Psyllid ID: psy8107
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1613 | 2.2.26 [Sep-21-2011] | |||||||
| P91620 | 2061 | Protein still life, isofo | no | N/A | 0.475 | 0.372 | 0.773 | 0.0 | |
| P91621 | 2072 | Protein still life, isofo | no | N/A | 0.469 | 0.365 | 0.763 | 0.0 | |
| Q8IVF5 | 1701 | T-lymphoma invasion and m | yes | N/A | 0.534 | 0.506 | 0.350 | 1e-145 | |
| Q60610 | 1591 | T-lymphoma invasion and m | yes | N/A | 0.446 | 0.452 | 0.385 | 1e-143 | |
| Q6ZPF3 | 1715 | T-lymphoma invasion and m | no | N/A | 0.521 | 0.490 | 0.341 | 1e-139 | |
| O88576 | 615 | Sodium-dependent neutral | no | N/A | 0.212 | 0.557 | 0.439 | 8e-96 | |
| Q62687 | 615 | Sodium-dependent neutral | no | N/A | 0.206 | 0.541 | 0.449 | 2e-95 | |
| Q695T7 | 634 | Sodium-dependent neutral | no | N/A | 0.204 | 0.520 | 0.452 | 6e-95 | |
| Q5R6J1 | 634 | Sodium-dependent neutral | no | N/A | 0.204 | 0.520 | 0.460 | 6e-95 | |
| Q2A865 | 634 | Sodium-dependent neutral | no | N/A | 0.210 | 0.536 | 0.457 | 1e-94 |
| >sp|P91620|SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster GN=sif PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 1203 bits (3113), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 602/778 (77%), Positives = 673/778 (86%), Gaps = 11/778 (1%)
Query: 1 FLSVKKWLLRKKHQIELARKRGWKGYWVCLKGTTLLFYPCDSREGRSVDAAPKHLIIVDG 60
FLSVKKWLLRKKHQIELARKRGWKGYWVCLKGTTLLFYPCDSREGRSV+AAPKHLIIVDG
Sbjct: 828 FLSVKKWLLRKKHQIELARKRGWKGYWVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDG 887
Query: 61 AIMQPIPEHPKRDYIFCLSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGT 120
AIMQPIPEHPKRDYIFCLSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGT
Sbjct: 888 AIMQPIPEHPKRDYIFCLSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGT 947
Query: 121 LHLLQEEIFRLEKAIDSDNKLKHMADLQMSVLAEPETKQQINEQITQWEENLERLHCEQF 180
LHLLQEEIFRLEKAI+SD+KLKHMA+LQ SV+ + ET+ QI QI QWEENLERLHCEQF
Sbjct: 948 LHLLQEEIFRLEKAIESDHKLKHMAELQQSVVTDQETRHQIQTQILQWEENLERLHCEQF 1007
Query: 181 RLRCYMASLQNGELPNPKSLLTHVSRNTKCILNNLGVFTVSSFHAFICARSPSLLNNLLA 240
RLRCYMASLQ+GELPNPKSLLTHVSR TK LN LGVFTVSSFHAFICARSPSLLNNLLA
Sbjct: 1008 RLRCYMASLQSGELPNPKSLLTHVSRPTKNTLNKLGVFTVSSFHAFICARSPSLLNNLLA 1067
Query: 241 GRGATKRRPPLLSRSNSGSSRRSLQSASSRDEPDKSVKVSLPENQYAHVYLKDSMTVEEF 300
GRGATKRRPP+LSRSNSGSSRRS+Q +SRDEP+K+ KV++P+N Y+ VYL+D+M+VEEF
Sbjct: 1068 GRGATKRRPPMLSRSNSGSSRRSMQ-MNSRDEPEKTFKVAMPDNAYSTVYLRDAMSVEEF 1126
Query: 301 LANACSRKNLNPMEHFVRVKKRREMEDHNYFVPPRGDLIETYLSTHEVVEVCAKILYQVE 360
LA+AC+R+NLNPMEHFVRVKKRR+MEDHNYFVP R DLIE YL HE VEVC KILYQVE
Sbjct: 1127 LASACARRNLNPMEHFVRVKKRRDMEDHNYFVPHRNDLIENYLHNHEFVEVCMKILYQVE 1186
Query: 361 LQRTTLDHMWGFSVEAELTENAERQDELCCYVSRVEDKSVAMHNGLIKGDEIMVINGAIV 420
LQRTTL+ MWGFSVEAEL ENAERQDELCCYVSRVEDKSVAMHNG+IKGDEIMVINGAIV
Sbjct: 1187 LQRTTLEQMWGFSVEAELIENAERQDELCCYVSRVEDKSVAMHNGIIKGDEIMVINGAIV 1246
Query: 421 SDLDMMYLESVLQEELSLCMMMRSSRTEPPETAGSGMLSATDDMIESLVCPPPPSDPPMI 480
SDLDMMYLESVLQEE SL MMMRSSRTEPP+ G++ TDDMI+SLVCPPPP+DPP++
Sbjct: 1247 SDLDMMYLESVLQEEQSLSMMMRSSRTEPPDLV--GIMRVTDDMIDSLVCPPPPTDPPVM 1304
Query: 481 SEEMICDLIVPAPSWSKEHNI-----SEQPPEKVKMPGSLYNRDLLMSNNNNSSTINNNN 535
SEEMI LIVPAP W+ +E P + + L +
Sbjct: 1305 SEEMITGLIVPAPGWNGTSKDLYSPEAESSPATSFVDPAAMAAQLAVGGVGGVVVGGLGV 1364
Query: 536 VNSNNKGETYEIENLIKSAGEVTGFCRSPVETHRTSPTGSMANQ---SSLNPSRQLTDAE 592
++ ++EIENL+K+A +VTGFCRSP ET ++SPTGS+ + ++L PSRQLTDAE
Sbjct: 1365 AKPTSRTSSFEIENLLKTAEQVTGFCRSPQETRKSSPTGSVTSSVSTTALTPSRQLTDAE 1424
Query: 593 KLSKVIIELIETERTYVKNLNGLLENYLEPLKKETFLSGAEINALFGNILEIVAFQRQFL 652
KL KV++EL++TERTYVK+LN LLE+YLEP+K+ETFLS AEINALFGNI EIV FQRQFL
Sbjct: 1425 KLRKVVMELVDTERTYVKHLNNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFL 1484
Query: 653 QNLVEALENEADFHHFDQSSQFKNILFSIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPN 712
QNL E+L+ E DF+ F+ QF+N+LF+IGSAFLYYVNHFKLYSSFCASHSKAQKVLHPN
Sbjct: 1485 QNLEESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPN 1544
Query: 713 EGNQALQEFLSSRNPRQQHSSTLESYLIKPIQRILKYPLLLQQLCNLTDPHCDEHLHL 770
EGN ALQEFL++RNP+QQHSSTLESYLIKPIQRILKYPLLLQQ+ NLTD DEH+HL
Sbjct: 1545 EGNHALQEFLAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHL 1602
|
Regulates synaptic differentiation through the organization of actin cytoskeleton possibly by activating Rho-like GTPases. Is likely a factor in the cascade of Rac1 or Cdc42 in the neurons. Drosophila melanogaster (taxid: 7227) |
| >sp|P91621|SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster GN=sif PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 | Back alignment and function description |
|---|
| >sp|Q60610|TIAM1_MOUSE T-lymphoma invasion and metastasis-inducing protein 1 OS=Mus musculus GN=Tiam1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O88576|S6A18_MOUSE Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Mus musculus GN=Slc6a18 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q62687|S6A18_RAT Sodium-dependent neutral amino acid transporter B(0)AT3 OS=Rattus norvegicus GN=Slc6a18 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q695T7|S6A19_HUMAN Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Homo sapiens GN=SLC6A19 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5R6J1|S6A19_PONAB Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Pongo abelii GN=SLC6A19 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q2A865|S6A19_RAT Sodium-dependent neutral amino acid transporter B(0)AT1 OS=Rattus norvegicus GN=Slc6a19 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1613 | ||||||
| 158296115 | 2959 | AGAP006590-PA [Anopheles gambiae str. PE | 0.468 | 0.255 | 0.803 | 0.0 | |
| 158296113 | 2736 | AGAP006590-PB [Anopheles gambiae str. PE | 0.468 | 0.275 | 0.803 | 0.0 | |
| 189237416 | 2043 | PREDICTED: similar to AGAP006590-PD [Tri | 0.462 | 0.365 | 0.797 | 0.0 | |
| 158296109 | 2038 | AGAP006590-PD [Anopheles gambiae str. PE | 0.468 | 0.370 | 0.803 | 0.0 | |
| 158296111 | 2264 | AGAP006590-PC [Anopheles gambiae str. PE | 0.468 | 0.333 | 0.803 | 0.0 | |
| 270007036 | 1453 | hypothetical protein TcasGA2_TC013483 [T | 0.462 | 0.513 | 0.797 | 0.0 | |
| 170060704 | 1819 | still life [Culex quinquefasciatus] gi|1 | 0.466 | 0.413 | 0.791 | 0.0 | |
| 442630405 | 2646 | still life, isoform K [Drosophila melano | 0.475 | 0.289 | 0.773 | 0.0 | |
| 442630401 | 1270 | still life, isoform L [Drosophila melano | 0.475 | 0.603 | 0.773 | 0.0 | |
| 157105282 | 2068 | still life, putative [Aedes aegypti] gi| | 0.462 | 0.360 | 0.791 | 0.0 |
| >gi|158296115|ref|XP_001688924.1| AGAP006590-PA [Anopheles gambiae str. PEST] gi|157016358|gb|EDO63930.1| AGAP006590-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Score = 1234 bits (3192), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 622/774 (80%), Positives = 682/774 (88%), Gaps = 19/774 (2%)
Query: 1 FLSVKKWLLRKKHQIELARKRGWKGYWVCLKGTTLLFYPCDSREGRSVDAAPKHLIIVDG 60
FLSVKKWLLRKKHQIELARKRGWKGYWVCLKGTTLLFYPCDSREGRSV+AAPKHLIIVDG
Sbjct: 1114 FLSVKKWLLRKKHQIELARKRGWKGYWVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDG 1173
Query: 61 AIMQPIPEHPKRDYIFCLSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGT 120
AIMQPIPEHPKRDYIFCLSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGT
Sbjct: 1174 AIMQPIPEHPKRDYIFCLSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGT 1233
Query: 121 LHLLQEEIFRLEKAIDSDNKLKHMADLQMSVLAEPETKQQINEQITQWEENLERLHCEQF 180
LHLLQEEIFRLEKAI+SD+KLKHMADLQ SV+ + +T+ QI +QI QWEENLERLHCEQF
Sbjct: 1234 LHLLQEEIFRLEKAIESDHKLKHMADLQQSVVTDADTRHQIQQQILQWEENLERLHCEQF 1293
Query: 181 RLRCYMASLQNGELPNPKSLLTHVSRNTKCILNNLGVFTVSSFHAFICARSPSLLNNLLA 240
RLRCYMASLQNGELPNPKSLLTHVSR TK LN LGVFTVSSFHAFICARSPSLLNNLLA
Sbjct: 1294 RLRCYMASLQNGELPNPKSLLTHVSRPTKNTLNKLGVFTVSSFHAFICARSPSLLNNLLA 1353
Query: 241 GRGATKRRPPLLSRSNSGSSRRSLQSASSRDEPDKSVKVSLPENQYAHVYLKDSMTVEEF 300
GRGATKRRPP+LSRSNSGSSRRS+Q +SRDEP+KS KV+LPEN +A VYL++ M+VEEF
Sbjct: 1354 GRGATKRRPPILSRSNSGSSRRSMQ-INSRDEPEKSYKVALPENTFATVYLREGMSVEEF 1412
Query: 301 LANACSRKNLNPMEHFVRVKKRREMEDHNYFVPPRGDLIETYLSTHEVVEVCAKILYQVE 360
LA+ACSRKNLNPMEHFVRVKKRR+MEDHNYFVP R DLIETYL THEVVEVCAKILYQVE
Sbjct: 1413 LASACSRKNLNPMEHFVRVKKRRDMEDHNYFVPHRNDLIETYLHTHEVVEVCAKILYQVE 1472
Query: 361 LQRTTLDHMWGFSVEAELTENAERQDELCCYVSRVEDKSVAMHNGLIKGDEIMVINGAIV 420
LQRTTL+ MWGFSVEAEL ENA+RQDELCCYVSRVEDKSVAM NG+IKGDEI+VINGAIV
Sbjct: 1473 LQRTTLEQMWGFSVEAELIENADRQDELCCYVSRVEDKSVAMQNGVIKGDEIIVINGAIV 1532
Query: 421 SDLDMMYLESVLQEELSLCMMMRSSRTEPPETAGSGMLSATDDMIESLVCPPPPSDPPMI 480
SDLDMMYLESVLQEE +LCMMMRSSRTEPP+ G++ +TDD+IESLVCPPPPSDPP+I
Sbjct: 1533 SDLDMMYLESVLQEEQALCMMMRSSRTEPPDLV--GIMRSTDDIIESLVCPPPPSDPPVI 1590
Query: 481 SEEMICDLIVPAPSWSKEHNISEQPPEKVKMPGSLYNRDLLMSNNNNSSTINNNNVNSNN 540
SEEMI LIVPAP W KE PE P N L+S + + + +
Sbjct: 1591 SEEMISGLIVPAPGWRKE----VYSPEVESSPAPSSNDPHLLSMDRSKPS---------S 1637
Query: 541 KGETYEIENLIKSAGEVTGFCRSPVETHRTSPTGSMANQSS---LNPSRQLTDAEKLSKV 597
+ ++EIENL+KSA +VTGFCRSP ET ++SPTGS+A+ S L PSRQLTDAEKL KV
Sbjct: 1638 RTSSFEIENLLKSAEQVTGFCRSPQETRKSSPTGSVASSVSNVMLTPSRQLTDAEKLRKV 1697
Query: 598 IIELIETERTYVKNLNGLLENYLEPLKKETFLSGAEINALFGNILEIVAFQRQFLQNLVE 657
I+EL++TE++YVK+LN LLE YLEPLK+ETFLS AEI ALFGNI EIV FQRQFL NL E
Sbjct: 1698 ILELVDTEKSYVKHLNNLLEYYLEPLKRETFLSNAEITALFGNIQEIVTFQRQFLNNLEE 1757
Query: 658 ALENEADFHHFDQSSQFKNILFSIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPNEGNQA 717
AL+ E DFH + SQFKN+LF+IGSAFLYYVNHFKLYSSFCASHSKAQKVLHPNEGNQA
Sbjct: 1758 ALDLEPDFHQLEHPSQFKNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPNEGNQA 1817
Query: 718 LQEFLSSRNPRQQHSSTLESYLIKPIQRILKYPLLLQQLCNLTDPHCDEHLHLV 771
LQEFL++RNP+QQHSSTLES+LIKPIQRILKYPLLLQQL NLTDP+ EHLHLV
Sbjct: 1818 LQEFLAARNPKQQHSSTLESFLIKPIQRILKYPLLLQQLRNLTDPNAAEHLHLV 1871
|
Source: Anopheles gambiae str. PEST Species: Anopheles gambiae Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|158296113|ref|XP_316614.4| AGAP006590-PB [Anopheles gambiae str. PEST] gi|157016357|gb|EAA11675.5| AGAP006590-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|189237416|ref|XP_001815363.1| PREDICTED: similar to AGAP006590-PD [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|158296109|ref|XP_316615.4| AGAP006590-PD [Anopheles gambiae str. PEST] gi|157016355|gb|EAA44262.4| AGAP006590-PD [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|158296111|ref|XP_001688923.1| AGAP006590-PC [Anopheles gambiae str. PEST] gi|157016356|gb|EDO63929.1| AGAP006590-PC [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|270007036|gb|EFA03484.1| hypothetical protein TcasGA2_TC013483 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|170060704|ref|XP_001865919.1| still life [Culex quinquefasciatus] gi|167879100|gb|EDS42483.1| still life [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|442630405|ref|NP_001097516.3| still life, isoform K [Drosophila melanogaster] gi|440215341|gb|ABW08472.3| still life, isoform K [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|442630401|ref|NP_001261447.1| still life, isoform L [Drosophila melanogaster] gi|440215339|gb|AGB94142.1| still life, isoform L [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|157105282|ref|XP_001648799.1| still life, putative [Aedes aegypti] gi|108880143|gb|EAT44368.1| AAEL004246-PB, partial [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1613 | ||||||
| FB|FBgn0085447 | 2072 | sif "still life" [Drosophila m | 0.469 | 0.365 | 0.733 | 0.0 | |
| MGI|MGI:103306 | 1591 | Tiam1 "T cell lymphoma invasio | 0.142 | 0.144 | 0.528 | 4.8e-161 | |
| UNIPROTKB|E2R0M7 | 1591 | TIAM1 "Uncharacterized protein | 0.142 | 0.144 | 0.528 | 1e-160 | |
| UNIPROTKB|F1MX58 | 1592 | Bt.74139 "Uncharacterized prot | 0.142 | 0.144 | 0.528 | 1.3e-160 | |
| UNIPROTKB|Q13009 | 1591 | TIAM1 "T-lymphoma invasion and | 0.142 | 0.144 | 0.523 | 4.7e-159 | |
| UNIPROTKB|F1NKH5 | 1721 | TIAM2 "Uncharacterized protein | 0.140 | 0.131 | 0.506 | 8.9e-158 | |
| UNIPROTKB|F1NKH6 | 1723 | TIAM2 "Uncharacterized protein | 0.140 | 0.131 | 0.506 | 9e-158 | |
| UNIPROTKB|E1BWX2 | 1728 | TIAM2 "Uncharacterized protein | 0.140 | 0.131 | 0.506 | 9.2e-158 | |
| UNIPROTKB|E2R0N1 | 1531 | TIAM1 "Uncharacterized protein | 0.142 | 0.150 | 0.519 | 4.1e-155 | |
| UNIPROTKB|F5GZ53 | 1531 | TIAM1 "T-lymphoma invasion and | 0.258 | 0.272 | 0.376 | 1.2e-154 |
| FB|FBgn0085447 sif "still life" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 2885 (1020.6 bits), Expect = 0., Sum P(2) = 0.
Identities = 571/778 (73%), Positives = 635/778 (81%)
Query: 1 FLSVKKWLLRKKHQIELARKRGWKGYWVCLKGTTLLFYPCDSREGRSVDAAPKHLIIVDG 60
FLSVKKWLLRKKHQIELARKRGWKGYWVCLKGTTLLFYPCDSREGRSV+AAPKHLIIVDG
Sbjct: 848 FLSVKKWLLRKKHQIELARKRGWKGYWVCLKGTTLLFYPCDSREGRSVEAAPKHLIIVDG 907
Query: 61 AIMQPIPEHPKRDYIFCLSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGT 120
AIMQPIPEHPKRDYIFCLSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGT
Sbjct: 908 AIMQPIPEHPKRDYIFCLSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTGT 967
Query: 121 LHLLQEEIFRLEKAIDSDNKLKHMADLQMSVLAEPETKQQINEQITQWEENLERLHCEQF 180
LHLLQEEIFRLEKAI+SD+KLKHMA+LQ SV+ + ET+ QI QI QWEENLERLHCEQF
Sbjct: 968 LHLLQEEIFRLEKAIESDHKLKHMAELQQSVVTDQETRHQIQTQILQWEENLERLHCEQF 1027
Query: 181 RLRCYMASLQNGELPNPKSLLTHVSRNTKCILNNLGVFTVSSFHAFICARSPSLLNNLLA 240
RLRCYMASLQ+GELPNPKSLLTHVSR TK LN LGVFTVSSFHAFICARSPSLLNNLLA
Sbjct: 1028 RLRCYMASLQSGELPNPKSLLTHVSRPTKNTLNKLGVFTVSSFHAFICARSPSLLNNLLA 1087
Query: 241 GRGATKXXXXXXXXXXXXXXXXXXXXXXXXDEPDKSVKVSLPENQYAHVYLKDSMTVEEF 300
GRGATK DEP+K+ KV++P+N Y+ VYL+D+M+VEEF
Sbjct: 1088 GRGATKRRPPMLSRSNSGSSRRSMQMNSR-DEPEKTFKVAMPDNAYSTVYLRDAMSVEEF 1146
Query: 301 LANACSRKNLNPMEHFVRVKKRREMEDHNYFVPPRGDLIETYLSTHEVVEVCAKILYQVE 360
LA+AC+R+NLNPMEHFVRVKKRR+MEDHNYFVP R DLIE YL HE VEVC KILYQVE
Sbjct: 1147 LASACARRNLNPMEHFVRVKKRRDMEDHNYFVPHRNDLIENYLHNHEFVEVCMKILYQVE 1206
Query: 361 LQRTTLDHMWGFSVEAELTENAERQDELCCYVSRVEDKSVAMHNGLIKGDEIMVINGAIV 420
LQRTTL+ MWGFSVEAEL ENAERQDELCCYVSRVEDKSVAMHNG+IKGDEIMVINGAIV
Sbjct: 1207 LQRTTLEQMWGFSVEAELIENAERQDELCCYVSRVEDKSVAMHNGIIKGDEIMVINGAIV 1266
Query: 421 SDLDMMYLESVLQEELSLCMMMRSSRTEPPETAGSGMLSATDDMIESLVCXXXXXXXXMI 480
SDLDMMYLESVLQEE SL MMMRSSRTEPP+ G ++ TDDMI+SLVC ++
Sbjct: 1267 SDLDMMYLESVLQEEQSLSMMMRSSRTEPPDLVG--IMRVTDDMIDSLVCPPPPTDPPVM 1324
Query: 481 SEEMICDLIVPAPSW---SKE--HNISEQPPEKVKMPGSLYNRDLLMXXXXXXXXXXXXX 535
SEEMI LIVPAP W SK+ +E P + + L +
Sbjct: 1325 SEEMITGLIVPAPGWNGTSKDLYSPEAESSPATSFVDPAAMAAQLAVGGVGGVVVGGLGV 1384
Query: 536 XXXXXKGETYEIENLIKSAGEVTGFCRSPVETHRTSPTGSMANQSS---LNPSRQLTDAE 592
+ ++EIENL+K+A + ET ++SPTGS+ + S L PSRQLTDAE
Sbjct: 1385 AKPTSRTSSFEIENLLKTAEQ---------ETRKSSPTGSVTSSVSTTALTPSRQLTDAE 1435
Query: 593 KLSKVIIELIETERTYVKNLNGLLENYLEPLKKETFLSGAEINALFGNILEIVAFQRQFL 652
KL KV++EL++TERTYVK+LN LLE+YLEP+K+ETFLS AEINALFGNI EIV FQRQFL
Sbjct: 1436 KLRKVVMELVDTERTYVKHLNNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFL 1495
Query: 653 QNLVEALENEADFHHFDQSSQFKNILFSIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPN 712
QNL E+L+ E DF+ F+ QF+N+LF+IGSAFLYYVNHFKLYSSFCASHSKAQKVLHPN
Sbjct: 1496 QNLEESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFKLYSSFCASHSKAQKVLHPN 1555
Query: 713 EGNQALQEFLSSRNPRQQHSSTLESYLIKPIQRILKYPLLLQQLCNLTDPHCDEHLHL 770
EGN ALQEFL++RNP+QQHSSTLESYLIKPIQRILKYPLLLQQ+ NLTD DEH+HL
Sbjct: 1556 EGNHALQEFLAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQMRNLTDTRADEHVHL 1613
|
|
| MGI|MGI:103306 Tiam1 "T cell lymphoma invasion and metastasis 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0M7 TIAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MX58 Bt.74139 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13009 TIAM1 "T-lymphoma invasion and metastasis-inducing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NKH5 TIAM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NKH6 TIAM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BWX2 TIAM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0N1 TIAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GZ53 TIAM1 "T-lymphoma invasion and metastasis-inducing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1613 | |||
| cd10332 | 565 | cd10332, SLC6sbd-B0AT-like, System B(0) neutral am | 0.0 | |
| pfam00209 | 506 | pfam00209, SNF, Sodium:neurotransmitter symporter | 1e-141 | |
| cd11517 | 576 | cd11517, SLC6sbd_B0AT3, glycine transporter, B0AT3 | 1e-132 | |
| cd10324 | 417 | cd10324, SLC6sbd, Solute carrier 6 family, neurotr | 1e-128 | |
| cd11515 | 530 | cd11515, SLC6sbd_NTT4-like, Na(+)-dependent neurot | 1e-127 | |
| cd11496 | 543 | cd11496, SLC6sbd-TauT-like, Na(+)- and Cl(-)-depen | 1e-123 | |
| cd11516 | 581 | cd11516, SLC6sbd_B0AT1, Na(+)-dependent neutral am | 1e-123 | |
| cd11518 | 576 | cd11518, SLC6sbd_SIT1, Na(+)- and Cl(-)-dependent | 1e-116 | |
| cd11522 | 580 | cd11522, SLC6sbd_SBAT1, Sodium-coupled branched-ch | 1e-115 | |
| cd11497 | 539 | cd11497, SLC6sbd_SERT-like, Na(+)- and Cl(-)-depen | 1e-113 | |
| cd11500 | 544 | cd11500, SLC6sbd_PROT, Na(+)- and Cl(-)-dependent | 1e-110 | |
| cd11521 | 589 | cd11521, SLC6sbd_NTT4, Na(+)-dependent neurotransm | 1e-107 | |
| cd11502 | 543 | cd11502, SLC6sbd_NTT5, Neurotransmitter transporte | 2e-98 | |
| cd11556 | 552 | cd11556, SLC6sbd_SERT-like_u1, uncharacterized sub | 4e-98 | |
| cd11513 | 537 | cd11513, SLC6sbd_SERT, Na(+)- and Cl(-)-dependent | 5e-98 | |
| cd11506 | 598 | cd11506, SLC6sbd_GAT1, Na(+)- and Cl(-)-dependent | 6e-96 | |
| cd01255 | 172 | cd01255, PH2_Tiam1_2, T-lymphoma invasion and meta | 1e-94 | |
| cd11499 | 606 | cd11499, SLC6sbd_GlyT2, Na(+)- and Cl(-)-dependent | 7e-94 | |
| cd11509 | 592 | cd11509, SLC6sbd_CT1, Na(+)- and Cl(-)-dependent c | 1e-93 | |
| cd11510 | 542 | cd11510, SLC6sbd_TauT, Na(+)- and Cl(-)-dependent | 3e-93 | |
| cd11501 | 601 | cd11501, SLC6sbd_ATB0, Na(+)- and Cl(-)-dependent | 8e-93 | |
| cd11511 | 541 | cd11511, SLC6sbd_BGT1, Na(+)- and Cl(-)-dependent | 8e-91 | |
| cd11498 | 585 | cd11498, SLC6sbd_GlyT1, Na(+)- and Cl(-)-dependent | 2e-89 | |
| cd11507 | 544 | cd11507, SLC6sbd_GAT2, Na(+)- and Cl(-)-dependent | 3e-89 | |
| cd11512 | 560 | cd11512, SLC6sbd_NET, Na(+)- and Cl(-)-dependent n | 8e-88 | |
| cd11508 | 542 | cd11508, SLC6sbd_GAT3, Na(+)- and Cl(-)-dependent | 8e-87 | |
| cd11514 | 555 | cd11514, SLC6sbd_DAT1, Na(+)- and Cl(-)-dependent | 1e-83 | |
| cd11554 | 406 | cd11554, SLC6sbd_u2, uncharacterized eukaryotic so | 8e-76 | |
| cd10334 | 480 | cd10334, SLC6sbd_u1, uncharacterized bacterial and | 1e-75 | |
| cd01230 | 127 | cd01230, PH1_Tiam1_2, T-lymphoma invasion and meta | 3e-70 | |
| COG0733 | 439 | COG0733, COG0733, Na+-dependent transporters of th | 2e-53 | |
| cd10332 | 565 | cd10332, SLC6sbd-B0AT-like, System B(0) neutral am | 5e-50 | |
| cd10336 | 439 | cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfa | 3e-49 | |
| smart00325 | 180 | smart00325, RhoGEF, Guanine nucleotide exchange fa | 2e-45 | |
| cd00160 | 181 | cd00160, RhoGEF, Guanine nucleotide exchange facto | 2e-44 | |
| pfam00621 | 179 | pfam00621, RhoGEF, RhoGEF domain | 8e-42 | |
| cd10333 | 500 | cd10333, LeuT-like_sbd, Aquifex aeolicus LeuT and | 6e-34 | |
| cd11517 | 576 | cd11517, SLC6sbd_B0AT3, glycine transporter, B0AT3 | 6e-33 | |
| cd10324 | 417 | cd10324, SLC6sbd, Solute carrier 6 family, neurotr | 9e-31 | |
| cd11516 | 581 | cd11516, SLC6sbd_B0AT1, Na(+)-dependent neutral am | 2e-30 | |
| pfam00209 | 506 | pfam00209, SNF, Sodium:neurotransmitter symporter | 4e-29 | |
| cd01818 | 77 | cd01818, TIAM1_RBD, Ubiquitin domain of Tiam1 guan | 6e-29 | |
| cd11518 | 576 | cd11518, SLC6sbd_SIT1, Na(+)- and Cl(-)-dependent | 7e-24 | |
| cd11497 | 539 | cd11497, SLC6sbd_SERT-like, Na(+)- and Cl(-)-depen | 2e-23 | |
| cd11500 | 544 | cd11500, SLC6sbd_PROT, Na(+)- and Cl(-)-dependent | 4e-23 | |
| cd11515 | 530 | cd11515, SLC6sbd_NTT4-like, Na(+)-dependent neurot | 1e-22 | |
| cd11522 | 580 | cd11522, SLC6sbd_SBAT1, Sodium-coupled branched-ch | 3e-22 | |
| cd11498 | 585 | cd11498, SLC6sbd_GlyT1, Na(+)- and Cl(-)-dependent | 7e-20 | |
| cd11521 | 589 | cd11521, SLC6sbd_NTT4, Na(+)-dependent neurotransm | 8e-20 | |
| cd11496 | 543 | cd11496, SLC6sbd-TauT-like, Na(+)- and Cl(-)-depen | 2e-19 | |
| cd11513 | 537 | cd11513, SLC6sbd_SERT, Na(+)- and Cl(-)-dependent | 7e-18 | |
| cd10334 | 480 | cd10334, SLC6sbd_u1, uncharacterized bacterial and | 7e-18 | |
| cd11501 | 601 | cd11501, SLC6sbd_ATB0, Na(+)- and Cl(-)-dependent | 1e-17 | |
| cd11512 | 560 | cd11512, SLC6sbd_NET, Na(+)- and Cl(-)-dependent n | 2e-17 | |
| cd11556 | 552 | cd11556, SLC6sbd_SERT-like_u1, uncharacterized sub | 2e-16 | |
| cd01760 | 72 | cd01760, RBD, Ubiquitin-like domain of RBD-like S/ | 1e-15 | |
| cd11499 | 606 | cd11499, SLC6sbd_GlyT2, Na(+)- and Cl(-)-dependent | 2e-15 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 2e-15 | |
| pfam02196 | 71 | pfam02196, RBD, Raf-like Ras-binding domain | 3e-15 | |
| cd11514 | 555 | cd11514, SLC6sbd_DAT1, Na(+)- and Cl(-)-dependent | 4e-14 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 8e-14 | |
| cd11507 | 544 | cd11507, SLC6sbd_GAT2, Na(+)- and Cl(-)-dependent | 9e-14 | |
| cd11506 | 598 | cd11506, SLC6sbd_GAT1, Na(+)- and Cl(-)-dependent | 2e-13 | |
| smart00455 | 70 | smart00455, RBD, Raf-like Ras-binding domain | 4e-13 | |
| cd11510 | 542 | cd11510, SLC6sbd_TauT, Na(+)- and Cl(-)-dependent | 8e-13 | |
| cd13295 | 126 | cd13295, PH_EFA6, Exchange Factor for ARF6 Pleckst | 2e-12 | |
| cd11511 | 541 | cd11511, SLC6sbd_BGT1, Na(+)- and Cl(-)-dependent | 3e-11 | |
| cd11508 | 542 | cd11508, SLC6sbd_GAT3, Na(+)- and Cl(-)-dependent | 3e-11 | |
| cd10571 | 105 | cd10571, PH_beta_spectrin, Beta-spectrin pleckstri | 6e-11 | |
| cd11502 | 543 | cd11502, SLC6sbd_NTT5, Neurotransmitter transporte | 1e-10 | |
| cd13301 | 108 | cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin | 6e-09 | |
| cd01253 | 113 | cd01253, PH_ARHGAP21-like, ARHGAP21 and related pr | 1e-08 | |
| COG5422 | 1175 | COG5422, ROM1, RhoGEF, Guanine nucleotide exchange | 2e-08 | |
| cd11509 | 592 | cd11509, SLC6sbd_CT1, Na(+)- and Cl(-)-dependent c | 3e-08 | |
| COG0531 | 466 | COG0531, PotE, Amino acid transporters [Amino acid | 6e-08 | |
| COG0733 | 439 | COG0733, COG0733, Na+-dependent transporters of th | 2e-07 | |
| cd00992 | 82 | cd00992, PDZ_signaling, PDZ domain found in a vari | 4e-07 | |
| cd06857 | 413 | cd06857, SLC5-6-like_sbd, Solute carrier families | 6e-07 | |
| smart00228 | 85 | smart00228, PDZ, Domain present in PSD-95, Dlg, an | 4e-06 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 7e-06 | |
| cd10333 | 500 | cd10333, LeuT-like_sbd, Aquifex aeolicus LeuT and | 2e-05 | |
| cd00990 | 80 | cd00990, PDZ_glycyl_aminopeptidase, PDZ domain ass | 3e-05 | |
| cd10336 | 439 | cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfa | 6e-05 | |
| cd11554 | 406 | cd11554, SLC6sbd_u2, uncharacterized eukaryotic so | 4e-04 | |
| cd13310 | 116 | cd13310, PH_RalGPS1_2, Ral GEF with PH domain and | 6e-04 | |
| cd13243 | 147 | cd13243, PH_PLEKHG1_G2_G3, Pleckstrin homology dom | 0.003 | |
| pfam13520 | 425 | pfam13520, AA_permease_2, Amino acid permease | 0.003 | |
| cd13233 | 110 | cd13233, PH_ARHGAP9-like, Beta-spectrin pleckstrin | 0.004 | |
| cd13298 | 106 | cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin | 0.004 |
| >gnl|CDD|212040 cd10332, SLC6sbd-B0AT-like, System B(0) neutral amino acid transporter AT1, 2 and 3, and related proteins; solute-binding domain | Back alignment and domain information |
|---|
Score = 633 bits (1636), Expect = 0.0
Identities = 225/386 (58%), Positives = 274/386 (70%), Gaps = 46/386 (11%)
Query: 878 AFLIPFMVMLILEGIPLFLIELGIGQKMRLGSLGVWNTIHPWLGGVGISSCLVTFFVALY 937
AFLIP+++ML+LEGIPLF +EL IGQ++R GS+GVWNTI P+LGG+GI+SC+V+F VALY
Sbjct: 38 AFLIPYVIMLVLEGIPLFFLELAIGQRLRKGSIGVWNTISPYLGGIGIASCVVSFLVALY 97
Query: 938 YNVIITWCFYYLFNSFSSSLPWSSCPTDHNGT-IIPECELSSETAYFWYRTTLDVSPNIE 996
YNVII WCF+YLFNSF LPWSSCPT+ NGT + EC SS T YFWYRTTLD+SP+I+
Sbjct: 98 YNVIIAWCFFYLFNSFQYPLPWSSCPTNGNGTGYVEECAKSSPTQYFWYRTTLDISPSID 157
Query: 997 SPGSPKWWIVLCLLLAWIIVFFIVMKGIQSSGRVVYFTSMFPYIVLTIFFIRGITLPGAG 1056
G WW+ LCLLLAWIIV+ ++KGI+SSG+VVYFT+ FPYIVL IF IRG+TL GAG
Sbjct: 158 ESGGLNWWMTLCLLLAWIIVYLCMIKGIKSSGKVVYFTATFPYIVLIIFLIRGLTLKGAG 217
Query: 1057 AGLVHMYTPKVEKLLDPNVWLDAATQVFYSFGLAFGSLIAFGSYNQPNNNCVRDVIMVSI 1116
GL HM+TPK EKLLDP VWLDAATQ+F+S GL FGSLIAF SYN P NNC RD ++VS+
Sbjct: 218 DGLKHMFTPKFEKLLDPQVWLDAATQIFFSLGLGFGSLIAFSSYNPPKNNCHRDAVLVSL 277
Query: 1117 CNALTAIYASVVVFAILGFKAMSNAAE-----------GTGLAFI--------------- 1150
N T+I+AS+VVF++LGFKA + L
Sbjct: 278 INCFTSIFASIVVFSVLGFKATTRYDRCVDSNILILVINFLLNSTEDYVDNYTAINNVTL 337
Query: 1151 -------------------AAEGTGLAFIVFTQAIVELPGAPFWSIIFFMMLLSLGLGSQ 1191
A EGTGLAFIVFT+AIV+ PGAPFWS++FF+MLL+LGLGS
Sbjct: 338 TENQTLGLTNCSLEDELDEAVEGTGLAFIVFTEAIVKFPGAPFWSVLFFLMLLTLGLGSM 397
Query: 1192 IGILEGVLCTIFDIEIFKRIRKPILT 1217
G LEGVL +FD +I ++ K LT
Sbjct: 398 FGTLEGVLTPLFDSKILPKVPKEYLT 423
|
This subgroup includes the solute-binding domain of transmembrane transporters, which transport, i) neutral amino acids: NTT4 (also called XT1), SBAT1 (also called B0AT2, v7-3, NTT7-3), and B0AT1 (also called HND); the human genes encoding these are SLC6A17, SLC6A15, and SLC6A19 respectively, ii) glycine: B0AT3 (also called Xtrp2, XT2), iii) imino acids, such as proline, pipecolate, MeAIB, and sarcosine: SIT1 (also called XTRP3, XT3, IMINO). The human genes encoding B0AT3 and SIT1 are SLC6A18 and SLC6A20 respectively. Transporters in this subgroup may play a role in disorders including major depression, Hartnup disorder, increased susceptibility to myocardial infarction, and iminoglycinuria. This subgroup belongs to the solute carrier 6 (SLC6) transporter family. Length = 565 |
| >gnl|CDD|215790 pfam00209, SNF, Sodium:neurotransmitter symporter family | Back alignment and domain information |
|---|
| >gnl|CDD|212086 cd11517, SLC6sbd_B0AT3, glycine transporter, B0AT3; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212034 cd10324, SLC6sbd, Solute carrier 6 family, neurotransmitter transporters; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212084 cd11515, SLC6sbd_NTT4-like, Na(+)-dependent neurotransmitter transporter 4, and related proteins; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212065 cd11496, SLC6sbd-TauT-like, Na(+)- and Cl(-)-dependent taurine transporter TauT, and related proteins; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212085 cd11516, SLC6sbd_B0AT1, Na(+)-dependent neutral amino acids transporter, B0AT1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212087 cd11518, SLC6sbd_SIT1, Na(+)- and Cl(-)-dependent imino acid transporter SIT1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212091 cd11522, SLC6sbd_SBAT1, Sodium-coupled branched-chain amino-acid transporter 1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212066 cd11497, SLC6sbd_SERT-like, Na(+)- and Cl(-)-dependent monoamine transporters, SERT, NET, DAT1 and related proteins; solute binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212069 cd11500, SLC6sbd_PROT, Na(+)- and Cl(-)-dependent L-proline transporter PROT; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212090 cd11521, SLC6sbd_NTT4, Na(+)-dependent neurotransmitter transporter 4; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212071 cd11502, SLC6sbd_NTT5, Neurotransmitter transporter 5; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212094 cd11556, SLC6sbd_SERT-like_u1, uncharacterized subgroup of the SERT-like Na(+)- and Cl(-)-dependent monoamine transporter subfamily; solute binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212082 cd11513, SLC6sbd_SERT, Na(+)- and Cl(-)-dependent serotonin transporter SERT; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212075 cd11506, SLC6sbd_GAT1, Na(+)- and Cl(-)-dependent GABA transporter 1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|241286 cd01255, PH2_Tiam1_2, T-lymphoma invasion and metastasis 1 and 2 Pleckstrin Homology (PH) domain, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|212068 cd11499, SLC6sbd_GlyT2, Na(+)- and Cl(-)-dependent glycine transporter GlyT2; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212078 cd11509, SLC6sbd_CT1, Na(+)- and Cl(-)-dependent creatine transporter 1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212079 cd11510, SLC6sbd_TauT, Na(+)- and Cl(-)-dependent taurine transporter; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212070 cd11501, SLC6sbd_ATB0, Na(+)- and Cl(-)-dependent beta-alanine transporter ATB0+; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212080 cd11511, SLC6sbd_BGT1, Na(+)- and Cl(-)-dependent betaine/GABA transporter-1, and related proteins; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212067 cd11498, SLC6sbd_GlyT1, Na(+)- and Cl(-)-dependent glycine transporter GlyT1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212076 cd11507, SLC6sbd_GAT2, Na(+)- and Cl(-)-dependent GABA transporter 2; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212081 cd11512, SLC6sbd_NET, Na(+)- and Cl(-)-dependent norepinephrine transporter NET; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212077 cd11508, SLC6sbd_GAT3, Na(+)- and Cl(-)-dependent GABA transporter 3; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212083 cd11514, SLC6sbd_DAT1, Na(+)- and Cl(-)-dependent dopamine transporter 1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212092 cd11554, SLC6sbd_u2, uncharacterized eukaryotic solute carrier 6 subfamily; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212042 cd10334, SLC6sbd_u1, uncharacterized bacterial and archaeal solute carrier 6 subfamily; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|241264 cd01230, PH1_Tiam1_2, T-lymphoma invasion and metastasis 1 and 2 Pleckstrin Homology (PH) domain, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223805 COG0733, COG0733, Na+-dependent transporters of the SNF family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|212040 cd10332, SLC6sbd-B0AT-like, System B(0) neutral amino acid transporter AT1, 2 and 3, and related proteins; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212043 cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|214619 smart00325, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|238091 cd00160, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|216028 pfam00621, RhoGEF, RhoGEF domain | Back alignment and domain information |
|---|
| >gnl|CDD|212041 cd10333, LeuT-like_sbd, Aquifex aeolicus LeuT and related proteins; solute binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212086 cd11517, SLC6sbd_B0AT3, glycine transporter, B0AT3; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212034 cd10324, SLC6sbd, Solute carrier 6 family, neurotransmitter transporters; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212085 cd11516, SLC6sbd_B0AT1, Na(+)-dependent neutral amino acids transporter, B0AT1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215790 pfam00209, SNF, Sodium:neurotransmitter symporter family | Back alignment and domain information |
|---|
| >gnl|CDD|176413 cd01818, TIAM1_RBD, Ubiquitin domain of Tiam1 guanine nucleotide exchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212087 cd11518, SLC6sbd_SIT1, Na(+)- and Cl(-)-dependent imino acid transporter SIT1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212066 cd11497, SLC6sbd_SERT-like, Na(+)- and Cl(-)-dependent monoamine transporters, SERT, NET, DAT1 and related proteins; solute binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212069 cd11500, SLC6sbd_PROT, Na(+)- and Cl(-)-dependent L-proline transporter PROT; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212084 cd11515, SLC6sbd_NTT4-like, Na(+)-dependent neurotransmitter transporter 4, and related proteins; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212091 cd11522, SLC6sbd_SBAT1, Sodium-coupled branched-chain amino-acid transporter 1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212067 cd11498, SLC6sbd_GlyT1, Na(+)- and Cl(-)-dependent glycine transporter GlyT1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212090 cd11521, SLC6sbd_NTT4, Na(+)-dependent neurotransmitter transporter 4; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212065 cd11496, SLC6sbd-TauT-like, Na(+)- and Cl(-)-dependent taurine transporter TauT, and related proteins; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212082 cd11513, SLC6sbd_SERT, Na(+)- and Cl(-)-dependent serotonin transporter SERT; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212042 cd10334, SLC6sbd_u1, uncharacterized bacterial and archaeal solute carrier 6 subfamily; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212070 cd11501, SLC6sbd_ATB0, Na(+)- and Cl(-)-dependent beta-alanine transporter ATB0+; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212081 cd11512, SLC6sbd_NET, Na(+)- and Cl(-)-dependent norepinephrine transporter NET; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212094 cd11556, SLC6sbd_SERT-like_u1, uncharacterized subgroup of the SERT-like Na(+)- and Cl(-)-dependent monoamine transporter subfamily; solute binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|176358 cd01760, RBD, Ubiquitin-like domain of RBD-like S/T kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212068 cd11499, SLC6sbd_GlyT2, Na(+)- and Cl(-)-dependent glycine transporter GlyT2; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|202147 pfam02196, RBD, Raf-like Ras-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212083 cd11514, SLC6sbd_DAT1, Na(+)- and Cl(-)-dependent dopamine transporter 1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|212076 cd11507, SLC6sbd_GAT2, Na(+)- and Cl(-)-dependent GABA transporter 2; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212075 cd11506, SLC6sbd_GAT1, Na(+)- and Cl(-)-dependent GABA transporter 1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|128731 smart00455, RBD, Raf-like Ras-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212079 cd11510, SLC6sbd_TauT, Na(+)- and Cl(-)-dependent taurine transporter; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|241449 cd13295, PH_EFA6, Exchange Factor for ARF6 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|212080 cd11511, SLC6sbd_BGT1, Na(+)- and Cl(-)-dependent betaine/GABA transporter-1, and related proteins; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212077 cd11508, SLC6sbd_GAT3, Na(+)- and Cl(-)-dependent GABA transporter 3; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|241307 cd10571, PH_beta_spectrin, Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|212071 cd11502, SLC6sbd_NTT5, Neurotransmitter transporter 5; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241284 cd01253, PH_ARHGAP21-like, ARHGAP21 and related proteins pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|227709 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|212078 cd11509, SLC6sbd_CT1, Na(+)- and Cl(-)-dependent creatine transporter 1; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223805 COG0733, COG0733, Na+-dependent transporters of the SNF family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >gnl|CDD|212031 cd06857, SLC5-6-like_sbd, Solute carrier families 5 and 6-like; solute binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|212041 cd10333, LeuT-like_sbd, Aquifex aeolicus LeuT and related proteins; solute binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238490 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >gnl|CDD|212043 cd10336, SLC6sbd_Tyt1-Like, solute carrier 6 subfamily, Fusobacterium nucleatum Tyt1-like; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212092 cd11554, SLC6sbd_u2, uncharacterized eukaryotic solute carrier 6 subfamily; solute-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|241464 cd13310, PH_RalGPS1_2, Ral GEF with PH domain and SH3 binding motif 1 and 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241397 cd13243, PH_PLEKHG1_G2_G3, Pleckstrin homology domain-containing family G members 1, 2, and 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|222193 pfam13520, AA_permease_2, Amino acid permease | Back alignment and domain information |
|---|
| >gnl|CDD|241387 cd13233, PH_ARHGAP9-like, Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1613 | |||
| KOG3659|consensus | 629 | 100.0 | ||
| KOG3660|consensus | 629 | 100.0 | ||
| PF00209 | 523 | SNF: Sodium:neurotransmitter symporter family; Int | 100.0 | |
| COG0733 | 439 | Na+-dependent transporters of the SNF family [Gene | 100.0 | |
| cd01255 | 160 | PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM | 100.0 | |
| KOG0932|consensus | 774 | 100.0 | ||
| cd00160 | 181 | RhoGEF Guanine nucleotide exchange factor for Rho/ | 99.94 | |
| KOG3519|consensus | 756 | 99.93 | ||
| smart00325 | 180 | RhoGEF Guanine nucleotide exchange factor for Rho/ | 99.93 | |
| KOG4424|consensus | 623 | 99.91 | ||
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 99.9 | |
| cd01818 | 77 | TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleo | 99.9 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 99.9 | |
| PF00621 | 180 | RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho | 99.89 | |
| KOG2996|consensus | 865 | 99.87 | ||
| KOG3518|consensus | 521 | 99.86 | ||
| KOG4305|consensus | 1029 | 99.85 | ||
| KOG3520|consensus | 1167 | 99.83 | ||
| KOG3523|consensus | 695 | 99.8 | ||
| KOG2070|consensus | 661 | 99.76 | ||
| KOG3522|consensus | 925 | 99.76 | ||
| KOG3521|consensus | 846 | 99.7 | ||
| KOG0689|consensus | 448 | 99.65 | ||
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 99.64 | |
| KOG4240|consensus | 1025 | 99.63 | ||
| KOG3660|consensus | 629 | 99.59 | ||
| COG5422 | 1175 | ROM1 RhoGEF, Guanine nucleotide exchange factor fo | 99.56 | |
| KOG3531|consensus | 1036 | 99.51 | ||
| KOG3659|consensus | 629 | 99.45 | ||
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 99.43 | |
| PF00595 | 81 | PDZ: PDZ domain (Also known as DHR or GLGF) Coordi | 99.32 | |
| cd01760 | 72 | RBD Ubiquitin-like domain of RBD-like S/T kinases. | 99.29 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.28 | |
| PF00209 | 523 | SNF: Sodium:neurotransmitter symporter family; Int | 99.27 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 99.25 | |
| KOG3606|consensus | 358 | 99.22 | ||
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 99.21 | |
| KOG3524|consensus | 850 | 99.18 | ||
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.15 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.15 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 99.15 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.13 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.12 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.04 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 99.03 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.03 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.01 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 99.01 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 98.97 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 98.96 | |
| PF02196 | 71 | RBD: Raf-like Ras-binding domain; InterPro: IPR003 | 98.93 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 98.91 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 98.87 | |
| KOG3550|consensus | 207 | 98.85 | ||
| cd00992 | 82 | PDZ_signaling PDZ domain found in a variety of Eum | 98.85 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 98.75 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 98.74 | |
| smart00228 | 85 | PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als | 98.72 | |
| cd00136 | 70 | PDZ PDZ domain, also called DHR (Dlg homologous re | 98.69 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 98.68 | |
| smart00455 | 70 | RBD Raf-like Ras-binding domain. | 98.58 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 98.53 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 98.51 | |
| KOG3553|consensus | 124 | 98.47 | ||
| KOG3209|consensus | 984 | 98.43 | ||
| PF13180 | 82 | PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ | 98.39 | |
| KOG3549|consensus | 505 | 98.39 | ||
| cd00988 | 85 | PDZ_CTP_protease PDZ domain of C-terminal processi | 98.38 | |
| KOG0517|consensus | 2473 | 98.36 | ||
| KOG3209|consensus | 984 | 98.33 | ||
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 98.3 | |
| KOG3542|consensus | 1283 | 98.26 | ||
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 98.14 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 98.12 | |
| KOG4407|consensus | 1973 | 98.12 | ||
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 98.1 | |
| cd00991 | 79 | PDZ_archaeal_metalloprotease PDZ domain of archaea | 98.08 | |
| cd00990 | 80 | PDZ_glycyl_aminopeptidase PDZ domain associated wi | 98.06 | |
| KOG0930|consensus | 395 | 98.0 | ||
| cd00989 | 79 | PDZ_metalloprotease PDZ domain of bacterial and pl | 97.99 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 97.81 | |
| KOG3551|consensus | 506 | 97.78 | ||
| cd00987 | 90 | PDZ_serine_protease PDZ domain of tryspin-like ser | 97.75 | |
| cd00986 | 79 | PDZ_LON_protease PDZ domain of ATP-dependent LON s | 97.75 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 97.72 | |
| PLN00049 | 389 | carboxyl-terminal processing protease; Provisional | 97.71 | |
| TIGR00225 | 334 | prc C-terminal peptidase (prc). A C-terminal pepti | 97.71 | |
| KOG3651|consensus | 429 | 97.7 | ||
| KOG1892|consensus | 1629 | 97.67 | ||
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 97.65 | |
| KOG3580|consensus | 1027 | 97.63 | ||
| COG0793 | 406 | Prc Periplasmic protease [Cell envelope biogenesis | 97.6 | |
| KOG4269|consensus | 1112 | 97.59 | ||
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 97.56 | |
| TIGR01713 | 259 | typeII_sec_gspC general secretion pathway protein | 97.47 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 97.41 | |
| KOG3580|consensus | 1027 | 97.38 | ||
| COG0733 | 439 | Na+-dependent transporters of the SNF family [Gene | 97.37 | |
| cd01817 | 73 | RGS12_RBD Ubiquitin domain of RGS12 and RGS14. RGS | 97.26 | |
| KOG3552|consensus | 1298 | 97.24 | ||
| PRK11186 | 667 | carboxy-terminal protease; Provisional | 97.23 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 97.13 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 97.05 | |
| PF04495 | 138 | GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: | 97.04 | |
| PRK10898 | 353 | serine endoprotease; Provisional | 97.04 | |
| KOG0606|consensus | 1205 | 97.02 | ||
| PRK10942 | 473 | serine endoprotease; Provisional | 97.02 | |
| TIGR02038 | 351 | protease_degS periplasmic serine pepetdase DegS. T | 97.01 | |
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 97.01 | |
| TIGR02037 | 428 | degP_htrA_DO periplasmic serine protease, Do/DeqQ | 97.01 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 97.0 | |
| PRK10139 | 455 | serine endoprotease; Provisional | 96.95 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 96.95 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 96.91 | |
| PRK10942 | 473 | serine endoprotease; Provisional | 96.89 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 96.86 | |
| KOG0609|consensus | 542 | 96.86 | ||
| PRK10779 | 449 | zinc metallopeptidase RseP; Provisional | 96.83 | |
| KOG3640|consensus | 1116 | 96.69 | ||
| KOG2059|consensus | 800 | 96.47 | ||
| TIGR03279 | 433 | cyano_FeS_chp putative FeS-containing Cyanobacteri | 96.45 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 96.4 | |
| KOG3605|consensus | 829 | 96.37 | ||
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 96.36 | |
| cd01816 | 74 | Raf_RBD Ubiquitin domain of Raf serine/threonine k | 96.31 | |
| KOG3129|consensus | 231 | 96.21 | ||
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 96.09 | |
| TIGR00054 | 420 | RIP metalloprotease RseP. A model that detects fra | 95.9 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 95.83 | |
| KOG1738|consensus | 638 | 95.47 | ||
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 95.45 | |
| TIGR02860 | 402 | spore_IV_B stage IV sporulation protein B. SpoIVB, | 95.35 | |
| KOG0690|consensus | 516 | 95.28 | ||
| PRK09681 | 276 | putative type II secretion protein GspC; Provision | 94.9 | |
| KOG3524|consensus | 850 | 94.84 | ||
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 94.75 | |
| COG3975 | 558 | Predicted protease with the C-terminal PDZ domain | 94.63 | |
| KOG3571|consensus | 626 | 94.34 | ||
| PF03845 | 320 | Spore_permease: Spore germination protein; InterPr | 94.16 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 94.04 | |
| KOG3751|consensus | 622 | 93.93 | ||
| KOG3531|consensus | 1036 | 93.84 | ||
| PRK11375 | 484 | allantoin permease; Provisional | 93.37 | |
| TIGR00837 | 381 | araaP aromatic amino acid transport protein. aroma | 92.8 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 92.75 | |
| TIGR00814 | 397 | stp serine transporter. The HAAAP family includes | 92.72 | |
| KOG0521|consensus | 785 | 92.67 | ||
| TIGR00912 | 359 | 2A0309 spore germination protein (amino acid perme | 92.66 | |
| COG0265 | 347 | DegQ Trypsin-like serine proteases, typically peri | 92.64 | |
| COG3031 | 275 | PulC Type II secretory pathway, component PulC [In | 92.45 | |
| KOG3605|consensus | 829 | 92.16 | ||
| PF01235 | 416 | Na_Ala_symp: Sodium:alanine symporter family; Inte | 92.03 | |
| KOG3723|consensus | 851 | 91.92 | ||
| KOG1090|consensus | 1732 | 91.88 | ||
| COG1953 | 497 | FUI1 Cytosine/uracil/thiamine/allantoin permeases | 91.84 | |
| PF14685 | 88 | Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 | 91.79 | |
| KOG3523|consensus | 695 | 91.7 | ||
| KOG3938|consensus | 334 | 90.4 | ||
| TIGR00930 | 953 | 2a30 K-Cl cotransporter. | 89.58 | |
| PF03222 | 394 | Trp_Tyr_perm: Tryptophan/tyrosine permease family; | 89.37 | |
| cd01777 | 87 | SNX27_RA Ubiquitin domain of SNX27 (sorting nexin | 89.12 | |
| PRK00701 | 439 | manganese transport protein MntH; Reviewed | 88.88 | |
| KOG1320|consensus | 473 | 88.73 | ||
| TIGR00909 | 429 | 2A0306 amino acid transporter. | 88.28 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 87.99 | |
| TIGR00905 | 473 | 2A0302 transporter, basic amino acid/polyamine ant | 87.29 | |
| KOG1738|consensus | 638 | 86.81 | ||
| PF01566 | 358 | Nramp: Natural resistance-associated macrophage pr | 86.66 | |
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 86.55 | |
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 86.31 | |
| KOG3519|consensus | 756 | 86.15 | ||
| TIGR00835 | 425 | agcS amino acid carrier protein. Members of the AG | 86.02 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 84.91 | |
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 83.9 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 83.75 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 83.68 | |
| PRK10483 | 414 | tryptophan permease; Provisional | 82.78 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 82.62 | |
| smart00295 | 207 | B41 Band 4.1 homologues. Also known as ezrin/radix | 82.41 | |
| PRK10435 | 435 | cadB lysine/cadaverine antiporter; Provisional | 81.82 | |
| PLN02866 | 1068 | phospholipase D | 81.79 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 81.68 | |
| PRK10655 | 438 | potE putrescine transporter; Provisional | 81.61 | |
| TIGR00911 | 501 | 2A0308 L-type amino acid transporter. | 81.48 |
| >KOG3659|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-85 Score=779.92 Aligned_cols=452 Identities=40% Similarity=0.791 Sum_probs=420.3
Q ss_pred cccccccccccchhhhhHHhhhheeeeccCCCc--ccccccchhHhHHHHHhhhcchhhhHHHhhhhccCCChhhhhhhh
Q psy8107 839 GWYWQITWRFLGPAIMSCILVSSIICRFLKKPS--YSAWNRAFLIPFMVMLILEGIPLFLIELGIGQKMRLGSLGVWNTI 916 (1613)
Q Consensus 839 ~~yWk~cW~fItP~il~~I~i~~ii~~~~~~P~--Y~~~g~~FLIpYli~l~liGlPll~lElalGQ~~r~g~i~a~~~i 916 (1613)
...|..-|-|++..++.++.++++ |++|+ |.+|||+|++||+++++++|+||++||+++||+.|+|++++|+++
T Consensus 78 R~~W~~K~eflLa~vgfaV~lgnv----WrFpYlC~~nGGgaFlvpY~imli~~GvPLfymELaLGQ~~r~g~~gvw~ri 153 (629)
T KOG3659|consen 78 RPTWGSKTEFLLAVVGFAVDLGNV----WRFPYLCYKNGGGAFLVPYTIMLIVGGVPLFYMELALGQYHRQGCIGVWRRI 153 (629)
T ss_pred CCcchhHHHHHHHHHHHhhccccc----ceeeheeeeCCCEeEhHHHHHHHHHhccHHHHHHHHHHHHhcccchhHHHHh
Confidence 568999999998888888888866 89997 889999999999999999999999999999999999999999999
Q ss_pred hhcccccchhhHHHHHHHHhhhhHHHHHHHHHHHhhcccCCCCCCCCCCCCCCcCC----------cccCCchhhhhhhh
Q psy8107 917 HPWLGGVGISSCLVTFFVALYYNVIITWCFYYLFNSFSSSLPWSSCPTDHNGTIIP----------ECELSSETAYFWYR 986 (1613)
Q Consensus 917 ~p~~~GvG~~~~li~~li~~YYsVi~aW~L~Y~~~Sf~~~lpW~~C~~~~n~~~~~----------~C~~s~~~~~f~~~ 986 (1613)
+|.++|||++++++++++.+||++|++|+++|++.||++++||++|++.||+..+. +|...+++++||++
T Consensus 154 ~P~l~Gigy~i~~i~~~~~~yyn~i~aWA~~yl~~sft~~lPW~sC~~s~n~~~C~~~~~s~~~~~~~ek~s~a~ef~~r 233 (629)
T KOG3659|consen 154 APALKGIGYAICLIAFFVGLYYNVIIAWALYYLFTSFTSNLPWESCPNSWNGPNCFDPTWSKNCDEECEKTSPAQEFWYR 233 (629)
T ss_pred CHHhcCCchhhhHHHHHHHHHHHHHHHHHHHHHHHHhcCCCChhhCCCcccCCCccCccccccCchhhhccchhHHHHHh
Confidence 99999999999999999999999999999999999999999999999999976532 46778999999999
Q ss_pred hccccCCC--CCCCCchhHHHHHHHHHHHHHHHHhhhcccccceeeeeehhhHHHHHHHHHHHHhccCCChhccceeeec
Q psy8107 987 TTLDVSPN--IESPGSPKWWIVLCLLLAWIIVFFIVMKGIQSSGRVVYFTSMFPYIVLTIFFIRGITLPGAGAGLVHMYT 1064 (1613)
Q Consensus 987 ~vL~~s~~--i~~~g~~~~~l~l~l~l~w~iv~~~v~kGI~~~gKv~~~~~l~P~vlL~iLlir~ltL~Ga~~Gl~~lf~ 1064 (1613)
.+|+++.. ++|.|++.|.+++|++++|++++++++||+|++||++|+++++|++++.++++|+++||||..|+.|+++
T Consensus 234 ~~l~l~~~~~~~d~g~~~~~~~lc~~lv~~liyf~~~kG~kssGKvv~vtallPy~Il~illirgl~l~ga~~g~~y~~~ 313 (629)
T KOG3659|consen 234 KVLGLSESHGLDDLGGPSWTLALCLVLVWLLIYFSLWKGVKSSGKVVWVTALLPYIILLILLVRGLTLPGAKNGIQYYLT 313 (629)
T ss_pred hcccccccccccccCCCchHHHHHHHHHHHHHHHHHhccccccceEEeeehhhHHHHHHHHHHhcccccccccchhheec
Confidence 99998877 9999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccccChhHHHHHHhhHHHhhcccccceehhccccCCCCccccceehhhhhHHHHHHHHHHHHHhhhccccccccccC
Q psy8107 1065 PKVEKLLDPNVWLDAATQVFYSFGLAFGSLIAFGSYNQPNNNCVRDVIMVSICNALTAIYASVVVFAILGFKAMSNAAEG 1144 (1613)
Q Consensus 1065 Pd~s~L~~~~vW~~A~~QaFfSLslG~G~mitygSY~~~~~ni~rda~~v~~~n~~vSllAgl~IFsilG~~a~~~~~~~ 1144 (1613)
|||+++.++.+|++|++|+|||||+|+|++++|||||+++|||+|||++++++|+++++++|+++|+++|+++.......
T Consensus 314 ~~~~kl~~~~vW~dAAtqiffslg~GfG~L~AfaSyn~F~NNc~rDAll~S~in~~ts~~sgfviFsvLg~~a~~~y~~~ 393 (629)
T KOG3659|consen 314 PDIEKLKEPSVWIDAATQIFFSLGPGFGVLIAFASYNKFHNNCYRDALLTSIINCLTSFLSGFVIFSVLGYMATLIYPCN 393 (629)
T ss_pred ccHHHHhhHHHHHHHHHHHHhhcCccchhhhhhhhhcccccchhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999998755555
Q ss_pred CCcee-cccCCCceehHHHHHHHHhCCChhHHHHHHHHHHHHHhhhhcchhhhhhhhhhhhcc-cccccchhhhhHhh--
Q psy8107 1145 TGLAF-IAAEGTGLAFIVFTQAIVELPGAPFWSIIFFMMLLSLGLGSQIGILEGVLCTIFDIE-IFKRIRKPILTEAL-- 1220 (1613)
Q Consensus 1145 ~~i~~-~~~~G~gL~Fi~lP~af~~mp~g~l~avLFFl~L~lagltS~isllE~iVt~l~D~~-~~~r~~~~~~~~~l-- 1220 (1613)
.+.++ +..+||||+|++||+|+++||.+.+|+++||+||..+|++|+++.+|.+++.+.|++ ..-|+++..+++.+
T Consensus 394 ~~~e~~~~~~gp~lafivy~Eait~~~~s~fWs~iFFlmL~~lgl~s~~g~~e~iit~l~d~~~~~l~~~~e~~~~~~~l 473 (629)
T KOG3659|consen 394 EEIEELVAVAGPGLAFIVYPEAITNMPYSSFWSVIFFLMLLTLGLDSMFGGIEAIITPLLDEFYLSLRKHRELFTLLVCL 473 (629)
T ss_pred ccHHHhhhhcCCceEEEehhhHHhcCCchHHHHHHHHHHHHHHhhHhhhhhHHHHhccccchhhhHhhhhHHHHHHHHHH
Confidence 56655 567899999999999999999999999999999999999999999999999999998 55566666655443
Q ss_pred ----hhhhhcchhhhHHHHHHHhhcceeeeeeeccccccceeccccCCceEEEEeEee-echhhhhhcccCCccceeeeh
Q psy8107 1221 ----KGMEKVAEHINEMQRIHEEYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGVEW-LNISDFLGKIKKGLELHAMCF 1295 (1613)
Q Consensus 1221 ----~gL~~vt~gG~y~~~l~d~yga~f~ll~~~~~~~l~e~Ials~~~lwiyg~~~~-~~i~~mlg~~~~~~~~w~~~w 1295 (1613)
+++++++.+|.|+.+++++|++++.+++. +++|.++++ |+||.+++ .|++.|+|. +++ .+|++||
T Consensus 474 ~~~~~~l~~~~~~g~y~~~ll~~y~~~~~vl~~----Vlie~i~Vs----wvYG~~rf~~d~~~Mlg~-~P~-~yw~v~w 543 (629)
T KOG3659|consen 474 FSFLLGLPFITAGGGYVFPLLIDYAAGLLVLFV----VLIEAIAVS----WVYGVRRFSADVKQMLGF-RPG-WYWRVCW 543 (629)
T ss_pred HHHhhhhhhccccceeeehhhHHHhhhhHHHHH----HHHHHHHHH----hhhhHhHHHHHHHHHhCC-CCc-hhHHHHH
Confidence 48899999999999999999988877666 899999998 99999666 599999999 666 7999999
Q ss_pred hhhhhhhee
Q psy8107 1296 VFKSAVVFL 1304 (1613)
Q Consensus 1296 ~fitPvill 1304 (1613)
..+.|++++
T Consensus 544 ~~vsp~~ll 552 (629)
T KOG3659|consen 544 PCVSPVFLL 552 (629)
T ss_pred hhhhHHHHH
Confidence 999998776
|
|
| >KOG3660|consensus | Back alignment and domain information |
|---|
| >PF00209 SNF: Sodium:neurotransmitter symporter family; InterPro: IPR000175 Neurotransmitter transport systems are integral to the release, re-uptake and recycling of neurotransmitters at synapses | Back alignment and domain information |
|---|
| >COG0733 Na+-dependent transporters of the SNF family [General function prediction only] | Back alignment and domain information |
|---|
| >cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0932|consensus | Back alignment and domain information |
|---|
| >cd00160 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain | Back alignment and domain information |
|---|
| >KOG3519|consensus | Back alignment and domain information |
|---|
| >smart00325 RhoGEF Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases | Back alignment and domain information |
|---|
| >KOG4424|consensus | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01818 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleotide exchange factor | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >PF00621 RhoGEF: RhoGEF domain; InterPro: IPR000219 The Rho family GTPases Rho, Rac and CDC42 regulate a diverse array of cellular processes | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG3518|consensus | Back alignment and domain information |
|---|
| >KOG4305|consensus | Back alignment and domain information |
|---|
| >KOG3520|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >KOG3522|consensus | Back alignment and domain information |
|---|
| >KOG3521|consensus | Back alignment and domain information |
|---|
| >KOG0689|consensus | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4240|consensus | Back alignment and domain information |
|---|
| >KOG3660|consensus | Back alignment and domain information |
|---|
| >COG5422 ROM1 RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >KOG3659|consensus | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] | Back alignment and domain information |
|---|
| >cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00209 SNF: Sodium:neurotransmitter symporter family; InterPro: IPR000175 Neurotransmitter transport systems are integral to the release, re-uptake and recycling of neurotransmitters at synapses | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3606|consensus | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3524|consensus | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >KOG3550|consensus | Back alignment and domain information |
|---|
| >cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 | Back alignment and domain information |
|---|
| >cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00455 RBD Raf-like Ras-binding domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3553|consensus | Back alignment and domain information |
|---|
| >KOG3209|consensus | Back alignment and domain information |
|---|
| >PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C | Back alignment and domain information |
|---|
| >KOG3549|consensus | Back alignment and domain information |
|---|
| >cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts | Back alignment and domain information |
|---|
| >KOG0517|consensus | Back alignment and domain information |
|---|
| >KOG3209|consensus | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3542|consensus | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4407|consensus | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3551|consensus | Back alignment and domain information |
|---|
| >cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis | Back alignment and domain information |
|---|
| >cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >PLN00049 carboxyl-terminal processing protease; Provisional | Back alignment and domain information |
|---|
| >TIGR00225 prc C-terminal peptidase (prc) | Back alignment and domain information |
|---|
| >KOG3651|consensus | Back alignment and domain information |
|---|
| >KOG1892|consensus | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3580|consensus | Back alignment and domain information |
|---|
| >COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG4269|consensus | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >TIGR01713 typeII_sec_gspC general secretion pathway protein C | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3580|consensus | Back alignment and domain information |
|---|
| >COG0733 Na+-dependent transporters of the SNF family [General function prediction only] | Back alignment and domain information |
|---|
| >cd01817 RGS12_RBD Ubiquitin domain of RGS12 and RGS14 | Back alignment and domain information |
|---|
| >KOG3552|consensus | Back alignment and domain information |
|---|
| >PRK11186 carboxy-terminal protease; Provisional | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous | Back alignment and domain information |
|---|
| >PRK10898 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >TIGR02038 protease_degS periplasmic serine pepetdase DegS | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >PRK10139 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PRK10942 serine endoprotease; Provisional | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >PRK10779 zinc metallopeptidase RseP; Provisional | Back alignment and domain information |
|---|
| >KOG3640|consensus | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3605|consensus | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01816 Raf_RBD Ubiquitin domain of Raf serine/threonine kinases | Back alignment and domain information |
|---|
| >KOG3129|consensus | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >TIGR00054 RIP metalloprotease RseP | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1738|consensus | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02860 spore_IV_B stage IV sporulation protein B | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >PRK09681 putative type II secretion protein GspC; Provisional | Back alignment and domain information |
|---|
| >KOG3524|consensus | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3571|consensus | Back alignment and domain information |
|---|
| >PF03845 Spore_permease: Spore germination protein; InterPro: IPR004761 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >PRK11375 allantoin permease; Provisional | Back alignment and domain information |
|---|
| >TIGR00837 araaP aromatic amino acid transport protein | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >TIGR00814 stp serine transporter | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >TIGR00912 2A0309 spore germination protein (amino acid permease) | Back alignment and domain information |
|---|
| >COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG3605|consensus | Back alignment and domain information |
|---|
| >PF01235 Na_Ala_symp: Sodium:alanine symporter family; InterPro: IPR001463 Sodium symporters can be divided by sequence and functional similarity into various groups | Back alignment and domain information |
|---|
| >KOG3723|consensus | Back alignment and domain information |
|---|
| >KOG1090|consensus | Back alignment and domain information |
|---|
| >COG1953 FUI1 Cytosine/uracil/thiamine/allantoin permeases [Nucleotide transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >KOG3938|consensus | Back alignment and domain information |
|---|
| >TIGR00930 2a30 K-Cl cotransporter | Back alignment and domain information |
|---|
| >PF03222 Trp_Tyr_perm: Tryptophan/tyrosine permease family; InterPro: IPR018227 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell | Back alignment and domain information |
|---|
| >cd01777 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin protein 27) | Back alignment and domain information |
|---|
| >PRK00701 manganese transport protein MntH; Reviewed | Back alignment and domain information |
|---|
| >KOG1320|consensus | Back alignment and domain information |
|---|
| >TIGR00909 2A0306 amino acid transporter | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >TIGR00905 2A0302 transporter, basic amino acid/polyamine antiporter (APA) family | Back alignment and domain information |
|---|
| >KOG1738|consensus | Back alignment and domain information |
|---|
| >PF01566 Nramp: Natural resistance-associated macrophage protein; InterPro: IPR001046 The natural resistance-associated macrophage protein (NRAMP) family consists of Nramp1, Nramp2, and yeast proteins Smf1 and Smf2 | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3519|consensus | Back alignment and domain information |
|---|
| >TIGR00835 agcS amino acid carrier protein | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >PRK10483 tryptophan permease; Provisional | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00295 B41 Band 4 | Back alignment and domain information |
|---|
| >PRK10435 cadB lysine/cadaverine antiporter; Provisional | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PRK10655 potE putrescine transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00911 2A0308 L-type amino acid transporter | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1613 | ||||
| 3a8n_A | 279 | Crystal Structure Of The Tiam1 Phccex Domain Length | 1e-70 | ||
| 3a8p_A | 263 | Crystal Structure Of The Tiam2 Phccex Domain Length | 2e-68 | ||
| 1foe_A | 377 | Crystal Structure Of Rac1 In Complex With The Guani | 2e-59 | ||
| 1foe_A | 377 | Crystal Structure Of Rac1 In Complex With The Guani | 9e-33 | ||
| 3f3a_A | 508 | Crystal Structure Of Leut Bound To L-Tryptophan And | 8e-16 | ||
| 3f3d_A | 517 | Crystal Structure Of Leut Bound To L-Methionine And | 1e-15 | ||
| 3gjc_A | 513 | Crystal Structure Of The E290s Mutant Of Leut With | 1e-14 | ||
| 2a65_A | 519 | Crystal Structure Of Leutaa, A Bacterial Homolog Of | 1e-14 | ||
| 3tu0_A | 519 | Crystal Structure Of T355v, S354a, K288a Leut Mutan | 1e-14 | ||
| 3qs5_A | 519 | Crystal Structure Of Leut Mutant I359q Bound To Sod | 1e-14 | ||
| 2qju_A | 511 | Crystal Structure Of An Nss Homolog With Bound Anti | 1e-14 | ||
| 3gjd_A | 515 | Crystal Structure Of Leut With Bound Og Length = 51 | 1e-14 | ||
| 3mpn_A | 507 | F177r1 Mutant Of Leut Length = 507 | 2e-14 | ||
| 2dfk_A | 402 | Crystal Structure Of The Cdc42-Collybistin Ii Compl | 2e-14 | ||
| 3mpq_A | 507 | I204r1 Mutant Of Leut Length = 507 | 4e-14 | ||
| 3tt1_A | 519 | Crystal Structure Of Leut In The Outward-Open Confo | 4e-14 | ||
| 4fxz_A | 513 | Crystal Structure Of Leut-F253a Bound To L-Leucine | 6e-14 | ||
| 2dx1_A | 482 | Crystal Structure Of Rhogef Protein Asef Length = 4 | 9e-14 | ||
| 3qs6_A | 519 | Crystal Structure Of Leut Mutant F259v,I359q Bound | 1e-13 | ||
| 3qs4_A | 519 | Crystal Structure Of Leut Mutant F259v Bound To Sod | 1e-13 | ||
| 1by1_A | 209 | Dbl Homology Domain From Beta-Pix Length = 209 | 1e-13 | ||
| 2pz1_A | 466 | Crystal Structure Of Auto-Inhibited Asef Length = 4 | 1e-13 | ||
| 3tt3_A | 519 | Crystal Structure Of Leut In The Inward-Open Confor | 2e-13 | ||
| 1rj2_A | 353 | Crystal Structure Of The DhPH FRAGMENT OF DBS WITHO | 2e-11 | ||
| 1kzg_A | 353 | Dbscdc42(Y889f) Length = 353 | 2e-11 | ||
| 1lb1_A | 353 | Crystal Structure Of The Dbl And Pleckstrin Homolog | 2e-11 | ||
| 2kr9_A | 190 | Kalirin Dh1 Nmr Structure Length = 190 | 7e-11 | ||
| 2nz8_B | 313 | N-Terminal Dhph Cassette Of Trio In Complex With Nu | 2e-10 | ||
| 1nty_A | 311 | Crystal Structure Of The First DhPH DOMAIN OF TRIO | 2e-10 | ||
| 1kz7_A | 353 | Crystal Structure Of The DhPH FRAGMENT OF MURINE DB | 4e-10 | ||
| 1f5x_A | 208 | Nmr Structure Of The Y174 Autoinhibited Dbl Homolog | 1e-09 | ||
| 2vrw_B | 406 | Critical Structural Role For The Ph And C1 Domains | 6e-09 | ||
| 3ky9_A | 587 | Autoinhibited Vav1 Length = 587 | 7e-09 | ||
| 2rgn_B | 354 | Crystal Structure Of P63rhogef Complex With Galpha- | 3e-08 | ||
| 3bji_A | 378 | Structural Basis Of Promiscuous Guanine Nucleotide | 3e-08 | ||
| 3gf9_A | 295 | Crystal Structure Of Human Intersectin 2 Rhogef Dom | 1e-07 | ||
| 3jzy_A | 510 | Crystal Structure Of Human Intersectin 2 C2 Domain | 2e-07 | ||
| 3jv3_A | 283 | Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l | 3e-07 | ||
| 2z0q_A | 352 | Crystal Structure Of Dh-Ph Domain Of Rhogef3(Xpln) | 4e-07 | ||
| 1ki1_B | 352 | Guanine Nucleotide Exchange Region Of Intersectin I | 6e-06 | ||
| 3qbv_B | 351 | Structure Of Designed Orthogonal Interaction Betwee | 1e-05 | ||
| 3eo2_A | 231 | Crystal Structure Of The Rhogef Domain Of Human Neu | 1e-05 | ||
| 3odw_A | 536 | Crystal Structure Of The Linker-DhPH DOMAINS OF P11 | 5e-04 | ||
| 2dtc_A | 126 | Crystal Structure Of Ms0666 Length = 126 | 5e-04 | ||
| 3odx_A | 417 | Crystal Structure Of An N-Terminally Truncated Link | 8e-04 |
| >pdb|3A8N|A Chain A, Crystal Structure Of The Tiam1 Phccex Domain Length = 279 | Back alignment and structure |
|
| >pdb|3A8P|A Chain A, Crystal Structure Of The Tiam2 Phccex Domain Length = 263 | Back alignment and structure |
| >pdb|1FOE|A Chain A, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 377 | Back alignment and structure |
| >pdb|1FOE|A Chain A, Crystal Structure Of Rac1 In Complex With The Guanine Nucleotide Exchange Region Of Tiam1 Length = 377 | Back alignment and structure |
| >pdb|3GJC|A Chain A, Crystal Structure Of The E290s Mutant Of Leut With Bound Og Length = 513 | Back alignment and structure |
| >pdb|2A65|A Chain A, Crystal Structure Of Leutaa, A Bacterial Homolog Of Na+/cl--dependent Neurotransmitter Transporters Length = 519 | Back alignment and structure |
| >pdb|3TU0|A Chain A, Crystal Structure Of T355v, S354a, K288a Leut Mutant In Complex With Alanine And Sodium Length = 519 | Back alignment and structure |
| >pdb|3QS5|A Chain A, Crystal Structure Of Leut Mutant I359q Bound To Sodium And L- Tryptophan Length = 519 | Back alignment and structure |
| >pdb|2QJU|A Chain A, Crystal Structure Of An Nss Homolog With Bound Antidepressant Length = 511 | Back alignment and structure |
| >pdb|3GJD|A Chain A, Crystal Structure Of Leut With Bound Og Length = 515 | Back alignment and structure |
| >pdb|3MPN|A Chain A, F177r1 Mutant Of Leut Length = 507 | Back alignment and structure |
| >pdb|2DFK|A Chain A, Crystal Structure Of The Cdc42-Collybistin Ii Complex Length = 402 | Back alignment and structure |
| >pdb|3MPQ|A Chain A, I204r1 Mutant Of Leut Length = 507 | Back alignment and structure |
| >pdb|3TT1|A Chain A, Crystal Structure Of Leut In The Outward-Open Conformation In Complex With Fab Length = 519 | Back alignment and structure |
| >pdb|4FXZ|A Chain A, Crystal Structure Of Leut-F253a Bound To L-Leucine From Lipid Bicelles Length = 513 | Back alignment and structure |
| >pdb|2DX1|A Chain A, Crystal Structure Of Rhogef Protein Asef Length = 482 | Back alignment and structure |
| >pdb|3QS6|A Chain A, Crystal Structure Of Leut Mutant F259v,I359q Bound To Sodium And L- Tryptophan Length = 519 | Back alignment and structure |
| >pdb|3QS4|A Chain A, Crystal Structure Of Leut Mutant F259v Bound To Sodium And L- Tryptophan Length = 519 | Back alignment and structure |
| >pdb|1BY1|A Chain A, Dbl Homology Domain From Beta-Pix Length = 209 | Back alignment and structure |
| >pdb|2PZ1|A Chain A, Crystal Structure Of Auto-Inhibited Asef Length = 466 | Back alignment and structure |
| >pdb|3TT3|A Chain A, Crystal Structure Of Leut In The Inward-Open Conformation In Complex With Fab Length = 519 | Back alignment and structure |
| >pdb|1RJ2|A Chain A, Crystal Structure Of The DhPH FRAGMENT OF DBS WITHOUT Bound Gtpase Length = 353 | Back alignment and structure |
| >pdb|1KZG|A Chain A, Dbscdc42(Y889f) Length = 353 | Back alignment and structure |
| >pdb|1LB1|A Chain A, Crystal Structure Of The Dbl And Pleckstrin Homology Domains Of Dbs In Complex With Rhoa Length = 353 | Back alignment and structure |
| >pdb|2KR9|A Chain A, Kalirin Dh1 Nmr Structure Length = 190 | Back alignment and structure |
| >pdb|2NZ8|B Chain B, N-Terminal Dhph Cassette Of Trio In Complex With Nucleotide- Free Rac1 Length = 313 | Back alignment and structure |
| >pdb|1NTY|A Chain A, Crystal Structure Of The First DhPH DOMAIN OF TRIO TO 1.7 A Length = 311 | Back alignment and structure |
| >pdb|1KZ7|A Chain A, Crystal Structure Of The DhPH FRAGMENT OF MURINE DBS IN Complex With The Placental Isoform Of Human Cdc42 Length = 353 | Back alignment and structure |
| >pdb|1F5X|A Chain A, Nmr Structure Of The Y174 Autoinhibited Dbl Homology Domain Length = 208 | Back alignment and structure |
| >pdb|2VRW|B Chain B, Critical Structural Role For The Ph And C1 Domains Of The Vav1 Exchange Factor Length = 406 | Back alignment and structure |
| >pdb|3KY9|A Chain A, Autoinhibited Vav1 Length = 587 | Back alignment and structure |
| >pdb|2RGN|B Chain B, Crystal Structure Of P63rhogef Complex With Galpha-Q And Rhoa Length = 354 | Back alignment and structure |
| >pdb|3BJI|A Chain A, Structural Basis Of Promiscuous Guanine Nucleotide Exchange By The T-Cell Essential Vav1 Length = 378 | Back alignment and structure |
| >pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 | Back alignment and structure |
| >pdb|3JZY|A Chain A, Crystal Structure Of Human Intersectin 2 C2 Domain Length = 510 | Back alignment and structure |
| >pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 | Back alignment and structure |
| >pdb|2Z0Q|A Chain A, Crystal Structure Of Dh-Ph Domain Of Rhogef3(Xpln) Length = 352 | Back alignment and structure |
| >pdb|1KI1|B Chain B, Guanine Nucleotide Exchange Region Of Intersectin In Complex With Cdc42 Length = 352 | Back alignment and structure |
| >pdb|3QBV|B Chain B, Structure Of Designed Orthogonal Interaction Between Cdc42 And Nucleotide Exchange Domains Of Intersectin Length = 351 | Back alignment and structure |
| >pdb|3EO2|A Chain A, Crystal Structure Of The Rhogef Domain Of Human Neuroepithelial Cell- Transforming Gene 1 Protein Length = 231 | Back alignment and structure |
| >pdb|3ODW|A Chain A, Crystal Structure Of The Linker-DhPH DOMAINS OF P115-Rhogef Length = 536 | Back alignment and structure |
| >pdb|2DTC|A Chain A, Crystal Structure Of Ms0666 Length = 126 | Back alignment and structure |
| >pdb|3ODX|A Chain A, Crystal Structure Of An N-Terminally Truncated Linker-DhPH DOMAINS OF P115-Rhogef Length = 417 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
Score = 229 bits (583), Expect = 5e-68
Identities = 117/236 (49%), Positives = 165/236 (69%), Gaps = 1/236 (0%)
Query: 1 FLSVKKWLL-RKKHQIELARKRGWKGYWVCLKGTTLLFYPCDSREGRSVDAAPKHLIIVD 59
+L K + +K+ ++EL +R WK YWV LKG TLLFY + ++AP+ + +
Sbjct: 16 WLFFKPLVTLQKERKLELVARRKWKQYWVTLKGCTLLFYETYGKNSTEQNSAPRCALFAE 75
Query: 60 GAIMQPIPEHPKRDYIFCLSTAFGDAYLFQAPCQVELENWVNSIHSACAAAFARHRGKTG 119
+I+Q +PEHPK++++FCLS + GD YLFQA Q +LENWV +IHSACA+ FA+ GK
Sbjct: 76 DSIVQSVPEHPKKEHVFCLSNSCGDVYLFQATSQTDLENWVTAIHSACASLFAKKHGKED 135
Query: 120 TLHLLQEEIFRLEKAIDSDNKLKHMADLQMSVLAEPETKQQINEQITQWEENLERLHCEQ 179
T+ LL+ + L + ID D+K+K MA+LQ+SV+++P+ ++ I QI QWE+NLE+ H +
Sbjct: 136 TVRLLKSQTRSLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIRQWEQNLEKFHMDL 195
Query: 180 FRLRCYMASLQNGELPNPKSLLTHVSRNTKCILNNLGVFTVSSFHAFICARSPSLL 235
FR+RCY+ASLQ GELPNPKSLL SR +K L LGV +VSSFHA +C+R S L
Sbjct: 196 FRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLGVLSVSSFHALVCSRDDSTL 251
|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Length = 377 | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Length = 377 | Back alignment and structure |
|---|
| >2a65_A Leutaa, Na(+):neurotransmitter symporter (SNF family); membrane protein, transport protein; HET: BOG; 1.65A {Aquifex aeolicus} SCOP: f.54.1.1 PDB: 2q6h_A* 2q72_A* 2qb4_A* 2qei_A* 3f3a_A* 3f3c_A* 3f3d_A* 3f3e_A* 3f48_A* 3f4i_A* 3f4j_A* 3usg_A* 3usi_A 3usj_A 3usk_A 3usl_A* 3usm_A* 3uso_A 3usp_A* 3qs5_A* ... Length = 519 | Back alignment and structure |
|---|
| >2a65_A Leutaa, Na(+):neurotransmitter symporter (SNF family); membrane protein, transport protein; HET: BOG; 1.65A {Aquifex aeolicus} SCOP: f.54.1.1 PDB: 2q6h_A* 2q72_A* 2qb4_A* 2qei_A* 3f3a_A* 3f3c_A* 3f3d_A* 3f3e_A* 3f48_A* 3f4i_A* 3f4j_A* 3usg_A* 3usi_A 3usj_A 3usk_A 3usl_A* 3usm_A* 3uso_A 3usp_A* 3qs5_A* ... Length = 519 | Back alignment and structure |
|---|
| >1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 Length = 209 | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Length = 402 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Length = 406 | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Length = 587 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Length = 346 | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Length = 346 | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Length = 311 | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Length = 311 | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Length = 354 | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Length = 353 | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Length = 434 | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Length = 368 | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Length = 418 | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Length = 385 | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Length = 385 | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Length = 377 | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Length = 377 | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Length = 536 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 112 | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 | Back alignment and structure |
|---|
| >3ayf_A Nitric oxide reductase; oxidoreductase; HET: HEM BOG EPE LOP; 2.50A {Geobacillus stearothermophilus} PDB: 3ayg_A* Length = 800 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 136 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1613 | |||
| 2a65_A | 519 | Leutaa, Na(+):neurotransmitter symporter (SNF fami | 100.0 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 100.0 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 100.0 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 100.0 | |
| 1by1_A | 209 | Protein (PIX); RHO-GTPase exchange factor, transpo | 99.97 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 99.96 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 99.96 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 99.95 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 99.95 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 99.95 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 99.95 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 99.94 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 99.94 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 99.94 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 99.94 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 99.94 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 99.94 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 99.93 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 99.93 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 99.92 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 99.92 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 99.92 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 99.88 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 99.81 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 99.75 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.73 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 99.72 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.72 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 99.71 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 99.64 | |
| 2d8i_A | 114 | T-cell lymphoma invasion and metastasis 1 variant; | 99.51 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.43 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 99.41 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 99.38 | |
| 3kzd_A | 94 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 99.37 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.37 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.37 | |
| 1wi2_A | 104 | Riken cDNA 2700099C19; structural genomics, riken | 99.34 | |
| 1r6j_A | 82 | Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap | 99.34 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.32 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.3 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.3 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.3 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.29 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.29 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.29 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.28 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 99.28 | |
| 1uez_A | 101 | KIAA1526 protein; PDZ domain, structural genomics, | 99.28 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.27 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.27 | |
| 1m5z_A | 91 | GRIP, AMPA receptor interacting protein; six beta- | 99.27 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.26 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.26 | |
| 3l4f_D | 132 | SH3 and multiple ankyrin repeat domains protein 1; | 99.25 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.24 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.24 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.24 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.24 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.24 | |
| 2vwr_A | 95 | Ligand of NUMB protein X 2; protein-binding, metal | 99.24 | |
| 2jik_A | 101 | Synaptojanin-2 binding protein; transmembrane, out | 99.24 | |
| 4e34_A | 87 | Golgi-associated PDZ and coiled-coil motif-contai | 99.24 | |
| 2q9v_A | 90 | Membrane-associated guanylate kinase, WW and PDZ c | 99.24 | |
| 1nf3_C | 128 | PAR-6B; semi-CRIB motif, switch I and II, PDZ doma | 99.24 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 99.23 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.23 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.23 | |
| 2he4_A | 90 | Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p | 99.23 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.23 | |
| 2awx_A | 105 | Synapse associated protein 97; membrane protein, s | 99.22 | |
| 2iwo_A | 120 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 99.22 | |
| 2pa1_A | 87 | PDZ and LIM domain protein 2; PDZ domain, structur | 99.22 | |
| 2d92_A | 108 | INAD-like protein; PDZ domain, inadl protein, hina | 99.22 | |
| 3b76_A | 118 | E3 ubiquitin-protein ligase LNX; PDZ, bound ligand | 99.22 | |
| 2uzc_A | 88 | Human pdlim5, PDZ and LIM domain 5; metal-binding, | 99.22 | |
| 2qg1_A | 92 | Multiple PDZ domain protein; MPDZ, MUPP1, structur | 99.21 | |
| 2r4h_A | 112 | Membrane-associated guanylate kinase, WW and PDZ c | 99.21 | |
| 2eeh_A | 100 | PDZ domain-containing protein 7; structural genomi | 99.21 | |
| 1d5g_A | 96 | Human phosphatase HPTP1E; protein-peptide complex, | 99.21 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.21 | |
| 1uhp_A | 107 | Hypothetical protein KIAA1095; PDZ domain, semapho | 99.21 | |
| 2fne_A | 117 | Multiple PDZ domain protein; structural protein, s | 99.2 | |
| 1ihj_A | 98 | INAD; intermolecular disulfide bond, PDZ domain, s | 99.2 | |
| 1uep_A | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.2 | |
| 2jil_A | 97 | GRIP1 protein, glutamate receptor interacting prot | 99.2 | |
| 2i04_A | 85 | Membrane-associated guanylate kinase, WW and PDZ d | 99.2 | |
| 3qe1_A | 107 | Sorting nexin-27, G protein-activated inward RECT | 99.2 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 99.2 | |
| 1kwa_A | 88 | Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca | 99.2 | |
| 3o46_A | 93 | Maguk P55 subfamily member 7; PDZ domain, structur | 99.2 | |
| 2i1n_A | 102 | Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig | 99.2 | |
| 1q3o_A | 109 | Shank1; PDZ, GKAP, peptide binding protein; 1.80A | 99.19 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.19 | |
| 3cbz_A | 108 | Dishevelled-2; PDZ domain, phage derived high affi | 99.19 | |
| 2q3g_A | 89 | PDZ and LIM domain protein 7; structural genomics, | 99.19 | |
| 1n7e_A | 97 | AMPA receptor interacting protein GRIP; PDZ, prote | 99.19 | |
| 2v90_A | 96 | PDZ domain-containing protein 3; membrane, protein | 99.19 | |
| 2fe5_A | 94 | Presynaptic protein SAP102; PDZ domain, DLG3, huma | 99.19 | |
| 2ego_A | 96 | General receptor for phosphoinositides 1- associat | 99.18 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 99.18 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.18 | |
| 2vsp_A | 91 | PDZ domain-containing protein 1; membrane, cytopla | 99.18 | |
| 3k1r_A | 192 | Harmonin; protein-protein complex, alternative spl | 99.18 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.18 | |
| 2byg_A | 117 | Channel associated protein of synapse-110; DLG2, P | 99.18 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.18 | |
| 2dkr_A | 93 | LIN-7 homolog B; LIN-7B, PDZ, structural genomics, | 99.18 | |
| 1g9o_A | 91 | NHE-RF; PDZ domain, complex, signaling protein; 1. | 99.18 | |
| 2ehr_A | 117 | INAD-like protein; PDZ domain, inadl protein, hina | 99.18 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.18 | |
| 1wi4_A | 109 | Synip, syntaxin binding protein 4; syntaxin4-inter | 99.17 | |
| 2db5_A | 128 | INAD-like protein; PDZ domain, hinadl, PALS1- asso | 99.17 | |
| 1rgw_A | 85 | ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, | 99.17 | |
| 3hpk_A | 125 | Protein interacting with PRKCA 1; oxidized, PDZ do | 99.17 | |
| 1ueq_A | 123 | Membrane associated guanylate kinase inverted-2 (M | 99.16 | |
| 2dls_A | 93 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 99.16 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 99.16 | |
| 1v62_A | 117 | KIAA1719 protein; structural genomics, synaptic tr | 99.16 | |
| 3r68_A | 95 | Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P | 99.16 | |
| 1wf8_A | 107 | Neurabin-I; PDZ domain, structural genomics, NPPSF | 99.16 | |
| 2o2t_A | 117 | Multiple PDZ domain protein; structural protein, s | 99.16 | |
| 2kpk_A | 129 | Membrane-associated guanylate kinase, WW and PDZ c | 99.16 | |
| 1ujd_A | 117 | KIAA0559 protein; PDZ domain, structural genomics, | 99.15 | |
| 2f5y_A | 91 | Regulator of G-protein signalling 3 isoform 1; PDZ | 99.15 | |
| 2a65_A | 519 | Leutaa, Na(+):neurotransmitter symporter (SNF fami | 99.15 | |
| 1ufx_A | 103 | KIAA1526 protein; PDZ domain, structural genomics, | 99.15 | |
| 3i4w_A | 104 | Disks large homolog 4; alpha and beta protein, alt | 99.15 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.14 | |
| 2pkt_A | 91 | PDZ and LIM domain protein 1; PDZ domain, structur | 99.13 | |
| 2eno_A | 120 | Synaptojanin-2-binding protein; mitochondrial oute | 99.13 | |
| 2opg_A | 98 | Multiple PDZ domain protein; structural protein, s | 99.13 | |
| 2yt7_A | 101 | Amyloid beta A4 precursor protein-binding family A | 99.13 | |
| 1wha_A | 105 | KIAA0147 protein, scribble; PDZ domain, cellular s | 99.12 | |
| 2ejy_A | 97 | 55 kDa erythrocyte membrane protein; GPC, maguk, P | 99.12 | |
| 1wfg_A | 131 | Regulating synaptic membrane exocytosis protein 2; | 99.12 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.11 | |
| 2d90_A | 102 | PDZ domain containing protein 1; structural genomi | 99.11 | |
| 2djt_A | 104 | Unnamed protein product; PDZ domain, structural ge | 99.11 | |
| 1uew_A | 114 | Membrane associated guanylate kinase inverted-2 (M | 99.11 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.11 | |
| 3axa_A | 106 | Afadin, nectin-3, protein AF-6; PDZ domain, fusion | 99.11 | |
| 2daz_A | 124 | INAD-like protein; PDZ domain, inadl protein, hina | 99.11 | |
| 1uju_A | 111 | Scribble; PDZ domain, cellular signaling, structur | 99.1 | |
| 1um1_A | 110 | KIAA1849 protein, RSGI RUH-007; PDZ domain, human | 99.1 | |
| 3ngh_A | 106 | PDZ domain-containing protein 1; adaptor protein, | 99.1 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.1 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.1 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 99.09 | |
| 3e17_A | 88 | Tight junction protein ZO-2; domain swapping, alte | 99.09 | |
| 1vb7_A | 94 | PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, | 99.09 | |
| 1x6d_A | 119 | Interleukin-16; PDZ domain, lymphocyte chemoattrac | 99.09 | |
| 3gge_A | 95 | PDZ domain-containing protein GIPC2; structural ge | 99.09 | |
| 1q7x_A | 108 | PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str | 99.08 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.08 | |
| 2eeg_A | 94 | PDZ and LIM domain protein 4; PDZ domain, structur | 99.08 | |
| 2gzv_A | 114 | PRKCA-binding protein; protein kinase C, PDZ domai | 99.07 | |
| 1va8_A | 113 | Maguk P55 subfamily member 5; PDZ domain, palmitoy | 99.07 | |
| 2kv8_A | 83 | RGS12, regulator of G-protein signaling 12; PDZ do | 99.07 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 99.07 | |
| 3bpu_A | 88 | Membrane-associated guanylate kinase, WW and PDZ c | 99.07 | |
| 2g5m_B | 113 | Neurabin-2; spinophilin, PDZ domain, CNS, synaptic | 99.07 | |
| 1uf1_A | 128 | KIAA1526 protein; PDZ domain, structural genomics, | 99.07 | |
| 1v5q_A | 122 | GRIP1 homolog, glutamate receptor interacting prot | 99.06 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.06 | |
| 4amh_A | 106 | Disks large homolog 1; permutation, protein foldin | 99.06 | |
| 2eei_A | 106 | PDZ domain-containing protein 1; regulatory factor | 99.06 | |
| 2jre_A | 108 | C60-1 PDZ domain peptide; de novo protein; NMR {Sy | 99.06 | |
| 3khf_A | 99 | Microtubule-associated serine/threonine-protein ki | 99.06 | |
| 1wg6_A | 127 | Hypothetical protein (riken cDNA 2810455B10); stru | 99.06 | |
| 2w4f_A | 97 | Protein LAP4; structural protein, phosphoprotein, | 99.05 | |
| 2csj_A | 117 | TJP2 protein; PDZ domain, structural genomics, NPP | 99.05 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.05 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 99.05 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.05 | |
| 2h2b_A | 107 | Tight junction protein ZO-1; PDZ domain, phage der | 99.04 | |
| 1wfv_A | 103 | Membrane associated guanylate kinase inverted-2; a | 99.04 | |
| 1x5q_A | 110 | LAP4 protein; PDZ domain, scribble homolog protein | 99.04 | |
| 2dlu_A | 111 | INAD-like protein; PDZ domain, inadl protein, hina | 99.04 | |
| 2edp_A | 100 | Fragment, shroom family member 4; APX/shroom famil | 99.04 | |
| 1mfg_A | 95 | ERB-B2 interacting protein; PDZ domain, protein-pe | 99.04 | |
| 2fcf_A | 103 | Multiple PDZ domain protein; adaptor molecule, pro | 99.04 | |
| 1tp5_A | 119 | Presynaptic density protein 95; PDZ-peptide ligand | 99.04 | |
| 3egg_C | 170 | Spinophilin; PP1, serine/threonine phosphatase, po | 99.03 | |
| 2jxo_A | 98 | Ezrin-radixin-moesin-binding phosphoprotein 50; nh | 99.03 | |
| 2yuy_A | 126 | RHO GTPase activating protein 21; PDZ domain, stru | 99.03 | |
| 2la8_A | 106 | Inactivation-NO-after-potential D protein, KON-TI | 99.03 | |
| 2koj_A | 111 | Partitioning defective 3 homolog; PDZ domain, stru | 99.03 | |
| 3soe_A | 113 | Membrane-associated guanylate kinase, WW and PDZ c | 99.03 | |
| 2dm8_A | 116 | INAD-like protein; PDZ domain, inadl protein, hina | 99.02 | |
| 2e7k_A | 91 | Maguk P55 subfamily member 2; PDZ domain, MPP2 pro | 99.02 | |
| 3sfj_A | 104 | TAX1-binding protein 3; PDZ:peptide complex, signa | 99.01 | |
| 2dmz_A | 129 | INAD-like protein; PDZ domain, inadl protein, hina | 99.01 | |
| 2vsv_A | 109 | Rhophilin-2; scaffold protein, RHO GTPase binding, | 99.0 | |
| 1v6b_A | 118 | Harmonin isoform A1; structural genomics, usher sy | 99.0 | |
| 2qkv_A | 96 | Inactivation-NO-after-potential D protein; PDZ dom | 99.0 | |
| 1n7t_A | 103 | 99-MER peptide of densin-180-like protein; PDZ dom | 99.0 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 99.0 | |
| 1y7n_A | 90 | Amyloid beta A4 precursor protein-binding family A | 98.99 | |
| 2iwq_A | 123 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.99 | |
| 1qau_A | 112 | Neuronal nitric oxide synthase (residues 1-130); b | 98.99 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 98.99 | |
| 1x5n_A | 114 | Harmonin; PDZ domain, usher syndrome 1C protein, a | 98.98 | |
| 2iwn_A | 97 | Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP | 98.98 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 98.98 | |
| 2edz_A | 114 | PDZ domain-containing protein 1; CFTR-associated p | 98.98 | |
| 2edv_A | 96 | FERM and PDZ domain-containing protein 1; cytoskel | 98.98 | |
| 2lob_A | 112 | Golgi-associated PDZ and coiled-coil motif-contai | 98.52 | |
| 2z17_A | 104 | Pleckstrin homology SEC7 and coiled-coil domains- | 98.96 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 98.95 | |
| 1ujv_A | 96 | Membrane associated guanylate kinase inverted-2 (M | 98.94 | |
| 2vz5_A | 139 | TAX1-binding protein 3; WNT signaling pathway, pro | 98.92 | |
| 1b8q_A | 127 | Protein (neuronal nitric oxide synthase); PDZ doma | 98.91 | |
| 2eaq_A | 90 | LIM domain only protein 7; conserved hypothetical | 98.91 | |
| 2kom_A | 121 | Partitioning defective 3 homolog; PAR-3B, PDZ doma | 98.91 | |
| 1um7_A | 113 | Synapse-associated protein 102; PDZ, discs large h | 98.91 | |
| 1uit_A | 117 | Human discs large 5 protein; PDZ domain, HDLG5, ma | 98.91 | |
| 2kjd_A | 128 | Sodium/hydrogen exchange regulatory cofactor NHE- | 98.9 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.9 | |
| 1whd_A | 100 | RGS3, regulator of G-protein signaling 3; PDZ doma | 98.9 | |
| 1v5l_A | 103 | PDZ and LIM domain 3; actinin alpha 2 associated L | 98.9 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 98.88 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.87 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 98.87 | |
| 3qik_A | 101 | Phosphatidylinositol 3,4,5-trisphosphate-dependen | 98.86 | |
| 3cyy_A | 92 | Tight junction protein ZO-1; protein-ligand comple | 98.86 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 98.86 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.84 | |
| 1wif_A | 126 | RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s | 98.84 | |
| 1vae_A | 111 | Rhophilin 2, rhophilin, RHO GTPase binding protein | 98.84 | |
| 3tsv_A | 124 | Tight junction protein ZO-1; PDZ, scaffolding, JAM | 98.83 | |
| 2yub_A | 118 | LIMK-2, LIM domain kinase 2; PDZ domain, structura | 98.83 | |
| 2rcz_A | 81 | Tight junction protein ZO-1; PDZ, domain-swapping, | 98.83 | |
| 2krg_A | 216 | Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a | 98.8 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 98.8 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 98.76 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 98.75 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 98.75 | |
| 3gsl_A | 196 | Disks large homolog 4; PDZ domain, tandem, PSD-95, | 98.75 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 98.73 | |
| 1wh1_A | 124 | KIAA1095 protein; PDZ domain, structural genomics, | 98.7 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 98.69 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 98.68 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 98.67 | |
| 3r0h_A | 206 | INAD, inactivation-NO-after-potential D protein; p | 98.65 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.63 | |
| 2qt5_A | 200 | Glutamate receptor-interacting protein 1; PDZ-pept | 98.59 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 98.57 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.56 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 98.48 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 98.42 | |
| 1p1d_A | 196 | PDZ45, glutamate receptor interacting protein; PDZ | 98.39 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.36 | |
| 2pzd_A | 113 | Serine protease HTRA2; PDZ domain, apoptosis, mito | 98.26 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 98.23 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 98.16 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 98.13 | |
| 2p3w_A | 112 | Probable serine protease HTRA3; PDZ domain, phage | 98.12 | |
| 2i6v_A | 87 | General secretion pathway protein C; EPSC, GSPC, P | 98.12 | |
| 2zpm_A | 91 | Regulator of sigma E protease; metalloproteinase, | 98.08 | |
| 2kjp_A | 91 | Uncharacterized protein YLBL; mixed alpha-beta pro | 98.03 | |
| 3id1_A | 95 | Regulator of sigma E protease; hydrolase, cell inn | 98.02 | |
| 3i18_A | 100 | LMO2051 protein; alpha-beta protein, structural ge | 98.0 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 97.99 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 97.99 | |
| 2kl1_A | 94 | YLBL protein; structure genomics, structural genom | 97.99 | |
| 2i4s_A | 105 | General secretion pathway protein C; EPSC, GSPC, P | 97.96 | |
| 1fc6_A | 388 | Photosystem II D1 protease; D1 C-terminal processi | 97.92 | |
| 2l97_A | 134 | HTRA, putative serine protease; HTRA-PDZ, protein | 97.9 | |
| 3suz_A | 388 | Amyloid beta A4 precursor protein-binding family 2 | 97.9 | |
| 1w9e_A | 166 | Syntenin 1; cell adhesion, adhesion/complex, PDZ d | 97.86 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 97.84 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 97.73 | |
| 1lcy_A | 325 | HTRA2 serine protease; apoptosis, PDZ domain, casp | 97.69 | |
| 4fgm_A | 597 | Aminopeptidase N family protein; structural genomi | 97.68 | |
| 3k50_A | 403 | Putative S41 protease; structural genomics, joint | 97.65 | |
| 3stj_A | 345 | Protease DEGQ; serine protease, PDZ domain, protea | 97.6 | |
| 1te0_A | 318 | Protease DEGS; two domains, serine protease, PDZ, | 97.53 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 97.52 | |
| 2hga_A | 125 | Conserved protein MTH1368; GFT structural genomics | 97.51 | |
| 3rle_A | 209 | Golgi reassembly-stacking protein 2; PDZ, tether, | 97.5 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 97.45 | |
| 1y8t_A | 324 | Hypothetical protein RV0983; serine protease, stru | 97.38 | |
| 4a8c_A | 436 | Periplasmic PH-dependent serine endoprotease DEGQ; | 97.32 | |
| 4gou_A | 518 | EHRGS-rhogef; RGS domain, DH domain, PH domain, RH | 97.27 | |
| 3pv2_A | 451 | DEGQ; trypsin fold, PDZ domain, chaperone protease | 97.27 | |
| 3qo6_A | 348 | Protease DO-like 1, chloroplastic; protease, HTRA, | 97.23 | |
| 3num_A | 332 | Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom | 97.21 | |
| 1c1y_B | 77 | Proto-onkogene serine/threonine protein kinase RAF | 97.08 | |
| 1wxm_A | 86 | A-RAF proto-oncogene serine/threonine-protein kina | 97.05 | |
| 3ny5_A | 96 | Serine/threonine-protein kinase B-RAF; NESG, struc | 96.79 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 96.79 | |
| 2l05_A | 95 | Serine/threonine-protein kinase B-RAF; structural | 96.75 | |
| 1ky9_A | 448 | Protease DO, DEGP, HTRA; protein quality control, | 96.73 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 96.65 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 96.35 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 96.11 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 96.09 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 96.04 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 95.86 | |
| 1rrb_A | 107 | RAF-1 RBD, RAF proto-oncogene serine/threonine-pro | 95.76 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 94.97 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 94.69 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 94.64 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 94.2 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 93.99 | |
| 4djk_A | 511 | Probable glutamate/gamma-aminobutyrate antiporter; | 93.74 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 93.29 | |
| 4fln_A | 539 | Protease DO-like 2, chloroplastic; protease, DEG, | 93.17 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 91.87 | |
| 3l1l_A | 445 | Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC | 91.2 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 91.1 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 90.44 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 89.74 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 89.65 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 89.63 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 89.6 | |
| 3gia_A | 444 | Uncharacterized protein MJ0609; membrane protein, | 89.57 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 89.53 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 89.28 | |
| 2jln_A | 501 | MHP1; hydantoin, transporter, membrane protein, nu | 88.78 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 87.97 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 86.95 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 86.2 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 85.92 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 85.83 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 84.25 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 83.58 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 83.17 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 82.03 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 81.22 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 80.65 | |
| 2adz_A | 178 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 80.27 |
| >2a65_A Leutaa, Na(+):neurotransmitter symporter (SNF family); membrane protein, transport protein; HET: BOG; 1.65A {Aquifex aeolicus} SCOP: f.54.1.1 PDB: 2q6h_A* 2q72_A* 2qb4_A* 2qei_A* 3f3a_A* 3f3c_A* 3f3d_A* 3f3e_A* 3f48_A* 3f4i_A* 3f4j_A* 3usg_A* 3usi_A 3usj_A 3usk_A 3usl_A* 3usm_A* 3uso_A 3usp_A* 3qs5_A* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=3.8e-78 Score=746.24 Aligned_cols=435 Identities=20% Similarity=0.330 Sum_probs=386.5
Q ss_pred cccccccccccchhhhhHHhhhheeeeccCCCc--ccccccchhHhHHHHHhhhcchhhhHHHhhhh----ccCCChhhh
Q psy8107 839 GWYWQITWRFLGPAIMSCILVSSIICRFLKKPS--YSAWNRAFLIPFMVMLILEGIPLFLIELGIGQ----KMRLGSLGV 912 (1613)
Q Consensus 839 ~~yWk~cW~fItP~il~~I~i~~ii~~~~~~P~--Y~~~g~~FLIpYli~l~liGlPll~lElalGQ----~~r~g~i~a 912 (1613)
+.-|...+.|+..+++.+|+++|+ ||+|+ |.||||||+|||+++++++|+|++++|+++|| ++|+|++++
T Consensus 5 R~~W~sr~~FiLa~~G~AVGLGNi----WRFPyl~~~nGGgAFlipYli~l~~~GiPll~~E~alGq~~~~~~r~~~i~a 80 (519)
T 2a65_A 5 REHWATRLGLILAMAGNAVGLGNF----LRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAI 80 (519)
T ss_dssp CCCCSCHHHHHHHHHHHHSSHHHH----THHHHHHHHTTTHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHTTTCCSHHHH
T ss_pred cccCCcHHHHHHHHHHHHhcccHH----HHHHHHHHHcCCcHHHHHHHHHHHHHHHHHHHHHHHhcccchhccCCCHHHH
Confidence 357999999999999999999987 89996 88999999999999999999999999999999 888999999
Q ss_pred hhhhhhc--ccccchhhHHHHHHHHhhhhHHHHHHHHHHHhhcccCCC--CCCCCCCCCCCcCCcccCCchhhhhhhhhc
Q psy8107 913 WNTIHPW--LGGVGISSCLVTFFVALYYNVIITWCFYYLFNSFSSSLP--WSSCPTDHNGTIIPECELSSETAYFWYRTT 988 (1613)
Q Consensus 913 ~~~i~p~--~~GvG~~~~li~~li~~YYsVi~aW~L~Y~~~Sf~~~lp--W~~C~~~~n~~~~~~C~~s~~~~~f~~~~v 988 (1613)
|++++|. |+|+|++++++++++++||+||+||+++|+++||++++| |.+|++ .+|. .++..+|| +++
T Consensus 81 ~~~l~~~~~~~giG~~~v~~~~~i~~yY~vi~gW~l~Y~~~s~~~~lp~~w~~~~~-------~~~~-~~~~~~~f-~~~ 151 (519)
T 2a65_A 81 FYLLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAIKFLVGLVPEPPPNATD-------PDSI-LRPFKEFL-YSY 151 (519)
T ss_dssp HHHHSCSHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCCCC--CC-------HHHH-HHHHHHHH-HHH
T ss_pred HHHhcCCcCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccccCC-------cccc-cCcHHHHH-HHH
Confidence 9999865 999999999999999999999999999999999999999 765421 0110 12233444 567
Q ss_pred cccCCCCCCCCchhHHHHHHHHHHHHHHHHhhhccc-ccceeeeeehhhHHHHHHHHHHHHhccCCC----hhccceeee
Q psy8107 989 LDVSPNIESPGSPKWWIVLCLLLAWIIVFFIVMKGI-QSSGRVVYFTSMFPYIVLTIFFIRGITLPG----AGAGLVHMY 1063 (1613)
Q Consensus 989 L~~s~~i~~~g~~~~~l~l~l~l~w~iv~~~v~kGI-~~~gKv~~~~~l~P~vlL~iLlir~ltL~G----a~~Gl~~lf 1063 (1613)
++.++++++.|.+.|.+++|++++|++++++++||| +..+|++++++.+|++++++|++|++|||| |.+|++|+|
T Consensus 152 l~~~~~~~~~g~~~~~~~~~~~~~w~i~~~ii~~Gv~kgiek~~~~~mp~l~vlliiL~ir~ltLpGp~~~A~~Gl~~~~ 231 (519)
T 2a65_A 152 IGVPKGDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLW 231 (519)
T ss_dssp HTCCSSSSCBCCCCHHHHHHHHHHHHHHHHHHTTCTTTTHHHHHHHHHHHHHHHHHHHHHHHTTCEETTEEHHHHHHHHH
T ss_pred HCCCCCcccccCccHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHhcCCCCchhHHHHHHHHh
Confidence 888889999999999999999999999999999999 567999999999999999999999999999 999999999
Q ss_pred ccccccccChhHHHHHHhhHHHhhcccccceehhccccCCCCccccceehhhhhHHHHHHHHHHHHHhhhcccccccccc
Q psy8107 1064 TPKVEKLLDPNVWLDAATQVFYSFGLAFGSLIAFGSYNQPNNNCVRDVIMVSICNALTAIYASVVVFAILGFKAMSNAAE 1143 (1613)
Q Consensus 1064 ~Pd~s~L~~~~vW~~A~~QaFfSLslG~G~mitygSY~~~~~ni~rda~~v~~~n~~vSllAgl~IFsilG~~a~~~~~~ 1143 (1613)
+|||++|.|+++|++|++|+|||||+|+|+|++||||+++++|+.+|+++++++|+++|++||++||+++||++.
T Consensus 232 ~Pd~s~L~~~~vw~~A~gQ~FFSLslG~G~~ity~SY~~~~~n~~~~a~~v~~~n~~~sllaG~~IF~~lgf~a~----- 306 (519)
T 2a65_A 232 TPDFEKLKDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKAEVILGGSISIPAAVAFF----- 306 (519)
T ss_dssp SCCTTSTTCHHHHHHHHHHHHHHHTTTSSHHHHHHTTSCTTSCCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHH-----
T ss_pred cCCHHHhCCHHHHHHHHHHHHHHhHHHHhHHhhhhcccCCCcChHhhHHHHHHHHHHHHHHHHHHHHHHHHHHhc-----
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999762
Q ss_pred CCC-ceecccCC-CceehHHHHHHHHhCCChhHHHHHHHHHHHHHhhhhcchhhhhhhhhhhhcccccccchhhhhHh--
Q psy8107 1144 GTG-LAFIAAEG-TGLAFIVFTQAIVELPGAPFWSIIFFMMLLSLGLGSQIGILEGVLCTIFDIEIFKRIRKPILTEA-- 1219 (1613)
Q Consensus 1144 ~~~-i~~~~~~G-~gL~Fi~lP~af~~mp~g~l~avLFFl~L~lagltS~isllE~iVt~l~D~~~~~r~~~~~~~~~-- 1219 (1613)
+.+ +.++.++| |||+|++||++|++||+|++|+++||+|+++||+||+++++|++++.++|+++++|++..+++.+
T Consensus 307 g~~~~~~v~~~G~pgL~Fi~~P~af~~mp~g~~~~~lFF~~l~~agltS~i~~~E~~vt~l~D~~~~~R~~~~~~v~~~~ 386 (519)
T 2a65_A 307 GVANAVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIV 386 (519)
T ss_dssp CHHHHHHHHHHCSSHHHHTHHHHHHTTSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHH
T ss_pred CCcchHHHhcCCCCceeHHHHHHHHHhCCCccchHHHHHHHHHHHHHHHHHHHhhHhHHHHHHhhCCcHHHHHHHHHHHH
Confidence 223 33455788 99999999999999999999999999999999999999999999999999999888777665544
Q ss_pred -hhhhhhcchh-hhHHHHHHHhhcceeeeeeeccccccceeccccCCceEEEEeE-eeechhhhhhcccCCccceeeehh
Q psy8107 1220 -LKGMEKVAEH-INEMQRIHEEYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGV-EWLNISDFLGKIKKGLELHAMCFV 1296 (1613)
Q Consensus 1220 -l~gL~~vt~g-G~y~~~l~d~yga~f~ll~~~~~~~l~e~Ials~~~lwiyg~~-~~~~i~~mlg~~~~~~~~w~~~w~ 1296 (1613)
++|+++++++ | ++++|+|.+.+.+.+. +++|++.++ |+||.. +..+++.|.+. +.+ .+|++||+
T Consensus 387 fllgl~~~~~~~g---~~~~D~~~~~~~l~~~----~l~~~i~v~----wv~g~~~~~~~i~~~~~~-~~~-~~w~~~~~ 453 (519)
T 2a65_A 387 FFSAHLVMFLNKS---LDEMDFWAGTIGVVFF----GLTELIIFF----WIFGADKAWEEINRGGII-KVP-RIYYYVMR 453 (519)
T ss_dssp HHHHHHHHHBTTH---HHHHHHHTTTHHHHHH----HHHHHHHHH----TTSCHHHHHHHHHTTCSS-CCC-THHHHHHH
T ss_pred HHHHHHHHcCCCC---cchHHHHHhHHHHHHH----HHHHHHhhh----eeeehhHHHHHHHcccCC-chH-HHHHHeEE
Confidence 4588899887 6 8899999877766665 899999888 999984 45578777665 333 68999999
Q ss_pred hhhhhhee
Q psy8107 1297 FKSAVVFL 1304 (1613)
Q Consensus 1297 fitPvill 1304 (1613)
|++|++++
T Consensus 454 ~v~P~~l~ 461 (519)
T 2a65_A 454 YITPAFLA 461 (519)
T ss_dssp THHHHHHH
T ss_pred ehHHHHHH
Confidence 99998776
|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >1by1_A Protein (PIX); RHO-GTPase exchange factor, transport protein; NMR {Homo sapiens} SCOP: a.87.1.1 | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A | Back alignment and structure |
|---|
| >4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A | Back alignment and structure |
|---|
| >2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A | Back alignment and structure |
|---|
| >2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A | Back alignment and structure |
|---|
| >2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A | Back alignment and structure |
|---|
| >2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A | Back alignment and structure |
|---|
| >2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A | Back alignment and structure |
|---|
| >3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A | Back alignment and structure |
|---|
| >1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* | Back alignment and structure |
|---|
| >1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A | Back alignment and structure |
|---|
| >1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2a65_A Leutaa, Na(+):neurotransmitter symporter (SNF family); membrane protein, transport protein; HET: BOG; 1.65A {Aquifex aeolicus} SCOP: f.54.1.1 PDB: 2q6h_A* 2q72_A* 2qb4_A* 2qei_A* 3f3a_A* 3f3c_A* 3f3d_A* 3f3e_A* 3f48_A* 3f4i_A* 3f4j_A* 3usg_A* 3usi_A 3usj_A 3usk_A 3usl_A* 3usm_A* 3uso_A 3usp_A* 3qs5_A* ... | Back alignment and structure |
|---|
| >1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* | Back alignment and structure |
|---|
| >2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A | Back alignment and structure |
|---|
| >1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A | Back alignment and structure |
|---|
| >2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A | Back alignment and structure |
|---|
| >1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A | Back alignment and structure |
|---|
| >2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A | Back alignment and structure |
|---|
| >1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A | Back alignment and structure |
|---|
| >2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A | Back alignment and structure |
|---|
| >3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A | Back alignment and structure |
|---|
| >2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A | Back alignment and structure |
|---|
| >3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A | Back alignment and structure |
|---|
| >2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A | Back alignment and structure |
|---|
| >1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A | Back alignment and structure |
|---|
| >2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A | Back alignment and structure |
|---|
| >1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} | Back alignment and structure |
|---|
| >2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A | Back alignment and structure |
|---|
| >2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A | Back alignment and structure |
|---|
| >2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A | Back alignment and structure |
|---|
| >3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 | Back alignment and structure |
|---|
| >1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A | Back alignment and structure |
|---|
| >2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A | Back alignment and structure |
|---|
| >1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 | Back alignment and structure |
|---|
| >4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} | Back alignment and structure |
|---|
| >3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 | Back alignment and structure |
|---|
| >3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A | Back alignment and structure |
|---|
| >4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A | Back alignment and structure |
|---|
| >4gou_A EHRGS-rhogef; RGS domain, DH domain, PH domain, RHO guanine nucleotide EXC factor, signaling protein, GTPase accelerating protein; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A | Back alignment and structure |
|---|
| >3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A | Back alignment and structure |
|---|
| >1c1y_B Proto-onkogene serine/threonine protein kinase RAF-1; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: d.15.1.5 PDB: 1gua_B* 1rfa_A 3kud_B* 3kuc_B* | Back alignment and structure |
|---|
| >1wxm_A A-RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain (RBD), ubiquitin-like fold, A-RAF kinase, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.5 | Back alignment and structure |
|---|
| >3ny5_A Serine/threonine-protein kinase B-RAF; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics consortium; HET: MSE; 1.99A {Homo sapiens} SCOP: d.15.1.0 | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >2l05_A Serine/threonine-protein kinase B-RAF; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rrb_A RAF-1 RBD, RAF proto-oncogene serine/threonine-protein kinase; RAS-binding domain, transferase, riken structural genomics/proteomics initiative; NMR {Rattus norvegicus} SCOP: d.15.1.5 | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >4djk_A Probable glutamate/gamma-aminobutyrate antiporter; LEUT, glutamate-GABA antiporter, transport protein; 3.10A {Escherichia coli} PDB: 4dji_A | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >2jln_A MHP1; hydantoin, transporter, membrane protein, nucleobase-cation-symport-1 family; 2.85A {Microbacterium liquefaciens} PDB: 2jlo_A* 2x79_A | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1613 | ||||
| d1foea2 | 162 | b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma in | 3e-71 | |
| d2a65a1 | 509 | f.54.1.1 (A:5-513) Na(+):neurotransmitter symporte | 9e-59 | |
| d2a65a1 | 509 | f.54.1.1 (A:5-513) Na(+):neurotransmitter symporte | 5e-19 | |
| d1foea1 | 206 | a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma in | 7e-50 | |
| d1by1a_ | 209 | a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxI | 4e-36 | |
| d1ki1b1 | 210 | a.87.1.1 (B:1229-1438) GEF of intersectin {Human ( | 2e-32 | |
| d2dfka1 | 203 | a.87.1.1 (A:37-239) Rho guanine nucleotide exchang | 2e-32 | |
| d1f5xa_ | 208 | a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [Ta | 4e-31 | |
| d1txda1 | 234 | a.87.1.1 (A:766-999) Rho guanine nucleotide exchan | 2e-29 | |
| d1xcga1 | 228 | a.87.1.1 (A:714-941) Rho guanine nucleotide exchan | 3e-29 | |
| d1ntya1 | 184 | a.87.1.1 (A:1231-1414) Triple functional domain pr | 2e-28 | |
| d1dbha1 | 207 | a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {H | 2e-28 | |
| d1kz7a1 | 195 | a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse | 2e-27 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 1e-15 | |
| d1btna_ | 106 | b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), | 3e-15 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 1e-13 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 4e-12 | |
| d1wjma_ | 123 | b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), | 8e-12 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 5e-10 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 2e-09 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 2e-09 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 2e-08 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 4e-08 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 5e-08 | |
| d2elba2 | 101 | b.55.1.1 (A:274-374) DCC-interacting protein 13-al | 7e-08 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 1e-07 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 2e-07 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 3e-07 | |
| d1wgqa_ | 109 | b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin | 3e-07 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 6e-07 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 8e-07 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 1e-06 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 1e-06 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 1e-06 | |
| d2fjla1 | 101 | b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph | 2e-06 | |
| d1m5za_ | 91 | b.36.1.1 (A:) Glutamate receptor interacting prote | 3e-06 | |
| d1qqga1 | 103 | b.55.1.2 (A:12-114) Insulin receptor substrate 1, | 5e-06 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 5e-06 | |
| d2coca1 | 99 | b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont | 6e-06 | |
| d1x1fa1 | 136 | b.55.1.1 (A:8-143) Signal-transducing adaptor prot | 8e-06 | |
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 2e-05 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 2e-05 | |
| d1ueza_ | 101 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 2e-05 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 3e-05 | |
| d1ihja_ | 94 | b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga | 4e-05 | |
| d2cofa1 | 95 | b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) | 5e-05 | |
| d1txda2 | 114 | b.55.1.1 (A:1020-1133) Rho guanine nucleotide exch | 5e-05 | |
| d2csja1 | 104 | b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj | 8e-05 | |
| d1ujda_ | 117 | b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human | 1e-04 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 1e-04 | |
| d1x5qa1 | 97 | b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom | 2e-04 | |
| d1wh1a_ | 124 | b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human | 3e-04 | |
| d1pw4a_ | 447 | f.38.1.1 (A:) Glycerol-3-phosphate transporter {Es | 3e-04 | |
| d1g9oa_ | 91 | b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, | 3e-04 | |
| d1n7ea_ | 95 | b.36.1.1 (A:) Glutamate receptor-interacting prote | 5e-04 | |
| d1wg6a_ | 127 | b.36.1.1 (A:) Partitioning-defective 3-like protei | 6e-04 | |
| d1wf8a1 | 94 | b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens | 7e-04 | |
| d1whaa_ | 105 | b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap | 0.001 | |
| d1uf1a_ | 128 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 0.001 | |
| d1xcga2 | 140 | b.55.1.1 (A:942-1081) Rho guanine nucleotide excha | 0.002 | |
| d1y7na1 | 79 | b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote | 0.002 | |
| d1wi4a1 | 96 | b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou | 0.002 | |
| d1x5ra1 | 99 | b.36.1.1 (A:8-106) Glutamate receptor interacting | 0.003 | |
| d1p1da2 | 99 | b.36.1.1 (A:115-213) Glutamate receptor interactin | 0.003 | |
| d2f5ya1 | 77 | b.36.1.1 (A:19-95) Regulator of G-protein signalin | 0.004 | |
| d1v6ba_ | 118 | b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI | 0.004 | |
| d1v5pa_ | 126 | b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: | 0.004 | |
| d1rzxa_ | 98 | b.36.1.1 (A:) GTPase-binding domain of the cell po | 0.004 |
| >d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 162 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 232 bits (594), Expect = 3e-71
Identities = 64/162 (39%), Positives = 98/162 (60%), Gaps = 2/162 (1%)
Query: 1239 EYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGVEWLNISDFLGKIKKGLELHAMCFVFK 1298
E+GA+FD L + K+ DLS GDLL + V WLN LGK KK EL A FVFK
Sbjct: 1 EFGAVFDQLIAEQTGEKKEVADLSMGDLLLHTSVIWLNPPASLGKWKKEPELAA--FVFK 58
Query: 1299 SAVVFLCKERLRQKKKLIGVSNKGCSNEVEIIRYQVLVPVTEVQVRASSAKDMDSHFLWE 1358
+AVV + K+ +QKKKL+G E + R++ ++P +QVRA + D +++ + E
Sbjct: 59 TAVVLVYKDGSKQKKKLVGSHRLSIYEEWDPFRFRHMIPTEALQVRALPSADAEANAVCE 118
Query: 1359 LIHLRSQIQRRTEKVYVLSNSTAEFRNAFLKTIRQIIRESVR 1400
++H++S+ + R E+V+ L S+ E R FLK++ I+R+ R
Sbjct: 119 IVHVKSESEGRPERVFHLCCSSPESRKDFLKSVHSILRDKHR 160
|
| >d2a65a1 f.54.1.1 (A:5-513) Na(+):neurotransmitter symporter homologue LeuT {Aquifex aeolicus [TaxId: 63363]} Length = 509 | Back information, alignment and structure |
|---|
| >d2a65a1 f.54.1.1 (A:5-513) Na(+):neurotransmitter symporter homologue LeuT {Aquifex aeolicus [TaxId: 63363]} Length = 509 | Back information, alignment and structure |
|---|
| >d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 206 | Back information, alignment and structure |
|---|
| >d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 210 | Back information, alignment and structure |
|---|
| >d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 203 | Back information, alignment and structure |
|---|
| >d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} Length = 208 | Back information, alignment and structure |
|---|
| >d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 234 | Back information, alignment and structure |
|---|
| >d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Length = 184 | Back information, alignment and structure |
|---|
| >d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 | Back information, alignment and structure |
|---|
| >d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Length = 195 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Length = 447 | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1613 | |||
| d2a65a1 | 509 | Na(+):neurotransmitter symporter homologue LeuT {A | 100.0 | |
| d1foea2 | 162 | GEF of TIAM1 (T-Lymphoma invasion and metastasis i | 100.0 | |
| d1foea1 | 206 | GEF of TIAM1 (T-Lymphoma invasion and metastasis i | 99.97 | |
| d2dfka1 | 203 | Rho guanine nucleotide exchange factor 9, Collybis | 99.95 | |
| d1f5xa_ | 208 | RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} | 99.95 | |
| d1by1a_ | 209 | beta-pix {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1ki1b1 | 210 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 99.94 | |
| d1xcga1 | 228 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 99.93 | |
| d1kz7a1 | 195 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 99.92 | |
| d1txda1 | 234 | Rho guanine nucleotide exchange factor 12 {Human ( | 99.92 | |
| d1ntya1 | 184 | Triple functional domain protein TRIO {Human (Homo | 99.92 | |
| d1dbha1 | 207 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 99.91 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 99.57 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 99.54 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 99.53 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 99.53 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.51 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.5 | |
| d1m5za_ | 91 | Glutamate receptor interacting protein {Rat (Rattu | 99.5 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 99.49 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 99.48 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 99.47 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 99.47 | |
| d1ozia_ | 99 | Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 | 99.46 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 99.46 | |
| d1wf8a1 | 94 | Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1x5qa1 | 97 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.45 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 99.45 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 99.44 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.44 | |
| d2f5ya1 | 77 | Regulator of G-protein signaling 3, RGS3 {Human (H | 99.43 | |
| d1rgra_ | 93 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 99.42 | |
| d2fcfa1 | 96 | Multiple PDZ domain protein {Human (Homo sapiens) | 99.42 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 99.42 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.42 | |
| d1rzxa_ | 98 | GTPase-binding domain of the cell polarity protein | 99.41 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 99.41 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 99.41 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 99.4 | |
| d1tp5a1 | 102 | Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ | 99.39 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1q3oa_ | 104 | Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId | 99.39 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 99.39 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 99.37 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 99.37 | |
| d1w9ea1 | 85 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 99.36 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 99.36 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 99.35 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.35 | |
| d1um1a_ | 110 | Hypothetical protein KIAA1849 {Human (Homo sapiens | 99.34 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 99.34 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.33 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 99.33 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 99.33 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.33 | |
| d1v62a_ | 117 | Glutamate receptor interacting protein 2, GRIP2 (K | 99.31 | |
| d1vaea_ | 111 | Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.31 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.31 | |
| d1uita_ | 117 | Discs large 5 protein KIAA0583 {Human (Homo sapien | 99.31 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 99.3 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 99.3 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 99.3 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 99.3 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.29 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 99.28 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.27 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.27 | |
| d1va8a1 | 100 | Maguk p55 subfamily member 5 {Mouse (Mus musculus) | 99.27 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 99.27 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d1ujda_ | 117 | Hypothetical protein KIAA0559 {Human (Homo sapiens | 99.26 | |
| d1wf7a_ | 103 | Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 | 99.26 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 99.25 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 99.25 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.24 | |
| d1x45a1 | 85 | Amyloid beta A4 precursor protein-binding family A | 99.24 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.22 | |
| d2cssa1 | 108 | Regulating synaptic membrane exocytosis protein 1, | 99.21 | |
| d1wg6a_ | 127 | Partitioning-defective 3-like protein, PAR3-L (RIK | 99.21 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 99.2 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 99.18 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.18 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 99.14 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 99.14 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.13 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 99.12 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.11 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.11 | |
| d1wifa_ | 126 | hypothetical PDZ domain containing protein Uqcrc2 | 99.1 | |
| d1fc6a3 | 92 | Photosystem II D1 C-terminal processing protease { | 99.08 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.07 | |
| d1wh1a_ | 124 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 99.04 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.03 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 99.02 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.0 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 98.99 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 98.98 | |
| d2a65a1 | 509 | Na(+):neurotransmitter symporter homologue LeuT {A | 98.97 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 98.96 | |
| d1ujva_ | 96 | Membrane associated guanylate kinase inverted-2 (M | 98.92 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 98.91 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 98.9 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.79 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 98.66 | |
| d2z9ia1 | 88 | Protease PepD {Mycobacterium tuberculosis [TaxId: | 98.52 | |
| d1lcya1 | 100 | Mitochondrial serine protease HtrA2 {Human (Homo s | 98.45 | |
| d1ky9b2 | 88 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 98.39 | |
| d2i6va1 | 87 | General secretion pathway protein C, EpsC {Vibrio | 98.13 | |
| d1k32a1 | 91 | Tricorn protease {Archaeon Thermoplasma acidophilu | 98.09 | |
| d2hgaa1 | 103 | Uncharacterized protein MTH1368 {Methanobacterium | 97.98 | |
| d1ky9a1 | 94 | Protease Do (DegP, HtrA), C-terminal domains {Esch | 97.97 | |
| d1sota1 | 99 | Stress sensor protease DegS, C-terminal domain {Es | 97.92 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 97.83 | |
| d1wxma1 | 73 | A-Raf proto-oncogene serine/threonine-protein kina | 97.57 | |
| d1c1yb_ | 77 | c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} | 97.46 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 96.9 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 96.79 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 96.77 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 96.46 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 94.98 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 94.57 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 94.31 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 93.68 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 93.57 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 92.57 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 92.03 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 89.01 | |
| d1wgra_ | 100 | Growth factor receptor-bound protein 7, GRB-7 {Hum | 88.37 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 87.37 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 80.74 |
| >d2a65a1 f.54.1.1 (A:5-513) Na(+):neurotransmitter symporter homologue LeuT {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: SNF-like superfamily: SNF-like family: SNF-like domain: Na(+):neurotransmitter symporter homologue LeuT species: Aquifex aeolicus [TaxId: 63363]
Probab=100.00 E-value=2.3e-65 Score=636.55 Aligned_cols=435 Identities=19% Similarity=0.292 Sum_probs=356.9
Q ss_pred cccccccccchhhhhHHhhhheeeeccCCCc--ccccccchhHhHHHHHhhhcchhhhHHHhhhhccCCChhhhhhhh--
Q psy8107 841 YWQITWRFLGPAIMSCILVSSIICRFLKKPS--YSAWNRAFLIPFMVMLILEGIPLFLIELGIGQKMRLGSLGVWNTI-- 916 (1613)
Q Consensus 841 yWk~cW~fItP~il~~I~i~~ii~~~~~~P~--Y~~~g~~FLIpYli~l~liGlPll~lElalGQ~~r~g~i~a~~~i-- 916 (1613)
-|...+.|+..+++.+++++|+ ||+|+ |.|||+||+|||+++++++|+|++++|+++||++|+|++++|+.+
T Consensus 3 ~W~s~~~fila~~g~avGlGNi----WrFPyl~~~nGGgaFlipY~~~l~l~gvPll~lE~~lGq~~~~g~i~~~~~i~~ 78 (509)
T d2a65a1 3 HWATRLGLILAMAGNAVGLGNF----LRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIEWAMGRYGGAQGHGTTPAIFY 78 (509)
T ss_dssp CCSCHHHHHHHHHHHHSSHHHH----THHHHHHHHTTTHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHTTTCCSHHHHHH
T ss_pred CCCChHHHHHHHHHHHhcccHH----HhhhHHHHhcCCchhHHHHHHHHHHHHHHHHHHHHHHcCCCCCCcccHHHHHHH
Confidence 3788888999999999999876 89996 789999999999999999999999999999999999999999987
Q ss_pred ----hhcccccchhhHHHHHHHHhhhhHHHHHHHHHHHhhcccCCCCCCCCCCCCCCcCCcccCCchhhhhhhhhccc--
Q psy8107 917 ----HPWLGGVGISSCLVTFFVALYYNVIITWCFYYLFNSFSSSLPWSSCPTDHNGTIIPECELSSETAYFWYRTTLD-- 990 (1613)
Q Consensus 917 ----~p~~~GvG~~~~li~~li~~YYsVi~aW~L~Y~~~Sf~~~lpW~~C~~~~n~~~~~~C~~s~~~~~f~~~~vL~-- 990 (1613)
+|+++|+|++++++++++++||+++++|+++|+++++++.+||..|++.+++ +. .++..+|+++.+..
T Consensus 79 ~~~~~~~~~giG~~~~~~~~~i~~yy~vi~~w~l~Y~~~s~~~~lp~~~~~~~~~~-----~~-~~~~~~~~~~~~~~~~ 152 (509)
T d2a65a1 79 LLWRNRFAKILGVFGLWIPLVVAIYYVYIESWTLGFAIKFLVGLVPEPPPNATDPD-----SI-LRPFKEFLYSYIGVPK 152 (509)
T ss_dssp HHSCSHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCCCCC--CCHH-----HH-HHHHHHHHHHHHTCCS
T ss_pred HhccCcchhHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcCCCCcccccCcc-----cc-ccchHHHHHhhhcccc
Confidence 5778999999999999999999999999999999999999999988765421 11 12344555543322
Q ss_pred cCCCCCCCCc-hhHHHHHHHHHHHHHHHHhhhcccccceeeeeehhhHHHHHHHHHHHHhccCC----Chhccceeeecc
Q psy8107 991 VSPNIESPGS-PKWWIVLCLLLAWIIVFFIVMKGIQSSGRVVYFTSMFPYIVLTIFFIRGITLP----GAGAGLVHMYTP 1065 (1613)
Q Consensus 991 ~s~~i~~~g~-~~~~l~l~l~l~w~iv~~~v~kGI~~~gKv~~~~~l~P~vlL~iLlir~ltL~----Ga~~Gl~~lf~P 1065 (1613)
..+.+.+... ....++++++++|++++.++.||+|+.+|+++.+.++| +++++++.++++ ||.+|+.|+++|
T Consensus 153 ~~~~~~~~~~~~~~~~~~~~~i~~~i~~~gi~kGi~~~~kv~~~~l~~~---~~~l~i~~~~l~~~~gga~~gl~~~~~p 229 (509)
T d2a65a1 153 GDEPILKPSLFAYIVFLITMFINVSILIRGISKGIERFAKIAMPTLFIL---AVFLVIRVFLLETPNGTAADGLNFLWTP 229 (509)
T ss_dssp SSSCBCCCCHHHHHHHHHHHHHHHHHHTTCTTTTHHHHHHHHHHHHHHH---HHHHHHHHTTCEETTEEHHHHHHHHHSC
T ss_pred CCCccccchHHHHHHHHHHHHHHHHHHhhcccchhhhhhHHHHHHHHHH---HHHHHHHhhhcccCCCcHHHHhhhccCC
Confidence 2223333322 33456678899999999999999999999955444333 344555666555 799999999999
Q ss_pred ccccccChhHHHHHHhhHHHhhcccccceehhccccCCCCccccceehhhhhHHHHHHHHHHHHHhhhccccccccccCC
Q psy8107 1066 KVEKLLDPNVWLDAATQVFYSFGLAFGSLIAFGSYNQPNNNCVRDVIMVSICNALTAIYASVVVFAILGFKAMSNAAEGT 1145 (1613)
Q Consensus 1066 d~s~L~~~~vW~~A~~QaFfSLslG~G~mitygSY~~~~~ni~rda~~v~~~n~~vSllAgl~IFsilG~~a~~~~~~~~ 1145 (1613)
||++|.++++|.+|++|+|||+|+|+|++++|||||++++|+.||+++++++|+.+++++|.+++...++..... ..
T Consensus 230 d~~~L~~~~vW~~A~~Q~ffSlgiG~G~~i~~~Sy~~~~~n~~rda~~v~~~~~~~si~~~~~~~~~~~~~~~~~---~~ 306 (509)
T d2a65a1 230 DFEKLKDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKAEVILGGSISIPAAVAFFGV---AN 306 (509)
T ss_dssp CTTSTTCHHHHHHHHHHHHHHHTTTSSHHHHHHTTSCTTSCCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHCH---HH
T ss_pred CHHHhcChHHHHHHHHHHhhhhcccCCceeeehhhccchhhhcccceEEEecccceeeccccchhhhhheeeecc---cc
Confidence 999999999999999999999999999999999999999999999999999999999999988887776654321 11
Q ss_pred CceecccCCCceehHHHHHHHHhCCChhHHHHHHHHHHHHHhhhhcchhhhhhhhhhhhcccccccchhhhhHhh----h
Q psy8107 1146 GLAFIAAEGTGLAFIVFTQAIVELPGAPFWSIIFFMMLLSLGLGSQIGILEGVLCTIFDIEIFKRIRKPILTEAL----K 1221 (1613)
Q Consensus 1146 ~i~~~~~~G~gL~Fi~lP~af~~mp~g~l~avLFFl~L~lagltS~isllE~iVt~l~D~~~~~r~~~~~~~~~l----~ 1221 (1613)
+.+..+.+|+||.|+++|++|++||+|++|+++||+|++++|++|+++++|++++.+.|++..+|+++..+++.+ .
T Consensus 307 ~~~~~~~~g~~L~Fv~~P~~fs~~~~~~~~~~lFF~~l~~~gl~s~i~~~e~~v~~l~d~~~~~r~~~~~~~~~~~~~~~ 386 (509)
T d2a65a1 307 AVAIAKAGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFFAGLTSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIVFFSA 386 (509)
T ss_dssp HHHHHHHCSSHHHHTHHHHHHTTSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHHHHHH
T ss_pred ccccccccCCCchhhhhHHHhhcCCcchhHHHHHHHHHHHHHHHHHhccccchhHHHHHhcCCchhhhhhheeEEEEhhh
Confidence 233455689999999999999999999999999999999999999999999999999999887776665544333 2
Q ss_pred hhhhcchhhhHHHHHHHhhcceeeeeeeccccccceeccccCCceEEEEeEee-echhhhhhcccCCccceeeehhhhhh
Q psy8107 1222 GMEKVAEHINEMQRIHEEYGAIFDHLFRQHQKSCKQPIDLSPGDLLYYGGVEW-LNISDFLGKIKKGLELHAMCFVFKSA 1300 (1613)
Q Consensus 1222 gL~~vt~gG~y~~~l~d~yga~f~ll~~~~~~~l~e~Ials~~~lwiyg~~~~-~~i~~mlg~~~~~~~~w~~~w~fitP 1300 (1613)
++++++.++ ++++|.|.+.+.+.+. +++|++++. |+||..++ .|++.|.|. +.. .+|+++|+|++|
T Consensus 387 ~~~~~~~~~---~~~~D~~~~~~~l~~~----~l~e~i~v~----w~yg~~r~~~di~~~~~~-~~~-~~~~~~~~~i~P 453 (509)
T d2a65a1 387 HLVMFLNKS---LDEMDFWAGTIGVVFF----GLTELIIFF----WIFGADKAWEEINRGGII-KVP-RIYYYVMRYITP 453 (509)
T ss_dssp HHHHHBTTH---HHHHHHHTTTHHHHHH----HHHHHHHHH----TTSCHHHHHHHHHTTCSS-CCC-THHHHHHHTHHH
T ss_pred hHHHHhcch---HHHHHHHHHHHHHHHH----HHHHHheee----eEecHHHHHHHHHhCCCC-CHH-HHHHHheeeeeH
Confidence 555666665 4567888877766666 799999888 99999554 578888887 333 689999999999
Q ss_pred hhee
Q psy8107 1301 VVFL 1304 (1613)
Q Consensus 1301 vill 1304 (1613)
++++
T Consensus 454 i~l~ 457 (509)
T d2a65a1 454 AFLA 457 (509)
T ss_dssp HHHH
T ss_pred hhhh
Confidence 8775
|
| >d1foea2 b.55.1.1 (A:1240-1401) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1foea1 a.87.1.1 (A:1034-1239) GEF of TIAM1 (T-Lymphoma invasion and metastasis inducing protein 1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dfka1 a.87.1.1 (A:37-239) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f5xa_ a.87.1.1 (A:) RhoGEF Vav {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1by1a_ a.87.1.1 (A:) beta-pix {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b1 a.87.1.1 (B:1229-1438) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga1 a.87.1.1 (A:714-941) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1txda1 a.87.1.1 (A:766-999) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ntya1 a.87.1.1 (A:1231-1414) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dbha1 a.87.1.1 (A:198-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a65a1 f.54.1.1 (A:5-513) Na(+):neurotransmitter symporter homologue LeuT {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|