Psyllid ID: psy8140

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MGSIVSLIAHLMRDIAFSRYIKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWNCPVCDKVGHLILLCMAMIESVCLFLC
cccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcEEEEEcccccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcc
cccHHHHHccccccccHHHHHHccccccccccEEEEEEEEEEEccccEEEEEEcccccccccEEEEcHHHHHHHHccccccEccccccHHHHHHHHHHHHHcEEEEcc
MGSIVSLIAHLMRDIAFSRYIKEkynsendseiktleltsslicplgkmrmafptkastcahlqcfdgatfikmnelkpkwncpvcdkvGHLILLCMAMIESVCLFLC
MGSIVSLIAHLMRDIAFSRYIKEKynsendseiktlelTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWNCPVCDKVGHLILLCMAMIESVCLFLC
MGSIVSLIAHLMRDIAFSRYIKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWNCPVCDKVGHLILLCMAMIESVCLFLC
***IVSLIAHLMRDIAFSRYIKEKYNSE*DSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWNCPVCDKVGHLILLCMAMIESVCLFL*
*GSIVSLIA***********************IKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWNCPVCDKVGHLILLCMAMIESVCLFLC
MGSIVSLIAHLMRDIAFSRYIKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWNCPVCDKVGHLILLCMAMIESVCLFLC
*****S***H**RDIAFSRYIKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWNCPVCDKVGHLILLCMAMIESVCLFLC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSIVSLIAHLMRDIAFSRYIKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWNCPVCDKVGHLILLCMAMIESVCLFLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query108 2.2.26 [Sep-21-2011]
O88907 651 E3 SUMO-protein ligase PI yes N/A 0.685 0.113 0.584 9e-21
O75925 651 E3 SUMO-protein ligase PI yes N/A 0.685 0.113 0.584 1e-20
Q6AZ28 572 E3 SUMO-protein ligase PI no N/A 0.629 0.118 0.617 1e-20
O75928 621 E3 SUMO-protein ligase PI no N/A 0.629 0.109 0.617 2e-20
O54714 628 E3 SUMO-protein ligase PI no N/A 0.629 0.108 0.602 2e-20
Q9Y6X2 628 E3 SUMO-protein ligase PI no N/A 0.629 0.108 0.602 2e-20
O70260 628 E3 SUMO-protein ligase PI no N/A 0.629 0.108 0.602 2e-20
Q8C5D8 621 E3 SUMO-protein ligase PI no N/A 0.629 0.109 0.617 2e-20
Q8N2W9 510 E3 SUMO-protein ligase PI no N/A 0.629 0.133 0.588 8e-19
Q9JM05 507 E3 SUMO-protein ligase PI no N/A 0.629 0.134 0.588 8e-19
>sp|O88907|PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus GN=Pias1 PE=1 SV=2 Back     alignment and function desciption
 Score = 98.6 bits (244), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 54/77 (70%), Gaps = 3/77 (3%)

Query: 21  IKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPK 80
           IKEK  ++ DSEI T  L  SL+CPLGKMR+  P +A TC+HLQCFD   +I+MNE KP 
Sbjct: 312 IKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDATLYIQMNEKKPT 371

Query: 81  WNCPVCDKVG---HLIL 94
           W CPVCDK     HLI+
Sbjct: 372 WVCPVCDKKAPYEHLII 388
Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. In vitro, binds A/T-rich DNA (By similarity). The effects of this transcriptional coregulation, transactivation or silencing, may vary depending upon the biological context. Together with PRMT1, may repress STAT1 transcriptional activity, in the late phase of interferon gamma (IFN-gamma) signaling.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|O75925|PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens GN=PIAS1 PE=1 SV=2 Back     alignment and function description
>sp|Q6AZ28|PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus GN=Pias2 PE=1 SV=1 Back     alignment and function description
>sp|O75928|PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens GN=PIAS2 PE=1 SV=3 Back     alignment and function description
>sp|O54714|PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus GN=Pias3 PE=1 SV=3 Back     alignment and function description
>sp|Q9Y6X2|PIAS3_HUMAN E3 SUMO-protein ligase PIAS3 OS=Homo sapiens GN=PIAS3 PE=1 SV=2 Back     alignment and function description
>sp|O70260|PIAS3_RAT E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus GN=Pias3 PE=1 SV=2 Back     alignment and function description
>sp|Q8C5D8|PIAS2_MOUSE E3 SUMO-protein ligase PIAS2 OS=Mus musculus GN=Pias2 PE=1 SV=2 Back     alignment and function description
>sp|Q8N2W9|PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens GN=PIAS4 PE=1 SV=1 Back     alignment and function description
>sp|Q9JM05|PIAS4_MOUSE E3 SUMO-protein ligase PIAS4 OS=Mus musculus GN=Pias4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
340002860 650 protein inhibitor of activated STAT [Ano 0.666 0.110 0.657 6e-23
345498422 581 PREDICTED: E3 SUMO-protein ligase PIAS3- 0.629 0.117 0.676 1e-22
345498420 580 PREDICTED: E3 SUMO-protein ligase PIAS3- 0.629 0.117 0.676 1e-22
307180996 568 E3 SUMO-protein ligase PIAS1 [Camponotus 0.629 0.119 0.676 2e-22
332028676 565 E3 SUMO-protein ligase PIAS3 [Acromyrmex 0.629 0.120 0.676 2e-22
322783212 556 hypothetical protein SINV_03840 [Solenop 0.629 0.122 0.676 2e-22
383862081 564 PREDICTED: E3 SUMO-protein ligase PIAS1- 0.629 0.120 0.676 2e-22
345498424 547 PREDICTED: E3 SUMO-protein ligase PIAS3- 0.629 0.124 0.676 2e-22
307203610 571 E3 SUMO-protein ligase PIAS2 [Harpegnath 0.629 0.119 0.676 2e-22
350400598 565 PREDICTED: E3 SUMO-protein ligase PIAS1- 0.629 0.120 0.676 3e-22
>gi|340002860|gb|AEK26394.1| protein inhibitor of activated STAT [Anopheles aquasalis] Back     alignment and taxonomy information
 Score =  111 bits (277), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 48/73 (65%), Positives = 57/73 (78%), Gaps = 1/73 (1%)

Query: 17  FSR-YIKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMN 75
           F+R  IKEK N + DSEI T  L  SLICPLGKMRM+ P +ASTC+HLQCFD + +++MN
Sbjct: 359 FTRALIKEKLNEDADSEIATTMLKVSLICPLGKMRMSTPCRASTCSHLQCFDASLYLQMN 418

Query: 76  ELKPKWNCPVCDK 88
           E KP WNCPVCDK
Sbjct: 419 ERKPTWNCPVCDK 431

Source: Anopheles aquasalis

Species: Anopheles aquasalis

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345498422|ref|XP_001607391.2| PREDICTED: E3 SUMO-protein ligase PIAS3-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345498420|ref|XP_003428227.1| PREDICTED: E3 SUMO-protein ligase PIAS3-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307180996|gb|EFN68770.1| E3 SUMO-protein ligase PIAS1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332028676|gb|EGI68710.1| E3 SUMO-protein ligase PIAS3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322783212|gb|EFZ10798.1| hypothetical protein SINV_03840 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383862081|ref|XP_003706512.1| PREDICTED: E3 SUMO-protein ligase PIAS1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345498424|ref|XP_003428228.1| PREDICTED: E3 SUMO-protein ligase PIAS3-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307203610|gb|EFN82639.1| E3 SUMO-protein ligase PIAS2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350400598|ref|XP_003485893.1| PREDICTED: E3 SUMO-protein ligase PIAS1-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
UNIPROTKB|B4DGW0 282 PIAS2 "cDNA FLJ57366, highly s 0.629 0.241 0.617 4.4e-20
UNIPROTKB|I3LBH1 282 PIAS2 "Uncharacterized protein 0.629 0.241 0.617 4.4e-20
ZFIN|ZDB-GENE-050419-202 650 pias1b "protein inhibitor of a 0.777 0.129 0.544 1.3e-19
UNIPROTKB|F1NPS3 555 PIAS1 "Uncharacterized protein 0.685 0.133 0.584 1.5e-19
UNIPROTKB|F1SJH4 570 PIAS1 "Uncharacterized protein 0.685 0.129 0.584 1.6e-19
UNIPROTKB|Q24JZ9 651 PIAS1 "Protein inhibitor of ac 0.685 0.113 0.584 2.1e-19
UNIPROTKB|F1PQ60 651 PIAS1 "Uncharacterized protein 0.685 0.113 0.584 2.1e-19
UNIPROTKB|O75925 651 PIAS1 "E3 SUMO-protein ligase 0.685 0.113 0.584 2.1e-19
MGI|MGI:1913125 651 Pias1 "protein inhibitor of ac 0.685 0.113 0.584 2.1e-19
RGD|1307843 651 Pias1 "protein inhibitor of ac 0.685 0.113 0.584 2.1e-19
UNIPROTKB|B4DGW0 PIAS2 "cDNA FLJ57366, highly similar to Protein inhibitor of activated STAT2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 238 (88.8 bits), Expect = 4.4e-20, P = 4.4e-20
 Identities = 42/68 (61%), Positives = 50/68 (73%)

Query:    21 IKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPK 80
             IKEK  ++ DSEI T  L  SL+CPLGKMR+  P +A TC HLQCFD A +++MNE KP 
Sbjct:    33 IKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPT 92

Query:    81 WNCPVCDK 88
             W CPVCDK
Sbjct:    93 WICPVCDK 100
GO:0008270 "zinc ion binding" evidence=IEA
GO:0019789 "SUMO ligase activity" evidence=IEA
UNIPROTKB|I3LBH1 PIAS2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050419-202 pias1b "protein inhibitor of activated STAT, 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPS3 PIAS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SJH4 PIAS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q24JZ9 PIAS1 "Protein inhibitor of activated STAT, 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQ60 PIAS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O75925 PIAS1 "E3 SUMO-protein ligase PIAS1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1913125 Pias1 "protein inhibitor of activated STAT 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307843 Pias1 "protein inhibitor of activated STAT, 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O88907PIAS1_MOUSE6, ., 3, ., 2, ., -0.58440.68510.1136yesN/A
O75925PIAS1_HUMAN6, ., 3, ., 2, ., -0.58440.68510.1136yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
pfam0289150 pfam02891, zf-MIZ, MIZ/SP-RING zinc finger 1e-17
>gnl|CDD|111745 pfam02891, zf-MIZ, MIZ/SP-RING zinc finger Back     alignment and domain information 
 Score = 69.6 bits (171), Expect = 1e-17
 Identities = 24/48 (50%), Positives = 33/48 (68%)

Query: 41 SLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWNCPVCDK 88
          SL CP+  +R++ P +   C H+QCFD  +F++ NE  P WNCPVCDK
Sbjct: 2  SLKCPISYLRISIPVRGRFCKHIQCFDLLSFLESNERTPTWNCPVCDK 49

This domain has SUMO (small ubiquitin-like modifier) ligase activity and is involved in DNA repair and chromosome organisation. Length = 50

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 108
KOG2169|consensus 636 99.94
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 99.93
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 99.51
KOG2979|consensus262 98.79
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.42
COG5627275 MMS21 DNA repair protein MMS21 [DNA replication, r 98.16
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.99
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 96.89
COG5222427 Uncharacterized conserved protein, contains RING Z 96.55
PF04641260 Rtf2: Rtf2 RING-finger 96.47
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.01
KOG2164|consensus 513 96.0
cd0016245 RING RING-finger (Really Interesting New Gene) dom 95.48
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 94.83
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 93.41
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 92.5
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 92.38
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 92.02
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 91.38
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 91.29
PF0481040 zf-Sec23_Sec24: Sec23/Sec24 zinc finger; InterPro: 90.82
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 89.9
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 88.18
KOG0320|consensus187 87.68
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 87.22
smart00531147 TFIIE Transcription initiation factor IIE. 86.42
KOG0978|consensus698 86.05
PF0442354 Rad50_zn_hook: Rad50 zinc hook motif; InterPro: IP 85.71
PF1463444 zf-RING_5: zinc-RING finger domain 85.31
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 84.97
KOG2177|consensus 386 84.62
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 83.76
PHA02929238 N1R/p28-like protein; Provisional 82.0
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 80.98
>KOG2169|consensus Back     alignment and domain information 
Probab=99.94  E-value=3.8e-27  Score=201.40  Aligned_cols=105  Identities=41%  Similarity=0.678  Sum_probs=100.0

Q ss_pred             hHHHHhccCCCh--HHHH-HHHHHhccCCCCceeeeeeeeeecCCCccccccccccccccCccceecHHHHHHHhcCCCc
Q psy8140           4 IVSLIAHLMRDI--AFSR-YIKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPK   80 (108)
Q Consensus         4 l~~l~~~~~~~~--~~~~-~i~~~~~~~~Dddi~~~~~~vsL~CPlS~~ri~~P~Rg~~C~H~qCFDl~~fl~~~~~~~~   80 (108)
                      |++++.++.++.  +.++ .|++++.+++|.||+.+...|||.|||+++||.+|+|+..|+|+||||+..|+++|+++++
T Consensus       266 lq~~~~~~~~~~~~~~s~~~~~~~l~~~~d~~i~tt~~~vSL~CPl~~~Rm~~P~r~~~CkHlQcFD~~~~lq~n~~~pT  345 (636)
T KOG2169|consen  266 LQRLKQNGKINRNLSQSDALIKKKLTAGPDSEIATTSLRVSLNCPLSKMRMSLPARGHTCKHLQCFDALSYLQMNEQKPT  345 (636)
T ss_pred             HHHHhccCCccCchhHhHHHhhcccccCCcccceeccceeEecCCcccceeecCCcccccccceecchhhhHHhccCCCe
Confidence            788999999998  7777 8888898899999999999999999999999999999999999999999999999999999


Q ss_pred             eecccCCCcccCCCeeehhhhhhhhhcC
Q psy8140          81 WNCPVCDKVGHLILLCMAMIESVCLFLC  108 (108)
Q Consensus        81 W~CPiC~~~~~~~dL~iD~~~~~~l~~~  108 (108)
                      |+||||++.+.+++|+||+|++.||.-|
T Consensus       346 W~CPVC~~~~~~e~l~iD~~~~~iL~~~  373 (636)
T KOG2169|consen  346 WRCPVCQKAAPFEGLIIDGYFLNILQSC  373 (636)
T ss_pred             eeCccCCccccccchhhhHHHHHHHhhc
Confidence            9999999999999999999999999754

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2979|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF04810 zf-Sec23_Sec24: Sec23/Sec24 zinc finger; InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>PF04423 Rad50_zn_hook: Rad50 zinc hook motif; InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
4fo9_A360 Crystal Structure Of The E3 Sumo Ligase Pias2 Lengt 9e-21
3i2d_A371 Crystal Structure Of S. Cerevisiae Sumo E3 Ligase S 6e-11
>pdb|4FO9|A Chain A, Crystal Structure Of The E3 Sumo Ligase Pias2 Length = 360 Back     alignment and structure 
Iteration: 1

 Score = 95.1 bits (235), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 45/78 (57%), Positives = 55/78 (70%), Gaps = 1/78 (1%)
Query: 12  MRDIAFSR-YIKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGAT 70
           +R+   SR  IKEK  ++ DSEI T  L  SL+CPLGKMR+  P +A TC HLQCFD A 
Sbjct: 185 IRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAAL 244
Query: 71  FIKMNELKPKWNCPVCDK 88
           +++MNE KP W CPVCDK
Sbjct: 245 YLQMNEKKPTWICPVCDK 262
>pdb|3I2D|A Chain A, Crystal Structure Of S. Cerevisiae Sumo E3 Ligase Siz1 Length = 371 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 7e-23
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 3e-22
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 8e-11
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 Back     alignment and structure
 Score = 89.6 bits (221), Expect = 7e-23
 Identities = 25/70 (35%), Positives = 35/70 (50%)

Query: 19  RYIKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELK 78
            Y+K+    + +  + T     SL CP+   RM +P+K+  C HLQCFD   F+      
Sbjct: 227 LYLKKTLREDEEMGLTTTSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQI 286

Query: 79  PKWNCPVCDK 88
           P W CPVC  
Sbjct: 287 PTWQCPVCQI 296
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Length = 360 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 100.0
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 99.98
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.46
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.51
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.48
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.44
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.26
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.2
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.11
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.85
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.82
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.68
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.55
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.5
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.47
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.45
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.34
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.34
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.25
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.21
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.18
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.17
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.16
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.14
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 96.97
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.96
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 96.92
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 96.71
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.7
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 96.53
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 96.47
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 96.4
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 96.22
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 96.21
2ysj_A63 Tripartite motif-containing protein 31; ring-type 96.21
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.17
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 95.81
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 95.7
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 95.65
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 95.22
2ect_A78 Ring finger protein 126; metal binding protein, st 95.13
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 95.08
2ecm_A55 Ring finger and CHY zinc finger domain- containing 95.01
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 94.98
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 94.63
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 94.45
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 94.17
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 93.75
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 93.73
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 92.82
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 91.99
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 91.95
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 91.29
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 91.16
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 90.5
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 90.37
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 90.04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 89.14
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 87.69
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 86.55
2yrc_A59 Protein transport protein SEC23A; zinc binding, co 85.86
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 84.35
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 84.18
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 84.16
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 83.24
2k5c_A95 Uncharacterized protein PF0385; structural genomic 82.62
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
Probab=100.00  E-value=8.5e-34  Score=228.15  Aligned_cols=103  Identities=47%  Similarity=0.775  Sum_probs=90.1

Q ss_pred             hHHHHhccCCChHHHH-HHHHHhccCCCCceeeeeeeeeecCCCccccccccccccccCccceecHHHHHHHhcCCCcee
Q psy8140           4 IVSLIAHLMRDIAFSR-YIKEKYNSENDSEIKTLELTSSLICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWN   82 (108)
Q Consensus         4 l~~l~~~~~~~~~~~~-~i~~~~~~~~Dddi~~~~~~vsL~CPlS~~ri~~P~Rg~~C~H~qCFDl~~fl~~~~~~~~W~   82 (108)
                      |++|++++.++++.++ .|++++..++|+||++++..|||+||||++||++|+||..|.|+||||+++||+|+++.++|+
T Consensus       177 lq~l~~k~~~~~e~t~~~Ik~~l~~d~DddI~~~~~~vSL~CPlS~~ri~~P~Rg~~C~HlqCFDl~sfL~~~~~~~~W~  256 (360)
T 4fo9_A          177 LQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTHLQCFDAALYLQMNEKKPTWI  256 (360)
T ss_dssp             HHHHHTC-CBCHHHHHHHHHHHHC---------CCEEEESBCTTTCSBCSSEEEETTCCCCCCEEHHHHHHHHHHSCCCB
T ss_pred             HHHHHhcCCCCHHHHHHHHHHHhccCCccceeeeeeEEeeeCCCccceeccCCcCCCCCCCccCCHHHHHHHHhhCCCeE
Confidence            6889999999999998 999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCcccCCCeeehhhhhhhhh
Q psy8140          83 CPVCDKVGHLILLCMAMIESVCLF  106 (108)
Q Consensus        83 CPiC~~~~~~~dL~iD~~~~~~l~  106 (108)
                      ||+|++.+.+++|+||+|+++||-
T Consensus       257 CPiC~k~~~~~dL~ID~~~~~IL~  280 (360)
T 4fo9_A          257 CPVCDKKAAYESLILDGLFMEILN  280 (360)
T ss_dssp             CTTTCSBCCGGGEEEBHHHHHHHT
T ss_pred             CCCCCcccCHHHeEEcHHHHHHHH
Confidence            999999999999999999999984
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yrc_A Protein transport protein SEC23A; zinc binding, copii, coat protein complex-II, endoplasmic reticulum, golgi, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yrd_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.75
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.38
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.18
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.05
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.94
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 97.93
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.46
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.11
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 96.92
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 96.22
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 95.45
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 94.66
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 93.54
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 93.15
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 89.17
d1pd0a585 Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T 88.96
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 86.33
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 86.16
d2qtva575 Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T 86.02
d2j9ub147 Vacuolar protein-sorting-associated protein 36, VP 84.09
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 83.78
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 82.21
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: Pre-mRNA splicing factor Prp19
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=98.75  E-value=1.4e-09  Score=64.28  Aligned_cols=51  Identities=10%  Similarity=0.178  Sum_probs=45.4

Q ss_pred             ecCCCccccccccccccccCccceecHHHHHHHhcCCCceecccCCCcccCCCee
Q psy8140          42 LICPLGKMRMAFPTKASTCAHLQCFDGATFIKMNELKPKWNCPVCDKVGHLILLC   96 (108)
Q Consensus        42 L~CPlS~~ri~~P~Rg~~C~H~qCFDl~~fl~~~~~~~~W~CPiC~~~~~~~dL~   96 (108)
                      |.|||++..|+.|+....|.|.  |+.+.+.++-+++  .+||+|++++..+||+
T Consensus         1 l~C~Ic~~~~~~Pv~~~~cGh~--fc~~cI~~~l~~~--~~CP~c~~~l~~~dLi   51 (56)
T d2baya1           1 MLCAISGKVPRRPVLSPKSRTI--FEKSLLEQYVKDT--GNDPITNEPLSIEEIV   51 (56)
T ss_dssp             CCCTTTCSCCSSEEEETTTTEE--EEHHHHHHHHHHH--SBCTTTCCBCCGGGCE
T ss_pred             CCCccCCchHHhcCccCCCCCc--ccHHHHHHHHhhc--cCCCccCCcCCHHhce
Confidence            6899999999999999999999  9999988876653  4799999999998885
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pd0a5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtva5 g.41.10.1 (A:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j9ub1 g.41.11.1 (B:115-161) Vacuolar protein-sorting-associated protein 36, VPS36 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure