure Of Human Sar1a In Complex With Gdp Length = 208 Back     alignment and structure
>pdb|1R4A|A Chain A, Crystal Structure Of Gtp-Bound Adp-Ribosylation Factor Like Protein 1 (Arl1) And Grip Domain Of Golgin245 Complex Length = 165 Back     alignment and structure
>pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length = 175 Back     alignment and structure
>pdb|3VHX|A Chain A, The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesin-Like Protein 1) Complex Length = 172 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query593
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 3e-77
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 5e-65
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 7e-65
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 7e-65
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 1e-64
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 2e-64
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 2e-64
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 2e-64
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 7e-64
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 7e-64
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 9e-64
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 1e-63
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 2e-63
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 2e-63
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 3e-63
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 4e-63
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 4e-63
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 4e-63
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 4e-63
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 5e-63
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 6e-63
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 6e-63
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 7e-63
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 1e-62
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 1e-62
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 1e-62
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 2e-62
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 5e-62
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 7e-62
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 1e-61
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 1e-61
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 1e-61
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 2e-61
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 3e-61
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 3e-61
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 7e-61
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 1e-60
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 2e-60
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 5e-59
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 2e-58
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 4e-58
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 6e-58
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 3e-55
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 6e-54
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 2e-53
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 4e-53
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 7e-53
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 7e-53
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 8e-53
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 1e-52
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 2e-52
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 3e-52
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 4e-52
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 5e-52
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 6e-52
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 1e-51
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 2e-51
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 2e-50
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 3e-50
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 1e-49
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 1e-49
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 2e-49
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 1e-47
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 6e-47
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 6e-46
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 2e-45
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 7e-43
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 8e-42
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 5e-40
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 2e-38
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 5e-38
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 6e-38
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 1e-37
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 3e-37
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 5e-36
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 1e-35
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 2e-35
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 4e-35
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 1e-34
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 2e-34
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 4e-34
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 1e-33
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 4e-33
3t1o_A198 Gliding protein MGLA; G domain containing protein, 2e-29
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 2e-23
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 2e-18
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 2e-17
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 2e-15
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 3e-15
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 5e-15
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 1e-14
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 1e-14
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 1e-14
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 2e-14
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 2e-14
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 3e-14
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 1e-13
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 1e-13
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 2e-13
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 3e-13
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 3e-13
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 3e-13
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 4e-13
3llu_A196 RAS-related GTP-binding protein C; structural geno 6e-13
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 7e-13
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 9e-13
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-12
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-11
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 5e-04
2fh5_B214 SR-beta, signal recognition particle receptor beta 9e-11
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 1e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
2hps_A186 Coelenterazine-binding protein with bound coelent; 5e-10
3o47_A329 ADP-ribosylation factor GTPase-activating protein 5e-10
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 1e-09
2ged_A193 SR-beta, signal recognition particle receptor beta 7e-09
1nrj_B218 SR-beta, signal recognition particle receptor beta 2e-08
3li6_A66 Calcium-binding protein; calcium signaling protein 6e-08
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 6e-08
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-07
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-05
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 4e-07
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 7e-07
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 8e-07
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 8e-07
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-06
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 1e-06
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 2e-06
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 2e-06
1y1x_A191 Leishmania major homolog of programmed cell death 2e-06
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 2e-06
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-06
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 3e-06
3fwb_A161 Cell division control protein 31; gene gating, com 3e-06
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 3e-06
1exr_A148 Calmodulin; high resolution, disorder, metal trans 3e-06
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 4e-06
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 4e-06
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 4e-06
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 4e-06
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 4e-06
1avs_A90 Troponin C; muscle contraction, calcium-activated, 4e-06
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 5e-06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 5e-06
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 5e-06
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-05
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 6e-06
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-05
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 6e-04
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 7e-06
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 7e-06
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 7e-06
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 7e-06
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 7e-06
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 2e-05
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 7e-06
2jnf_A158 Troponin C; stretch activated muscle contraction, 8e-06
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 9e-06
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 9e-06
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 1e-05
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 1e-05
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 1e-05
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 1e-05
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-05
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 1e-05
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 1e-05
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 2e-05
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-05
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 2e-05
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 3e-05
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-04
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 3e-05
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 3e-05
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 4e-05
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 5e-05
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 5e-05
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 5e-05
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 5e-05
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 5e-05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 6e-05
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 6e-05
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 7e-05
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 5e-04
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 7e-05
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 8e-05
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 1e-04
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 5e-04
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 1e-04
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 2e-04
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 2e-04
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 2e-04
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 2e-04
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 2e-04
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 2e-04
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 2e-04
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 2e-04
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 3e-04
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 3e-04
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 3e-04
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 3e-04
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 3e-04
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 4e-04
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 4e-04
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 4e-04
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 4e-04
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 4e-04
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 6e-04
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 8e-04
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 8e-04
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 9e-04
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 9e-04
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
 Score =  242 bits (620), Expect = 3e-77
 Identities = 96/195 (49%), Positives = 133/195 (68%), Gaps = 2/195 (1%)

Query: 366 SNKSDSQSTPLLSLSNSLEPTGEPDRAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTL 425
           S+     S+ L+   ++   +    +A+KIV AGDAAVGKS F+ R  K  F   + +TL
Sbjct: 4   SHHHHHHSSGLVPRGSA--KSFSSQKAYKIVLAGDAAVGKSSFLMRLCKNEFRENISATL 61

Query: 426 GVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLLYDVTNERSFNSVKN 485
           GVDFQMKT+ VD     LQLWDTAGQERFRS+ K+YFR+ADGV+LLYDVT E+SF +++ 
Sbjct: 62  GVDFQMKTLIVDGERTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNIRE 121

Query: 486 WVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSG 545
           WV+ +E+    ++PI++  NK D+R  A  +G KC+    GEKLA  YGA+F ETS+K G
Sbjct: 122 WVDMIEDAAHETVPIMLVGNKADIRDTAATEGQKCVPGHFGEKLAMTYGALFCETSAKDG 181

Query: 546 DNILDALIALSRHVY 560
            NI++A++ L+R V 
Sbjct: 182 SNIVEAVLHLAREVK 196
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Length = 332 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Length = 255 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query593
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 100.0
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.97
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.96
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.96
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.96
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.96
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.96
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.96
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.96
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.96
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.96
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.96
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.96
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.96
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.96
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.96
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.96
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.96
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.96
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.96
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.96
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.96
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.96
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.96
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.96
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.96
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.96
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.96
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.96
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.96
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.96
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.96
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.96
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.96
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.96
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.96
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.96
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.96
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.96
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.96
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.96
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.96
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.96
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.96
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.96
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.96
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.96
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.96
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.95
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.95
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.95
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.95
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.95
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.95
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.95
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.95
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.95
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.95
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.95
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.95
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.95
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.95
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.95
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.95
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.95
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.95
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.95
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.95
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.95
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.95
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.95
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.94
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.94
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.94
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.94
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.94
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.94
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.94
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.94
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.94
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.94
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.94
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.94
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.94
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.94
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.93
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.93
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.93
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.93
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.93
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.93
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.93
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.93
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.93
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.93
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.92
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.92
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.92
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.92
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.86
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.91
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.91
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.91
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.9
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.9
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.9
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.9
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.9
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.9
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.9
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.89
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.89
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.89
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.89
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.88
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.88
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.88
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.88
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.87
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.87
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.86
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.86
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.85
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.85
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.85
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.84
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.84
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.84
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.83
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.83
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.83
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.82
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.82
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.81
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.81
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.81
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.81
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.8
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.8
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.79
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.79
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.78
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.77
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.77
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.77
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.77
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.76
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.76
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.76
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.76
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.76
2ged_A193 SR-beta, signal recognition particle receptor beta 99.75
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.74
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.74
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.73
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.73
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.73
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.73
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.73
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.73
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.72
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.72
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.72
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.71
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.71
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.7
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.7
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.69
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.69
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.68
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.67
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.66
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.66
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.66
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.65
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.65
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.64
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.64
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.62
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.62
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.61
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.61
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.6
1wxq_A 397 GTP-binding protein; structural genomics, riken st 99.6
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.58
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.57
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.57
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.56
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.56
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.55
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.54
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.53
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.5
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.48
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.47
2hf9_A226 Probable hydrogenase nickel incorporation protein 99.47
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.46
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.42
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.41
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.41
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.36
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 99.35
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 99.34
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.34
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.33
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.32
1c07_A95 Protein (epidermal growth factor receptor pathway 99.3
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.29
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.28
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.28
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.26
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.25
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.24
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.22
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.21
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.21
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.21
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.2
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.2
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.18
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 99.18
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.17
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.16
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.15
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.14
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.13
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.12
3fwb_A161 Cell division control protein 31; gene gating, com 99.12
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.12
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 99.11
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.06
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.04
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.03
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.03
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.03
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.02
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.01
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.01
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.0
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.99
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.99
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.99
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.98
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.97
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.97
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.96
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.96
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.96
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.96
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.96
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.95
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.95
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.95
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.95
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.95
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.94
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.94
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.94
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.94
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.93
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.93
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.93
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.92
1y1x_A191 Leishmania major homolog of programmed cell death 98.92
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.92
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.92
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.9
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.9
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.9
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.9
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.9
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.9
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.88
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.88
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.88
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.88
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.88
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.87
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.87
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.87
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.86
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.86
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.86
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.85
3li6_A66 Calcium-binding protein; calcium signaling protein 98.85
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.85
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.84
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.84
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.84
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.83
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.83
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.83
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.83
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.82
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.82
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.82
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.82
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.81
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.81
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.81
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.81
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.81
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.81
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.8
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.8
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.79
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.78
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.78
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.78
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.77
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.77
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.77
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.77
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.77
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 98.76
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.76
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.76
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.76
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.76
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.75
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.75
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.74
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.73
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.73
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.72
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.72
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.72
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.71
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.71
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.7
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.69
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.69
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.69
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.69
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.68
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.67
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.67
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.67
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.67
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.67
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.66
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.66
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.66
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.65
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.65
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.65
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.64
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.64
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.64
1y1x_A191 Leishmania major homolog of programmed cell death 98.63
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.63
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.63
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.62
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.62
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.61
3fwb_A161 Cell division control protein 31; gene gating, com 98.61
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 98.6
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.6
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.59
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.59
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.59
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.59
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.59
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.59
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.58
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.57
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.57
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.57
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.57
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.56
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.56
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.56
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.56
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.55
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.55
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.54
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.54
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.54
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.53
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.53
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.53
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.53
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.52
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.52
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.52
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.52
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.51
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.51
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.51
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.51
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.5
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.5
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.5
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.49
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.49
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.48
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.48
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.48
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.47
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.47
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.47
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.46
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.45
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.45
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.45
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.45
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.44
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.44
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.44
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 98.43
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.42
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.42
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.41
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.41
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.41
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.4
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 98.4
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.4
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.39
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 98.38
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.38
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.37
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.36
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.36
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.36
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.35
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.35
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.35
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 98.35
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.34
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.34
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.34
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.34
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.33
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.31
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.31
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.29
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.29
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.29
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.29
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.28
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.28
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.28
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.28
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.27
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.27
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.26
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.25
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.25
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.24
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 98.24
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.24
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.24
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.23
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.23
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.23
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.21
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.21
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 98.19
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.19
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.19
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.19
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.18
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.16
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.15
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 98.12
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.12
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.12
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.07
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 98.04
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.02
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 97.89
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.89
3a4u_B143 Multiple coagulation factor deficiency protein 2; 97.85
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 97.81
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 97.79
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.73
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 97.69
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.64
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 97.56
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 97.54
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.52
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.42
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.42
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.39
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.33
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.29
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 97.28
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.19
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 97.18
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 97.02
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.99
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.91
2xxa_A433 Signal recognition particle protein; protein trans 96.79
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.72
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.71
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.7
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 96.51
2lv7_A100 Calcium-binding protein 7; metal binding protein; 96.5
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=100.00  E-value=2.8e-34  Score=278.62  Aligned_cols=169  Identities=36%  Similarity=0.655  Sum_probs=145.8

Q ss_pred             CCcceEEEEEcCCCCcHHHHHHHHhcCccccCCCCccceeeEEEEEEECCeeEEEEEEecCCchhhhhhhHhhccCCCEE
Q psy8073         389 PDRAFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGV  468 (593)
Q Consensus       389 ~~~~~kI~ivG~~nvGKSSLln~l~~~~~~~~~~~t~g~~~~~~~~~~~~~~~~~~l~DTaG~e~~~~~~~~~~~~ad~v  468 (593)
                      +.+.+||+|+|++|||||||+++|+.+.|...+.+|+|.++..+.+.+++..+.++||||||+++|..++..|++.||++
T Consensus        10 P~k~~KivlvGd~~VGKTsLi~r~~~~~f~~~~~~Tig~d~~~k~~~~~~~~v~l~iwDtaGqe~~~~l~~~~~~~a~~~   89 (216)
T 4dkx_A           10 PLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGLERFRSLIPSYIRDSAAA   89 (216)
T ss_dssp             ---CEEEEEECSTTSSHHHHHHHHHHSCCC----------CEEEEEECSSCEEEEEEECCSCTTTCGGGHHHHHTTCSEE
T ss_pred             CCCcEEEEEECcCCcCHHHHHHHHHhCCCCCCcCCccceEEEEEEEEecceEEEEEEEECCCchhhhhHHHHHhccccEE
Confidence            45679999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeCCChhcHHHHHHHHHHHHHHcCCCCcEEEEEeCCCCCCccccccccccCHHHHHHHHHHhCCeEEEEcCCCCCCH
Q psy8073         469 MLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNI  548 (593)
Q Consensus       469 i~v~D~~~~~s~~~~~~~~~~i~~~~~~~~piivV~NK~Dl~~~~~~~~~~~v~~~~~~~l~~~~~~~~~e~Sa~~g~gi  548 (593)
                      |+|||++++.||..+..|+..+......++|+||||||+|+...      +.|..+++..+++.+++.|++|||++|.||
T Consensus        90 ilv~di~~~~Sf~~i~~~~~~i~~~~~~~~piilVgNK~Dl~~~------r~V~~~e~~~~a~~~~~~~~e~SAktg~nV  163 (216)
T 4dkx_A           90 VVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADK------RQVSIEEGERKAKELNVMFIETSAKAGYNV  163 (216)
T ss_dssp             EEEEETTCHHHHHTHHHHHHHHHHHHTTSSEEEEEEECTTCGGG------CCSCHHHHHHHHHHHTCEEEEEBTTTTBSH
T ss_pred             EEEeecchhHHHHHHHHHHHHHHHhcCCCCeEEEEeeccchHhc------CcccHHHHhhHHHHhCCeeEEEeCCCCcCH
Confidence            99999999999999999999998888778999999999999754      668999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhhc
Q psy8073         549 LDALIALSRHVYVFI  563 (593)
Q Consensus       549 ~~l~~~L~~~l~~~~  563 (593)
                      +++|..|++.+....
T Consensus       164 ~e~F~~i~~~i~~~~  178 (216)
T 4dkx_A          164 KQLFRRVAAALPGME  178 (216)
T ss_dssp             HHHHHHHHHHC----
T ss_pred             HHHHHHHHHHHHhhh
Confidence            999999999886543
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 593
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 8e-41
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 8e-41
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 3e-37
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 5e-37
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 1e-36
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 3e-35
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 5e-34
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 1e-33
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 4e-32
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 7e-32
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 7e-31
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 8e-31
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 1e-28
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 3e-28
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 1e-27
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 2e-27
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 2e-27
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 4e-27
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 1e-26
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 2e-26
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 4e-26
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 7e-26
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 8e-26
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9e-26
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-24
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 3e-24
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 4e-24
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 7e-24
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 8e-24
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 1e-23
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 1e-22
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 2e-22
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 3e-22
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 3e-22
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 4e-22
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 2e-21
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 5e-21
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 6e-21
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 6e-21
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 7e-21
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 5e-20
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 3e-19
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 2e-18
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 1e-17
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 1e-16
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-16
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 3e-16
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 1e-15
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 2e-15
d2atva1168 c.37.1.8 (A:5-172) Ras-like estrogen-regulated gro 3e-15
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 2e-14
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 2e-13
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 2e-12
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 3e-12
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 4e-12
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 6e-11
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 7e-08
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-07
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 1e-07
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 1e-07
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 2e-07
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-07
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 3e-07
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-07
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 3e-07
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 3e-07
d2sasa_185 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 3e-07
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 6e-07
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 7e-07
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 8e-07
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 9e-07
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 1e-06
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-06
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 2e-06
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 3e-06
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 3e-06
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 4e-06
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 5e-06
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 8e-06
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 1e-05
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 2e-05
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 2e-05
d1qjta_99 a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 3e-05
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 3e-05
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 7e-05
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 7e-05
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 8e-05
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 9e-05
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 9e-05
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 9e-05
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 1e-04
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 1e-04
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 2e-04
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 3e-04
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 5e-04
d1iq3a_110 a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9 7e-04
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 0.001
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 0.001
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.002
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 0.002
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 0.002
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 0.002
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 0.003
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 0.003
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 0.003
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 0.004
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 0.004
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.004
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab-related protein Sec4
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  143 bits (362), Expect = 8e-41
 Identities = 62/168 (36%), Positives = 108/168 (64%), Gaps = 7/168 (4%)

Query: 393 FKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQE 452
            KI+  GD+ VGKSC + RF ++ F     +T+G+DF++KT+ ++ + V LQ+WDTAGQE
Sbjct: 3   MKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQIWDTAGQE 62

Query: 453 RFRSMTKNYFRRADGVMLLYDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRAD 512
           RFR++T  Y+R A G++L+YD+T+ER+F ++K W + V E   +   +++  NK D+   
Sbjct: 63  RFRTITTAYYRGAMGIILVYDITDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDME-- 120

Query: 513 AQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDALIALSRHVY 560
                 + +  + GE LA++ G  F+E+S+K+ DN+ +    L++ + 
Sbjct: 121 -----TRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQ 163
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query593
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.97
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.97
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.97
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.97
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.97
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.97
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.97
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.97
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.97
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.97
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.96
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.96
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.96
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.96
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.96
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.95
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.95
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.94
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.93
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.93
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.93
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.92
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.91
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.89
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.87
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.86
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.86
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.85
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.85
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.84
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.84
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.84
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.83
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.82
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.82
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.82
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.81
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.79
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.78
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.77
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.77
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.77
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.72
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.71
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.71
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.69
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.67
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.64
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.62
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.6
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.59
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.44
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.44
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.44
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.4
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.35
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.34
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.34
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.31
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.3
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 99.26
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.25
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.25
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.25
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.22
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.21
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.21
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 99.21
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.2
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.2
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.2
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.18
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.17
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.17
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.16
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.16
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 99.16
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.12
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.11
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.1
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.1
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.09
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.07
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.04
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.02
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.01
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.98
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.98
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.97
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.97
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.96
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.96
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.95
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.94
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.94
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.92
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.92
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.88
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.83
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.8
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.8
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.79
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.77
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.75
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.75
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.75
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.75
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.75
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.74
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.74
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.73
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.73
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.72
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.72
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.7
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.68
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.67
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.67
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.67
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.66
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.65
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.65
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.64
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.64
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.63
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.63
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.62
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.61
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.56
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.56
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.56
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.55
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.55
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.48
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.46
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.45
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.43
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.39
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.39
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.37
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.37
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.37
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.35
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.33
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.32
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.32
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.32
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.32
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.32
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.29
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.29
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.28
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.28
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.27
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.23
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.23
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.19
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.19
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.18
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.17
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.12
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.1
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.09
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.07
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.06
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.02
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.0
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.0
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.99
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.99
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 97.99
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.97
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.97
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.89
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 97.89
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.85
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.81
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.81
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.71
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.69
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 97.68
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.66
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.65
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 97.57
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.55
d1vmaa2213 GTPase domain of the signal recognition particle r 97.52
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.44
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 97.43
d2qy9a2211 GTPase domain of the signal recognition particle r 97.43
d1okkd2207 GTPase domain of the signal recognition particle r 97.42
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.31
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.24
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.01
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.98
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.9
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.82
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 96.8
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 96.76
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.7
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 96.69
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.65
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.59
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 96.58
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.53
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 96.51
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.5
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 96.36
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.33
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.28
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.23
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.2
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.12
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.01
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.99
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 95.93
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.84
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 95.81
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.8
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 95.8
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.63
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.52
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.52
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.48
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 95.46
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.42
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.35
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 95.3
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.28
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.23
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.22
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 95.17
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.15
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.14
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.11
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.1
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 95.1
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.05
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.96
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.86
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.82
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 94.77
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.71
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 94.63
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.61
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 94.58
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 94.56
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.45
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.35
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 94.29
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 94.25
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.24
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.17
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 94.14
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 94.13
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.12
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 94.08
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.98
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 93.97
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 93.96
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.95
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 93.95
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.93
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 93.88
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.86
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.82
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.79
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.77
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.67
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.66
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.64
d2awna2232 Maltose transport protein MalK, N-terminal domain 93.63
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 93.6
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.53
d2hyda1255 Putative multidrug export ATP-binding/permease pro 93.51
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 93.44
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.36
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.29
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 93.29
d1g2912240 Maltose transport protein MalK, N-terminal domain 93.28
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 93.27
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.09
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.02
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 93.01
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.89
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 92.81
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 92.75
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 92.72
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.69
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 92.57
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.46
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 92.25
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.22
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.11
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.04
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 92.04
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.93
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.74
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 91.72
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 91.7
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.62
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.54
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 91.24
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 91.21
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 90.9
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 90.79
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.68
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.54
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 90.54
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 90.39
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 90.21
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 90.09
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 90.07
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 90.04
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 89.8
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 89.58
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 89.48
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 89.42
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 89.22
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.22
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 89.18
d1svma_362 Papillomavirus large T antigen helicase domain {Si 89.1
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 89.01
d1tuea_205 Replication protein E1 helicase domain {Human papi 88.49
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 88.42
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 87.92
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 87.62
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 87.2
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 87.16
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 87.07
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 86.85
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 86.77
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 86.31
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 86.21
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 86.2
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 86.18
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 86.17
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 86.11
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 85.85
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 85.84
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 85.74
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 85.69
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 85.45
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 85.23
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 85.23
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 85.06
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 84.75
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 84.71
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 84.64
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 84.49
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 84.37
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 84.05
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 84.04
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 83.95
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 83.2
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 83.0
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 82.53
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 82.41
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 82.37
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 81.91
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 81.91
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 81.8
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 81.25
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 81.2
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 81.11
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 80.71
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 80.68
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 80.53
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 80.11
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab23
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.97  E-value=2.6e-31  Score=244.56  Aligned_cols=162  Identities=38%  Similarity=0.658  Sum_probs=151.0

Q ss_pred             ceEEEEEcCCCCcHHHHHHHHhcCccccCCCCccceeeEEEEEEECCeeEEEEEEecCCchhhhhhhHhhccCCCEEEEE
Q psy8073         392 AFKIVFAGDAAVGKSCFIYRFSKEVFLNKLGSTLGVDFQMKTIRVDERNVALQLWDTAGQERFRSMTKNYFRRADGVMLL  471 (593)
Q Consensus       392 ~~kI~ivG~~nvGKSSLln~l~~~~~~~~~~~t~g~~~~~~~~~~~~~~~~~~l~DTaG~e~~~~~~~~~~~~ad~vi~v  471 (593)
                      .+||+|+|++|||||||+++|+++.|...+.+|+|.++.......++..+.+.+|||+|++++..+...+++.||++++|
T Consensus         2 ~iKv~liG~~~vGKSsLi~rl~~~~~~~~~~~ti~~~~~~~~~~~~~~~~~~~i~d~~g~~~~~~~~~~~~~~~~~~i~v   81 (164)
T d1z2aa1           2 AIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLV   81 (164)
T ss_dssp             EEEEEEECSTTSSHHHHHHHHHHCCCCCCSSCCCSSSEEEEEEEETTEEEEEEEECCTTGGGTTCCCHHHHTTCCEEEEE
T ss_pred             eEEEEEECCCCcCHHHHHHHHHhCCCCcccccccccccceeeeeecCceeeeeeeccCCccchhhhhhhhhccCceEEEE
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCChhcHHHHHHHHHHHHHHcCCCCcEEEEEeCCCCCCccccccccccCHHHHHHHHHHhCCeEEEEcCCCCCCHHHH
Q psy8073         472 YDVTNERSFNSVKNWVEAVEEVTENSIPIVICANKVDLRADAQAKGVKCIDREVGEKLAQQYGAIFMETSSKSGDNILDA  551 (593)
Q Consensus       472 ~D~~~~~s~~~~~~~~~~i~~~~~~~~piivV~NK~Dl~~~~~~~~~~~v~~~~~~~l~~~~~~~~~e~Sa~~g~gi~~l  551 (593)
                      ||++++.||+.+..|++.+....+ ++|+||||||+|+...      +.+..++++.+++.++++|++|||++|.||+++
T Consensus        82 ~d~~~~~s~~~~~~~~~~i~~~~~-~~~iilVgnK~Dl~~~------~~v~~~~~~~~~~~~~~~~~e~Sak~g~~v~e~  154 (164)
T d1z2aa1          82 FSTTDRESFEAISSWREKVVAEVG-DIPTALVQNKIDLLDD------SCIKNEEAEGLAKRLKLRFYRTSVKEDLNVSEV  154 (164)
T ss_dssp             EETTCHHHHHTHHHHHHHHHHHHC-SCCEEEEEECGGGGGG------CSSCHHHHHHHHHHHTCEEEECBTTTTBSSHHH
T ss_pred             EeccchhhhhhcccccccccccCC-CceEEEeeccCCcccc------eeeeehhhHHHHHHcCCEEEEeccCCCcCHHHH
Confidence            999999999999999999987665 4899999999999654      568888999999999999999999999999999


Q ss_pred             HHHHHHHHH
Q psy8073         552 LIALSRHVY  560 (593)
Q Consensus       552 ~~~L~~~l~  560 (593)
                      |..|++.+.
T Consensus       155 f~~l~~~~l  163 (164)
T d1z2aa1         155 FKYLAEKHL  163 (164)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHh
Confidence            999998764
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure