Psyllid ID: psy8152


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----
MTLADDYNIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKIKIYDTDFKNFNTNTDVSFGEGDIVGVSRYDECILTAVKSGDVKLWRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKNIFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVHDFHSKKLLRKDYMQSRLTSILVRSDFSLENETKKEEQEHSEEKGDSDEKYDPEHFEMNQVTRENYAESKTNKNTSDYDDESDIEIVDEIDNDEDKQDESEEDGEEEGEEEASENEYYTETDEDEKENEEDDGESDGGRRRGS
ccccccccEEEEcccccEEEEEEcccccEEEcEEEEccccccccEEEEEEEcccccEEEEEEcccEEEEEEcccccEEEEEEEccccEEEEEEEEcccEEEEEEcccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEccccEEEEEEEccccccccccEEEEEEEEcccccEEEEEEccccEEEEEcccccccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEccccccccEEEccccccEEEEEEcccccEEEEEEcccEEEEEEcccccEEEEEEEccEEEEEEEcccccccccccHHHHccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccEEEEEcccccEEEEcccccccccHHHHccccccccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEEccccccccEEEcccccccEEEEEEEEEEEcccccEEEEEccccEEEEEEccccccEEEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEEEcccEEEEEEccccccccccccccccccccccccccccHHHHHHccEEEEccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccc
mtladdyniyigsstgafkgvnlskdkciIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGqkikiydtdfknfntntdvsfgegdivgvsryDECILTAVKSGDVKlwryktepdqwtnfnvgpqlecmkhnkhsniiatggkendlklwdlnttknifsaknVSHRVLVysvkpdefdlrrpvwvngisflpnsdkvavcskqgyvrvydpkittqrrpvlkvdipdvalscitttnqshyvIVGSTTGDMMAvdlrgkgkpcykykgfagcvkdiacplnenlilsvsldrhfrvhdfhskkLLRKDYMQSRLTSILvrsdfslenetkkeeqehseekgdsdekydpehfemNQVTRENYAEsktnkntsdyddesdieivdeidndedkqdeseedgeeegeeeaseneyytetdedekeneeddgesdggrrrgs
mtladdyniyigsstgafkgvnlSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKIKIYDTDFKNFNTNTDVSFGEGDIVGVSRYDECILTAvksgdvklwRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKnifsaknvshrVLVYSvkpdefdlrrpvwvngisflpnsdkvavcskqgyvrvydpkittqrrpvlkvdIPDVALScitttnqshyvIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVHDFhskkllrkdymQSRLTsilvrsdfslenetkkeeqehseekgdsdekydpEHFEMNQvtrenyaesktnkntsdyddesdieivdeidndedkqdeseedgeeegeeeaseneyytetdedekeneeddgesdggrrrgs
MTLADDYNIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKIKIYDTDFKNFNTNTDVSFGEGDIVGVSRYDECILTAVKSGDVKLWRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKNIFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVHDFHSKKLLRKDYMQSRLTSILVRSDFSLenetkkeeqehseekGDSDEKYDPEHFEMNQVTRENYAESKTNKNTSdyddesdieivdeidndedkqdeseedgeeegeeeaseneyytetdedekeneeddgesdgGRRRGS
*****DYNIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKIKIYDTDFKNFNTNTDVSFGEGDIVGVSRYDECILTAVKSGDVKLWRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKNIFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVHDFHSKKLLRKDYMQSRLTSILVR***********************************************************************************************************************
****DDYNIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKIKIYDTDFKNFNTNTDVSFGEGDIVGVSRYDECILTAVKSGDVKLWRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKNIFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVHDFHSKKLLRKDYMQSRLTSILVRS**********************************************************************************************************************
MTLADDYNIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKIKIYDTDFKNFNTNTDVSFGEGDIVGVSRYDECILTAVKSGDVKLWRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKNIFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVHDFHSKKLLRKDYMQSRLTSILVRSDFSL*********************YDPEHFEMNQVTRENYAESKTNKNTSDYDDESDIEIVDEIDN***************************************************
***ADDYNIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKIKIYDTDFKNFNTNTDVSFGEGDIVGVSRYDECILTAVKSGDVKLWRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKNIFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVHDFHSKKLLRKDYMQSRLTSILVRSDFSL**********************DPE****NQVTREN*************DDESDIEIVDE******************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLADDYNIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKIKIYDTDFKNFNTNTDVSFGEGDIVGVSRYDECILTAVKSGDVKLWRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKNIFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVHDFHSKKLLRKDYMQSRLTSILVRSDFSLENETKKEEQEHSEEKGDSDEKYDPEHFEMNQVTRENYAESKTNKNTSDYDDESDIEIVDEIDNDEDKQDESEEDGEEEGEEEASENEYYTETDEDEKENEEDDGESDGGRRRGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query444 2.2.26 [Sep-21-2011]
Q6RFH5385 WD repeat-containing prot yes N/A 0.718 0.828 0.334 6e-47
Q58D06385 WD repeat-containing prot yes N/A 0.747 0.862 0.331 3e-46
Q8VCG3384 WD repeat-containing prot yes N/A 0.747 0.864 0.311 2e-44
Q54FW9508 WD repeat-containing prot yes N/A 0.466 0.407 0.311 3e-19
A5DKC4398 Ribosome biogenesis prote N/A N/A 0.391 0.437 0.259 1e-11
Q6CEC9410 Ribosome biogenesis prote yes N/A 0.461 0.5 0.265 3e-10
A5DX41447 Ribosome biogenesis prote N/A N/A 0.396 0.393 0.252 6e-10
O94698387 Ribosome biogenesis prote yes N/A 0.432 0.496 0.277 6e-09
Q5A2T0406 Ribosome biogenesis prote N/A N/A 0.430 0.470 0.246 7e-09
Q6BUJ2430 Ribosome biogenesis prote yes N/A 0.434 0.448 0.244 1e-08
>sp|Q6RFH5|WDR74_HUMAN WD repeat-containing protein 74 OS=Homo sapiens GN=WDR74 PE=1 SV=1 Back     alignment and function desciption
 Score =  188 bits (478), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 113/338 (33%), Positives = 183/338 (54%), Gaps = 19/338 (5%)

Query: 8   NIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKI 67
           ++++G+ TG  KGVNL + +    N         + +V AL WG   E+++L+  + + +
Sbjct: 10  HVWVGTETGILKGVNLQRKQA--ANFTAGGQPRREEAVSALCWGTGGETQMLVGCADRTV 67

Query: 68  KIYDTDFKNFNTNTDVSFGEGDIVGVSRYDECILTAVKSGDVKLWRYK---TEPDQWTNF 124
           K + T+   F        GEG   G+++ D  ++T V SG +++W  K   T  D     
Sbjct: 68  KHFSTEDGIFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLEL 127

Query: 125 NVGPQLECMKHNK-HSNIIATGGKENDLKLWDLNTTKN-IFSAKNVSHRVLVYSVKPDEF 182
            VGP +  M+ +  H +++ATGGKEN LK+WDL  ++  +F AKNV +         D  
Sbjct: 128 RVGPGVCRMRQDPAHPHVVATGGKENALKIWDLQGSEEPVFRAKNVRN---------DWL 178

Query: 183 DLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTTN 242
           DLR P+W   I FLP S K+  C+    VRVYDP  + QRRPVL+    +  L+ +T T 
Sbjct: 179 DLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPA-SPQRRPVLETTYGEYPLTAMTLTP 237

Query: 243 QSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVH 302
             + VIVG+T G +  +DLR +G+     KG AG V+ + C  ++ L+ S  LDR  R+H
Sbjct: 238 GGNSVIVGNTHGQLAEIDLR-QGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIH 296

Query: 303 DFHSKKLL-RKDYMQSRLTSILVRSDFSLENETKKEEQ 339
              + + L  K Y++S+L  +L+    + E+E ++ ++
Sbjct: 297 RIQNPRGLEHKVYLKSQLNCLLLSGRDNWEDEPQEPQE 334





Homo sapiens (taxid: 9606)
>sp|Q58D06|WDR74_BOVIN WD repeat-containing protein 74 OS=Bos taurus GN=WDR74 PE=2 SV=1 Back     alignment and function description
>sp|Q8VCG3|WDR74_MOUSE WD repeat-containing protein 74 OS=Mus musculus GN=Wdr74 PE=2 SV=1 Back     alignment and function description
>sp|Q54FW9|Y0555_DICDI WD repeat-containing protein DDB_G0290555 OS=Dictyostelium discoideum GN=DDB_G0290555 PE=4 SV=1 Back     alignment and function description
>sp|A5DKC4|NSA1_PICGU Ribosome biogenesis protein NSA1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NSA1 PE=3 SV=2 Back     alignment and function description
>sp|Q6CEC9|NSA1_YARLI Ribosome biogenesis protein NSA1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NSA1 PE=3 SV=1 Back     alignment and function description
>sp|A5DX41|NSA1_LODEL Ribosome biogenesis protein NSA1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NSA1 PE=3 SV=1 Back     alignment and function description
>sp|O94698|NSA1_SCHPO Ribosome biogenesis protein nsa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nsa1 PE=3 SV=1 Back     alignment and function description
>sp|Q5A2T0|NSA1_CANAL Ribosome biogenesis protein NSA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NSA1 PE=3 SV=1 Back     alignment and function description
>sp|Q6BUJ2|NSA1_DEBHA Ribosome biogenesis protein NSA1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NSA1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
383862357428 PREDICTED: WD repeat-containing protein 0.765 0.794 0.416 1e-75
350400052422 PREDICTED: WD repeat-containing protein 0.898 0.945 0.377 8e-73
328792013400 PREDICTED: WD repeat-containing protein 0.837 0.93 0.395 9e-72
340727922423 PREDICTED: LOW QUALITY PROTEIN: WD repea 0.898 0.943 0.375 1e-71
321477061384 hypothetical protein DAPPUDRAFT_311532 [ 0.718 0.830 0.410 4e-71
380017075424 PREDICTED: LOW QUALITY PROTEIN: WD repea 0.833 0.872 0.388 3e-70
307211275414 WD repeat-containing protein 74 [Harpegn 0.754 0.809 0.384 1e-65
242019376354 WD-repeat protein, putative [Pediculus h 0.770 0.966 0.365 3e-61
345479871306 PREDICTED: WD repeat-containing protein 0.680 0.986 0.398 1e-58
291224117366 PREDICTED: MGC89952 protein-like [Saccog 0.736 0.893 0.390 1e-58
>gi|383862357|ref|XP_003706650.1| PREDICTED: WD repeat-containing protein 74-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  290 bits (742), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 155/372 (41%), Positives = 226/372 (60%), Gaps = 32/372 (8%)

Query: 1   MTLADDYNIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLI 60
           M + D+++IY+G  +G FKGV + + + +++NIQN+  IT+   +  ++WG+ EE E+LI
Sbjct: 1   MDVKDNFDIYVGGKSGVFKGVKIGQQENVMQNIQNLVSITDHDEITTMSWGDTEEKEVLI 60

Query: 61  AYSG---QKIKIYDTDFKNFNTNTDVSFGEGDIVGVSRYDECILTAVKSGDVKLWRYKTE 117
           A      + IK+YDT+   F  +   + G G I G+SRYD  ILTAVKSG++KLWR+K E
Sbjct: 61  ACGVKGIRSIKVYDTECSTFTCSFFCNIGTGKINGISRYDGAILTAVKSGEIKLWRFKEE 120

Query: 118 PDQWTNFNVGPQLECMKHNK-HSNIIATGGKENDLKLWDLNTTKNIFSAKNVSHRVLVYS 176
            +       G  L  M+H+K + NIIATGG E++LKL+DL   K IF  KN+ H      
Sbjct: 121 DE--IIIKAGENLNRMRHSKINKNIIATGGYEHNLKLFDLEKQKQIFIEKNMPH------ 172

Query: 177 VKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALS 236
              D   LR P+W++ I FLP ++++    + G+VR+YDP++  QRRPV+ +++ D AL+
Sbjct: 173 ---DWLQLRVPIWISDIEFLPGTEQIVTVGRFGHVRLYDPRV--QRRPVINLEMKDEALT 227

Query: 237 CITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLD 296
            ++T  +   VIVGS  G M  VDLR   K    YKGF G V  IAC  NE  ++SVSLD
Sbjct: 228 TLSTMPREKQVIVGSGKGSMNLVDLRKPAKALNTYKGFVGSVTGIACSTNEPYVVSVSLD 287

Query: 297 RHFRVHDFHSKKLLRKDYMQSRLTSILVRSDFSLENETK---------------KEEQEH 341
           R+ R+H   +KKLL+K Y+ SR++ +L+RS FSL  E                 KEEQE+
Sbjct: 288 RYLRIHHIDTKKLLKKVYLTSRMSCMLLRSGFSLPTEKTNEESIRKRTDIDERFKEEQEN 347

Query: 342 SEEKGDSDEKYD 353
            +   D+D +YD
Sbjct: 348 IQRDSDTDSEYD 359




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350400052|ref|XP_003485722.1| PREDICTED: WD repeat-containing protein 74-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328792013|ref|XP_001120550.2| PREDICTED: WD repeat-containing protein 74 [Apis mellifera] Back     alignment and taxonomy information
>gi|340727922|ref|XP_003402282.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 74-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|321477061|gb|EFX88020.1| hypothetical protein DAPPUDRAFT_311532 [Daphnia pulex] Back     alignment and taxonomy information
>gi|380017075|ref|XP_003692491.1| PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 74-like, partial [Apis florea] Back     alignment and taxonomy information
>gi|307211275|gb|EFN87461.1| WD repeat-containing protein 74 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242019376|ref|XP_002430137.1| WD-repeat protein, putative [Pediculus humanus corporis] gi|212515228|gb|EEB17399.1| WD-repeat protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345479871|ref|XP_003424046.1| PREDICTED: WD repeat-containing protein 74-like, partial [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|291224117|ref|XP_002732053.1| PREDICTED: MGC89952 protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query444
ZFIN|ZDB-GENE-060929-1138375 wdr74 "WD repeat domain 74" [D 0.682 0.808 0.365 5.4e-47
UNIPROTKB|E2R2B7383 WDR74 "Uncharacterized protein 0.684 0.793 0.343 1.3e-43
UNIPROTKB|I3LD53385 WDR74 "Uncharacterized protein 0.684 0.789 0.337 2.2e-43
UNIPROTKB|Q6RFH5385 WDR74 "WD repeat-containing pr 0.684 0.789 0.343 1.2e-42
WB|WBGene00011538431 T06E6.1 [Caenorhabditis elegan 0.686 0.707 0.312 2.5e-42
UNIPROTKB|Q58D06385 WDR74 "WD repeat-containing pr 0.684 0.789 0.343 5.2e-42
MGI|MGI:2147427384 Wdr74 "WD repeat domain 74" [M 0.684 0.791 0.321 3.3e-40
RGD|1582881366 Wdr74 "WD repeat domain 74" [R 0.666 0.808 0.322 2.1e-38
FB|FBgn0033059419 CG7845 [Drosophila melanogaste 0.691 0.732 0.300 4.3e-38
UNIPROTKB|E9PS41328 WDR74 "WD repeat-containing pr 0.576 0.780 0.351 4.4e-36
ZFIN|ZDB-GENE-060929-1138 wdr74 "WD repeat domain 74" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 492 (178.3 bits), Expect = 5.4e-47, P = 5.4e-47
 Identities = 118/323 (36%), Positives = 177/323 (54%)

Query:     8 NIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKI 67
             +I++GS TG  KGV+L K +    N   +  ++    V  + WG+  ESELL+      +
Sbjct:     9 SIWLGSETGILKGVSLRKKQAF--NFCEMSCLSRDQEVCVMAWGDPYESELLLGSVNGTV 66

Query:    68 KIYDTDFKNFNTNTDVSF-GEGDIVGVSRYDECILTAVKSGDVKLWRYKTEPDQWTNFNV 126
             K + TD   F    +     +G   G++  D  ++T V+SG +K+W+ +   D     NV
Sbjct:    67 KTFSTDKGIFTATKECGDPSQGKFTGLAVTDSSMITCVESGLLKVWK-EGSTDT-VEVNV 124

Query:   127 GPQLECMKHNKHS-NIIATGGKENDLKLWDLNTT-KNIFSAKNVSHRVLVYSVKPDEFDL 184
             G  +  M+ N+   + +ATGGKEN LK+WDL    K IF+AKNV+H         D  ++
Sbjct:   125 GKDICKMRQNQSQRHHVATGGKENPLKVWDLEKPDKPIFTAKNVAH---------DWLEM 175

Query:   185 RRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTTNQS 244
             R PVWV  ISF+ +SDK+  C+    VRVYDP  T QRRPVL+ D  +  L+ ++     
Sbjct:   176 RVPVWVRDISFIADSDKIVTCTGHHKVRVYDPS-TPQRRPVLEADFGEYPLTALSLPASQ 234

Query:   245 HYVIVGSTTGDMMAVDLR-GKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVHD 303
               V+VG+T G++  +DLR G  + C+K  G AG V+ + C  +  L+ S  LDR  RVH 
Sbjct:   235 DAVVVGNTHGELAILDLRKGLVRGCFK--GLAGAVRGLQCHPSLPLVASCGLDRFLRVHS 292

Query:   304 FHSKKLLRKDYMQSRLTSILVRS 326
                + L  K Y++SRL  +L+ S
Sbjct:   293 LEDRSLQHKVYLKSRLNCVLLSS 315




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|E2R2B7 WDR74 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LD53 WDR74 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6RFH5 WDR74 "WD repeat-containing protein 74" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00011538 T06E6.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q58D06 WDR74 "WD repeat-containing protein 74" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2147427 Wdr74 "WD repeat domain 74" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1582881 Wdr74 "WD repeat domain 74" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0033059 CG7845 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E9PS41 WDR74 "WD repeat-containing protein 74" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6RFH5WDR74_HUMANNo assigned EC number0.33430.71840.8285yesN/A
Q58D06WDR74_BOVINNo assigned EC number0.33140.74770.8623yesN/A
Q8VCG3WDR74_MOUSENo assigned EC number0.31160.74770.8645yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query444
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-12
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-06
COG4547 620 COG4547, CobT, Cobalamin biosynthesis protein CobT 4e-06
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-05
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-05
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-05
pfam04147 809 pfam04147, Nop14, Nop14-like family 2e-05
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 4e-05
pfam04147 809 pfam04147, Nop14, Nop14-like family 4e-05
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 1e-04
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 1e-04
PTZ00415 2849 PTZ00415, PTZ00415, transmission-blocking target a 3e-04
pfam02724 583 pfam02724, CDC45, CDC45-like protein 3e-04
pfam03344 715 pfam03344, Daxx, Daxx Family 4e-04
PHA00435 306 PHA00435, PHA00435, capsid assembly protein 5e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 6e-04
pfam07423214 pfam07423, DUF1510, Protein of unknown function (D 7e-04
TIGR01651 600 TIGR01651, CobT, cobaltochelatase, CobT subunit 7e-04
pfam04147 809 pfam04147, Nop14, Nop14-like family 8e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.001
pfam03344 715 pfam03344, Daxx, Daxx Family 0.001
TIGR01651 600 TIGR01651, CobT, cobaltochelatase, CobT subunit 0.001
pfam05793 528 pfam05793, TFIIF_alpha, Transcription initiation f 0.001
COG5137279 COG5137, COG5137, Histone chaperone involved in ge 0.001
pfam08553 794 pfam08553, VID27, VID27 cytoplasmic protein 0.001
PRK14891131 PRK14891, PRK14891, 50S ribosomal protein L24e/unk 0.001
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 0.002
pfam06213282 pfam06213, CobT, Cobalamin biosynthesis protein Co 0.002
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 0.003
PHA02664534 PHA02664, PHA02664, hypothetical protein; Provisio 0.003
PTZ00007337 PTZ00007, PTZ00007, (NAP-L) nucleosome assembly pr 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 67.7 bits (166), Expect = 1e-12
 Identities = 49/277 (17%), Positives = 105/277 (37%), Gaps = 35/277 (12%)

Query: 42  KASVLALNWGNVEESELLIAYSGQK-IKIYDTDFKNFNTNTDVSFGEGDIVGV-----SR 95
              V  + +    + +LL   SG   IK++D +     T   +   +G    V     S 
Sbjct: 9   TGGVTCVAF--SPDGKLLATGSGDGTIKVWDLE-----TGELLRTLKGHTGPVRDVAASA 61

Query: 96  YDECILTAVKSGDVKLWRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWD 155
               + +      ++LW  +T     T       +  +  +    I+++  ++  +K+WD
Sbjct: 62  DGTYLASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWD 121

Query: 156 LNTTKNIFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYD 215
           + T K + + +  +                   WVN ++F P+   VA  S+ G ++++D
Sbjct: 122 VETGKCLTTLRGHTD------------------WVNSVAFSPDGTFVASSSQDGTIKLWD 163

Query: 216 PKITTQRRPVLKVDIPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFA 275
            +     + V  +      ++ +  +     ++  S+ G +   DL   GK     +G  
Sbjct: 164 LR---TGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLS-TGKCLGTLRGHE 219

Query: 276 GCVKDIACPLNENLILSVSLDRHFRVHDFHSKKLLRK 312
             V  +A   +  L+ S S D   RV D  + + ++ 
Sbjct: 220 NGVNSVAFSPDGYLLASGSEDGTIRVWDLRTGECVQT 256


Length = 289

>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|226920 COG4547, CobT, Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|185603 PTZ00415, PTZ00415, transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|222792 PHA00435, PHA00435, capsid assembly protein Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|219408 pfam07423, DUF1510, Protein of unknown function (DUF1510) Back     alignment and domain information
>gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|217503 pfam03344, Daxx, Daxx Family Back     alignment and domain information
>gnl|CDD|130712 TIGR01651, CobT, cobaltochelatase, CobT subunit Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information
>gnl|CDD|227466 COG5137, COG5137, Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein Back     alignment and domain information
>gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|148051 pfam06213, CobT, Cobalamin biosynthesis protein CobT Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|177447 PHA02664, PHA02664, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|240226 PTZ00007, PTZ00007, (NAP-L) nucleosome assembly protein -L; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 444
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0272|consensus459 100.0
KOG0286|consensus343 100.0
KOG0279|consensus315 100.0
KOG0315|consensus311 100.0
KOG0286|consensus343 100.0
KOG0295|consensus406 100.0
KOG0315|consensus311 100.0
KOG0318|consensus603 100.0
KOG0279|consensus315 100.0
KOG0273|consensus524 100.0
KOG0319|consensus 775 100.0
KOG0285|consensus460 100.0
KOG0284|consensus464 100.0
KOG0295|consensus406 100.0
KOG0263|consensus707 100.0
KOG0265|consensus338 100.0
KOG0284|consensus464 100.0
KOG0273|consensus524 100.0
KOG0265|consensus338 100.0
KOG0296|consensus399 100.0
KOG0319|consensus775 100.0
KOG0281|consensus499 100.0
KOG0291|consensus 893 100.0
KOG0645|consensus312 100.0
KOG0263|consensus707 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0281|consensus499 100.0
KOG0276|consensus 794 100.0
KOG0291|consensus 893 100.0
KOG0316|consensus307 100.0
KOG0282|consensus503 100.0
KOG0318|consensus603 100.0
KOG0306|consensus 888 100.0
KOG0266|consensus456 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0282|consensus503 100.0
KOG0313|consensus423 100.0
KOG0285|consensus460 100.0
KOG0293|consensus519 100.0
KOG0266|consensus456 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0645|consensus312 100.0
KOG0292|consensus 1202 100.0
KOG0296|consensus399 100.0
KOG0293|consensus519 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0275|consensus508 100.0
KOG1407|consensus313 100.0
KOG0313|consensus423 100.0
KOG1446|consensus311 100.0
KOG1407|consensus313 100.0
KOG0274|consensus537 100.0
KOG0275|consensus508 100.0
KOG0277|consensus311 100.0
KOG0276|consensus 794 100.0
KOG0277|consensus311 100.0
KOG0278|consensus334 100.0
KOG0294|consensus362 100.0
KOG0278|consensus334 100.0
KOG0316|consensus307 100.0
KOG0772|consensus641 100.0
KOG0306|consensus888 100.0
KOG0305|consensus484 100.0
KOG0310|consensus487 100.0
KOG0268|consensus433 100.0
KOG0283|consensus712 100.0
KOG0292|consensus 1202 100.0
KOG0274|consensus537 100.0
KOG0288|consensus459 100.0
KOG0643|consensus327 100.0
KOG0643|consensus327 100.0
KOG0310|consensus487 100.0
PTZ00421493 coronin; Provisional 100.0
KOG0288|consensus459 100.0
KOG0308|consensus 735 100.0
KOG1539|consensus 910 100.0
KOG0640|consensus430 100.0
KOG0289|consensus506 100.0
KOG0294|consensus362 100.0
KOG0268|consensus433 100.0
KOG0299|consensus479 99.98
KOG0308|consensus 735 99.98
KOG0305|consensus484 99.98
KOG0289|consensus506 99.98
KOG1274|consensus 933 99.98
KOG0264|consensus422 99.97
KOG0647|consensus347 99.97
KOG0641|consensus350 99.97
PTZ00421493 coronin; Provisional 99.97
KOG0641|consensus350 99.97
KOG0300|consensus481 99.97
KOG1446|consensus311 99.97
KOG0973|consensus 942 99.97
KOG0772|consensus641 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG1036|consensus323 99.97
KOG1408|consensus 1080 99.97
KOG0301|consensus 745 99.97
KOG0640|consensus430 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG0647|consensus347 99.97
KOG0973|consensus 942 99.97
KOG0639|consensus705 99.97
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.97
KOG1036|consensus323 99.97
KOG0646|consensus476 99.97
KOG0299|consensus479 99.97
KOG0301|consensus 745 99.96
KOG0639|consensus705 99.96
KOG0300|consensus481 99.96
KOG0283|consensus712 99.96
KOG2055|consensus514 99.96
KOG1332|consensus299 99.96
KOG2055|consensus514 99.96
KOG1408|consensus 1080 99.96
KOG1063|consensus764 99.96
KOG1332|consensus299 99.96
KOG1273|consensus405 99.96
KOG4283|consensus397 99.96
KOG0264|consensus422 99.96
KOG1539|consensus 910 99.96
KOG2106|consensus626 99.96
KOG4283|consensus397 99.96
KOG0269|consensus 839 99.96
KOG0269|consensus 839 99.96
KOG2096|consensus420 99.96
KOG2445|consensus361 99.95
KOG0321|consensus 720 99.95
KOG0646|consensus476 99.95
KOG1274|consensus 933 99.95
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.95
KOG0270|consensus463 99.95
KOG2048|consensus 691 99.95
KOG3881|consensus412 99.95
KOG4378|consensus 673 99.95
KOG0267|consensus 825 99.95
KOG0267|consensus 825 99.95
KOG4328|consensus498 99.94
KOG2106|consensus626 99.94
KOG1273|consensus405 99.94
KOG0321|consensus 720 99.94
KOG1063|consensus764 99.94
KOG2096|consensus420 99.94
KOG2919|consensus406 99.94
KOG0650|consensus733 99.94
KOG0302|consensus440 99.94
KOG1445|consensus 1012 99.94
KOG0270|consensus463 99.93
KOG2048|consensus 691 99.93
KOG0650|consensus733 99.93
KOG4328|consensus498 99.93
KOG2445|consensus361 99.93
KOG0302|consensus440 99.93
KOG2919|consensus406 99.92
KOG0307|consensus 1049 99.92
KOG4378|consensus 673 99.91
KOG1009|consensus434 99.91
KOG1188|consensus376 99.91
KOG0307|consensus 1049 99.91
KOG1034|consensus385 99.9
KOG1034|consensus385 99.9
KOG1007|consensus370 99.9
KOG1334|consensus559 99.89
KOG0290|consensus364 99.89
PRK11028330 6-phosphogluconolactonase; Provisional 99.89
KOG1538|consensus 1081 99.89
KOG0290|consensus364 99.88
COG2319466 FOG: WD40 repeat [General function prediction only 99.88
KOG0642|consensus577 99.88
KOG4227|consensus609 99.87
COG2319466 FOG: WD40 repeat [General function prediction only 99.87
KOG1587|consensus555 99.87
KOG1538|consensus 1081 99.87
KOG4227|consensus 609 99.86
KOG0322|consensus323 99.86
KOG1517|consensus1387 99.86
KOG1009|consensus434 99.86
KOG0649|consensus325 99.86
KOG1188|consensus376 99.85
KOG0303|consensus472 99.85
KOG2110|consensus391 99.85
KOG0322|consensus323 99.84
KOG1517|consensus1387 99.84
KOG0644|consensus 1113 99.84
KOG1963|consensus 792 99.84
KOG1587|consensus555 99.84
KOG2110|consensus391 99.83
KOG1007|consensus370 99.83
KOG0771|consensus398 99.83
KOG1240|consensus1431 99.83
KOG1334|consensus559 99.83
KOG1963|consensus 792 99.82
KOG0303|consensus472 99.82
KOG0642|consensus577 99.82
KOG0649|consensus325 99.81
PRK11028330 6-phosphogluconolactonase; Provisional 99.81
KOG1524|consensus 737 99.81
KOG1524|consensus 737 99.81
KOG1832|consensus1516 99.8
KOG1272|consensus545 99.79
KOG4497|consensus447 99.79
PRK01742429 tolB translocation protein TolB; Provisional 99.79
KOG1523|consensus361 99.78
KOG2394|consensus636 99.78
KOG1523|consensus361 99.78
KOG1240|consensus1431 99.78
KOG1445|consensus1012 99.78
KOG2394|consensus636 99.78
KOG0771|consensus398 99.78
KOG2111|consensus346 99.77
PRK01742429 tolB translocation protein TolB; Provisional 99.77
KOG4497|consensus447 99.76
KOG1272|consensus545 99.75
KOG2321|consensus 703 99.75
PRK03629429 tolB translocation protein TolB; Provisional 99.74
KOG3881|consensus412 99.73
KOG2111|consensus346 99.73
KOG2139|consensus445 99.73
KOG0644|consensus 1113 99.72
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.72
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.71
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.71
KOG2139|consensus445 99.71
PRK03629429 tolB translocation protein TolB; Provisional 99.7
KOG1310|consensus 758 99.69
PRK04922433 tolB translocation protein TolB; Provisional 99.68
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.67
KOG1310|consensus 758 99.66
KOG2321|consensus 703 99.66
PRK05137435 tolB translocation protein TolB; Provisional 99.66
PRK04922433 tolB translocation protein TolB; Provisional 99.65
PRK05137435 tolB translocation protein TolB; Provisional 99.65
PRK02889427 tolB translocation protein TolB; Provisional 99.65
KOG2315|consensus566 99.65
PRK02889427 tolB translocation protein TolB; Provisional 99.64
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.63
KOG0974|consensus 967 99.63
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.61
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.6
KOG1354|consensus433 99.59
KOG1409|consensus404 99.58
KOG2315|consensus566 99.57
KOG1354|consensus433 99.57
KOG1832|consensus1516 99.55
PRK01029428 tolB translocation protein TolB; Provisional 99.55
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.55
KOG0974|consensus 967 99.54
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.54
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.54
PRK00178430 tolB translocation protein TolB; Provisional 99.54
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.53
KOG4547|consensus 541 99.53
KOG2041|consensus 1189 99.53
KOG0280|consensus339 99.52
PRK04792448 tolB translocation protein TolB; Provisional 99.51
KOG4547|consensus541 99.5
KOG0280|consensus339 99.49
KOG1064|consensus2439 99.49
PRK00178430 tolB translocation protein TolB; Provisional 99.49
PRK01029428 tolB translocation protein TolB; Provisional 99.46
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.46
KOG1409|consensus404 99.46
PRK04792448 tolB translocation protein TolB; Provisional 99.45
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.45
KOG2314|consensus698 99.43
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.43
KOG1064|consensus2439 99.39
COG4946668 Uncharacterized protein related to the periplasmic 99.35
KOG4532|consensus344 99.34
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.32
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.31
KOG0309|consensus 1081 99.31
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.31
KOG2041|consensus 1189 99.31
KOG4532|consensus344 99.28
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.27
KOG4190|consensus1034 99.27
KOG0309|consensus 1081 99.26
KOG3914|consensus390 99.26
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.24
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.24
KOG4190|consensus1034 99.24
KOG1912|consensus 1062 99.24
KOG2314|consensus698 99.24
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.23
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.23
COG4946668 Uncharacterized protein related to the periplasmic 99.23
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.2
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.19
KOG4714|consensus319 99.17
KOG0882|consensus558 99.16
KOG2695|consensus425 99.14
PRK04043419 tolB translocation protein TolB; Provisional 99.13
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.12
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.11
KOG0882|consensus 558 99.11
KOG2695|consensus425 99.11
KOG3914|consensus390 99.1
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.09
KOG1912|consensus 1062 99.09
KOG4649|consensus354 99.09
PRK04043419 tolB translocation protein TolB; Provisional 99.07
KOG1275|consensus 1118 99.06
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.05
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 99.02
KOG4714|consensus319 99.0
KOG1275|consensus 1118 98.98
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.98
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.97
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.95
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.93
KOG4649|consensus354 98.9
KOG2066|consensus 846 98.86
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.86
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.85
KOG2114|consensus 933 98.84
PRK02888635 nitrous-oxide reductase; Validated 98.83
KOG2066|consensus 846 98.82
KOG2114|consensus 933 98.79
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.78
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.74
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.73
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.68
KOG1645|consensus463 98.66
KOG1920|consensus 1265 98.65
KOG1645|consensus463 98.65
KOG3617|consensus 1416 98.65
KOG1920|consensus 1265 98.62
KOG3621|consensus 726 98.6
PRK02888635 nitrous-oxide reductase; Validated 98.59
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.58
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.56
KOG1008|consensus 783 98.54
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.51
KOG3617|consensus 1416 98.46
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.45
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.4
KOG3621|consensus 726 98.38
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.38
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.31
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.29
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.28
COG3391381 Uncharacterized conserved protein [Function unknow 98.26
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 98.23
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.22
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.2
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 98.19
KOG1008|consensus 783 98.17
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.17
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.17
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.15
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.15
PHA02713557 hypothetical protein; Provisional 98.14
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.11
KOG2444|consensus238 98.09
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.08
COG3391381 Uncharacterized conserved protein [Function unknow 98.08
KOG1897|consensus1096 98.07
KOG4441|consensus571 98.07
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.03
KOG4640|consensus 665 98.02
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.0
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.99
PHA02713557 hypothetical protein; Provisional 97.97
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.95
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.94
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.94
KOG4441|consensus571 97.88
KOG2395|consensus644 97.84
KOG4640|consensus 665 97.84
PF14727418 PHTB1_N: PTHB1 N-terminus 97.76
KOG2444|consensus238 97.75
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.75
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.72
KOG1897|consensus 1096 97.7
KOG2079|consensus 1206 97.7
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.7
KOG2395|consensus644 97.68
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.67
KOG2079|consensus 1206 97.62
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.6
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 97.58
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.52
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 97.4
PRK13616591 lipoprotein LpqB; Provisional 97.39
PHA03098534 kelch-like protein; Provisional 97.39
PHA03098534 kelch-like protein; Provisional 97.38
PRK13616591 lipoprotein LpqB; Provisional 97.34
KOG4499|consensus310 97.22
COG5276370 Uncharacterized conserved protein [Function unknow 97.17
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 97.16
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.12
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.11
KOG4499|consensus310 97.09
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 97.09
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.01
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.01
KOG3630|consensus 1405 96.96
PHA02790480 Kelch-like protein; Provisional 96.96
COG3490366 Uncharacterized protein conserved in bacteria [Fun 96.89
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.88
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.81
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.8
KOG3630|consensus 1405 96.72
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.7
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.65
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.59
PHA02790480 Kelch-like protein; Provisional 96.58
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.5
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 96.44
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.41
PLN02193470 nitrile-specifier protein 96.32
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.3
PLN02153341 epithiospecifier protein 96.25
PF14727418 PHTB1_N: PTHB1 N-terminus 96.24
COG5167776 VID27 Protein involved in vacuole import and degra 96.22
COG5276370 Uncharacterized conserved protein [Function unknow 96.16
COG5167776 VID27 Protein involved in vacuole import and degra 96.11
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 96.02
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.01
KOG1916|consensus 1283 96.01
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.85
KOG2377|consensus 657 95.73
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.64
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 95.56
KOG2280|consensus 829 95.53
KOG2247|consensus 615 95.37
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.31
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.14
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 95.12
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.09
KOG1916|consensus 1283 95.08
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 94.96
PRK10115 686 protease 2; Provisional 94.95
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.94
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 94.94
KOG1898|consensus1205 94.92
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 94.89
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.88
KOG2377|consensus 657 94.83
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 94.82
PRK13684334 Ycf48-like protein; Provisional 94.59
KOG2247|consensus 615 94.56
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 94.5
COG3823262 Glutamine cyclotransferase [Posttranslational modi 94.49
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 94.43
KOG2280|consensus 829 94.3
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 94.29
PRK10115 686 protease 2; Provisional 94.24
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 94.19
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 94.15
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 94.08
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 94.06
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.99
PRK13684334 Ycf48-like protein; Provisional 93.86
PLN02153341 epithiospecifier protein 93.83
KOG2063|consensus 877 93.78
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.69
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 93.58
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.47
COG1520370 FOG: WD40-like repeat [Function unknown] 93.32
KOG4460|consensus 741 93.14
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.04
KOG1983|consensus 993 92.98
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 92.96
KOG1900|consensus 1311 92.76
KOG4460|consensus 741 92.54
KOG1896|consensus1366 92.46
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 92.38
PLN02193470 nitrile-specifier protein 92.34
PF11635 753 Med16: Mediator complex subunit 16; InterPro: IPR0 92.33
COG4590 733 ABC-type uncharacterized transport system, permeas 92.27
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 92.04
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 91.31
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 91.06
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 90.9
KOG1900|consensus 1311 90.85
KOG2038|consensus988 90.84
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 90.82
KOG1898|consensus 1205 90.6
PF02724 622 CDC45: CDC45-like protein; InterPro: IPR003874 CDC 90.5
KOG2063|consensus 877 90.38
COG4590 733 ABC-type uncharacterized transport system, permeas 90.3
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 90.14
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 89.84
PF12768281 Rax2: Cortical protein marker for cell polarity 89.29
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 89.23
KOG0943|consensus 3015 89.2
PTZ00415 2849 transmission-blocking target antigen s230; Provisi 89.15
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 89.13
smart00036302 CNH Domain found in NIK1-like kinases, mouse citro 88.96
COG3823262 Glutamine cyclotransferase [Posttranslational modi 88.78
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 88.74
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 88.36
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 88.2
PRK05560805 DNA gyrase subunit A; Validated 88.04
TIGR01063800 gyrA DNA gyrase, A subunit. This model describes t 87.77
>KOG0271|consensus Back     alignment and domain information
Probab=100.00  E-value=1.9e-54  Score=362.36  Aligned_cols=321  Identities=16%  Similarity=0.220  Sum_probs=281.3

Q ss_pred             CcccEEEecCCCcEEEEEcCCCccceeeeeeecccCcccceEEEeeeccCCcEEEEEEcCCeEEEEeCCCCccccceeec
Q psy8152           5 DDYNIYIGSSTGAFKGVNLSKDKCIIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKIKIYDTDFKNFNTNTDVS   84 (444)
Q Consensus         5 ~~~~l~~g~~dg~i~i~~~~~~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~~l~~~~~d~~i~vw~~~~~~~~~~~~~~   84 (444)
                      ++..|++|+.|.++++||+.+...    +...+  +|...|.|++|+ |++..||+|+.||.|++||.++++.+.. .+.
T Consensus       126 ~g~~l~tGsGD~TvR~WD~~TeTp----~~t~K--gH~~WVlcvaws-PDgk~iASG~~dg~I~lwdpktg~~~g~-~l~  197 (480)
T KOG0271|consen  126 TGSRLVTGSGDTTVRLWDLDTETP----LFTCK--GHKNWVLCVAWS-PDGKKIASGSKDGSIRLWDPKTGQQIGR-ALR  197 (480)
T ss_pred             CCceEEecCCCceEEeeccCCCCc----ceeec--CCccEEEEEEEC-CCcchhhccccCCeEEEecCCCCCcccc-ccc
Confidence            678999999999999999988874    22333  899999999999 8999999999999999999998887654 335


Q ss_pred             cccccEEEEEe-------CCCeEEEEecCCcEEEEEcCCCCccccccccCCCeEEEEEeccCCEEEEeeCCCeEEEEEcC
Q psy8152          85 FGEGDIVGVSR-------YDECILTAVKSGDVKLWRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLN  157 (444)
Q Consensus        85 ~~~~~v~~~s~-------~~~~l~~~~~dg~i~iw~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~vwd~~  157 (444)
                      +|..+|+++++       ..++|++++.||.|+|||+..++++..+.+|..+|+|++|--+ .+|++|+.|++|++|+..
T Consensus       198 gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsgHT~~VTCvrwGG~-gliySgS~DrtIkvw~a~  276 (480)
T KOG0271|consen  198 GHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSGHTASVTCVRWGGE-GLIYSGSQDRTIKVWRAL  276 (480)
T ss_pred             CcccceeEEeecccccCCCccceecccCCCCEEEEEccCceEEEEeccCccceEEEEEcCC-ceEEecCCCceEEEEEcc
Confidence            89999998863       4578999999999999999999999989999999999999744 599999999999999999


Q ss_pred             CceeeeeeecccceeeEeeeCCCcccccCccceeEEEEecC-------------------------CCEEEEEeCCceEE
Q psy8152         158 TTKNIFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGISFLPN-------------------------SDKVAVCSKQGYVR  212 (444)
Q Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~-------------------------~~~l~~~~~d~~i~  212 (444)
                      .|.+...+++|.+.+..++++.+-.       .+.=+|.|.                         +..|++|+.|.++.
T Consensus       277 dG~~~r~lkGHahwvN~lalsTdy~-------LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVSgsDd~tlf  349 (480)
T KOG0271|consen  277 DGKLCRELKGHAHWVNHLALSTDYV-------LRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVSGSDDFTLF  349 (480)
T ss_pred             chhHHHhhcccchheeeeeccchhh-------hhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEEecCCceEE
Confidence            9999999999999555555543210       011112222                         24699999999999


Q ss_pred             EEEcCCCCCccceEEEeCCCCCeeEEEEccCCCEEEEEcCCCcEEEEEcCCCCcceeEeccccCceeEEEecCCCCEEEE
Q psy8152         213 VYDPKITTQRRPVLKVDIPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILS  292 (444)
Q Consensus       213 i~d~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~h~~~i~~~~~s~~~~~l~s  292 (444)
                      +|+..  ...+++..+.+|...|+.+.|||++++||+++.|..|++|+.++ ++.+.+|+||-++|..++|+.|.++|++
T Consensus       350 lW~p~--~~kkpi~rmtgHq~lVn~V~fSPd~r~IASaSFDkSVkLW~g~t-Gk~lasfRGHv~~VYqvawsaDsRLlVS  426 (480)
T KOG0271|consen  350 LWNPF--KSKKPITRMTGHQALVNHVSFSPDGRYIASASFDKSVKLWDGRT-GKFLASFRGHVAAVYQVAWSADSRLLVS  426 (480)
T ss_pred             Eeccc--ccccchhhhhchhhheeeEEECCCccEEEEeecccceeeeeCCC-cchhhhhhhccceeEEEEeccCccEEEE
Confidence            99987  56678889999999999999999999999999999999999999 9999999999999999999999999999


Q ss_pred             EECCCcEEEEEcCCCceEEEee-cCCceeEEEEcCCCcccccchhhhhccccccCCCccccC
Q psy8152         293 VSLDRHFRVHDFHSKKLLRKDY-MQSRLTSILVRSDFSLENETKKEEQEHSEEKGDSDEKYD  353 (444)
Q Consensus       293 ~~~dg~i~vw~~~~~~~~~~~~-~~~~i~~~~~~~~~~~~~~~~~~~~~~s~~~d~~i~~W~  353 (444)
                      |+.|.+++||++++.++...+. |...|.++-|+         |++..+++++.|..+++|.
T Consensus       427 ~SkDsTLKvw~V~tkKl~~DLpGh~DEVf~vDws---------pDG~rV~sggkdkv~~lw~  479 (480)
T KOG0271|consen  427 GSKDSTLKVWDVRTKKLKQDLPGHADEVFAVDWS---------PDGQRVASGGKDKVLRLWR  479 (480)
T ss_pred             cCCCceEEEEEeeeeeecccCCCCCceEEEEEec---------CCCceeecCCCceEEEeec
Confidence            9999999999999999988887 99999999877         5578999999999999995



>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>KOG2063|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>KOG2038|consensus Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>PF02724 CDC45: CDC45-like protein; InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46 Back     alignment and domain information
>KOG2063|consensus Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG0943|consensus Back     alignment and domain information
>PTZ00415 transmission-blocking target antigen s230; Provisional Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>smart00036 CNH Domain found in NIK1-like kinases, mouse citron and yeast ROM1, ROM2 Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PRK05560 DNA gyrase subunit A; Validated Back     alignment and domain information
>TIGR01063 gyrA DNA gyrase, A subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.98
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.98
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.97
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.97
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.97
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.96
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.96
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.95
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.95
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.95
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.95
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.95
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.95
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.95
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.94
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.94
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.94
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.94
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.94
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.93
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.93
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.93
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.93
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.93
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.93
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.92
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.92
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.91
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.91
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.9
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.9
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.9
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.9
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.89
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.89
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.89
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.88
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.88
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.87
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.86
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.85
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.85
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.83
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.83
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.83
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.83
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.83
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.82
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.8
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.79
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.79
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.78
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.78
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.78
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.77
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.77
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.77
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.77
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.76
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.76
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.76
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.76
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.75
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.75
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.74
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.74
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.73
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.72
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.72
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.72
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.71
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.69
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.69
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.67
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.67
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.66
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.65
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.65
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.65
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.65
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.63
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.63
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.59
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.59
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.58
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.57
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.57
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.56
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.55
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.55
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.54
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.53
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.52
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.52
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.5
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.5
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.5
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.5
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.49
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.48
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.41
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.41
2ece_A462 462AA long hypothetical selenium-binding protein; 99.4
2qe8_A343 Uncharacterized protein; structural genomics, join 99.39
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 99.38
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.37
2qe8_A343 Uncharacterized protein; structural genomics, join 99.36
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.35
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.35
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.35
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.35
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.34
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.3
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.3
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.27
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 99.26
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 99.24
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.23
2ece_A462 462AA long hypothetical selenium-binding protein; 99.21
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.2
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.18
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.15
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.14
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.11
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.09
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 99.06
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.05
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.02
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.02
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.01
4a2l_A795 BT_4663, two-component system sensor histidine kin 99.01
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.92
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.91
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.88
3v65_B386 Low-density lipoprotein receptor-related protein; 98.85
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.85
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.83
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.83
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.82
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.82
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.82
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.8
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.79
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.76
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.75
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.75
3v65_B386 Low-density lipoprotein receptor-related protein; 98.71
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.68
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.65
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.64
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.62
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.6
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.58
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.54
3kya_A496 Putative phosphatase; structural genomics, joint c 98.53
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.49
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.48
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.47
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.47
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.45
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.45
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.45
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.44
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.41
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.38
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.38
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 98.32
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 98.32
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.3
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 98.29
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.28
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.23
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.22
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.2
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 98.18
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.16
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.14
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 98.13
3kya_A496 Putative phosphatase; structural genomics, joint c 98.13
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 98.11
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.07
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 98.06
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 98.05
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.03
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 98.01
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 98.01
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.97
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 97.9
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.89
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.89
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.83
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.81
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.8
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.76
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.73
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.71
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 97.7
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 97.69
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.66
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 97.65
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 97.59
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.53
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.42
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 97.4
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 97.36
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.32
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.31
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.19
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.13
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.06
3ott_A 758 Two-component system sensor histidine kinase; beta 97.04
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.95
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.9
3ott_A 758 Two-component system sensor histidine kinase; beta 96.88
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.87
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.77
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.73
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 96.67
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 96.51
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.47
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.35
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.34
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 96.29
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.02
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 95.42
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 94.72
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal do 94.13
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 93.6
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 93.23
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase 93.17
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 90.12
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 89.28
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 88.35
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 88.34
3no0_A276 DNA gyrase subunit A; DNA topology, topoisomerase, 88.05
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 87.24
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-i 85.63
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 85.47
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 84.68
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-i 84.26
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase 82.3
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.4e-48  Score=353.87  Aligned_cols=284  Identities=13%  Similarity=0.216  Sum_probs=259.3

Q ss_pred             CcccceEEEeeecc---CCcEEEEEEcCCeEEEEeCCCCccccceeeccccccEEEE--EeCCCeEEEEecCCcEEEEEc
Q psy8152          40 TNKASVLALNWGNV---EESELLIAYSGQKIKIYDTDFKNFNTNTDVSFGEGDIVGV--SRYDECILTAVKSGDVKLWRY  114 (444)
Q Consensus        40 ~h~~~v~~~~~~~~---~~~~l~~~~~d~~i~vw~~~~~~~~~~~~~~~~~~~v~~~--s~~~~~l~~~~~dg~i~iw~~  114 (444)
                      +|.+.|++++|+|.   ++.+|++|+.|++|+||++..++........+|...|.++  ++++.++++++.|++|++||+
T Consensus        30 ~H~~~V~~v~~~~~~~~~~~~l~tgs~D~~v~vW~~~~~~~~~~~~l~gh~~~v~~~~~~~~~~~l~s~s~D~~i~lWd~  109 (321)
T 3ow8_A           30 AHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDL  109 (321)
T ss_dssp             SSSSCEEEEEEC-------CEEEEEETTSCEEEEEEETTEEEEEEEECCCSSCEEEEEECSSSSEEEEEETTSEEEEEET
T ss_pred             cCCCcEEEEEEecCCCCCCCEEEEEcCCCCEEEEECCCCCeeeeeeeccCCCCEEEEEECCCCCEEEEEeCCCcEEEEEC
Confidence            89999999999941   4679999999999999999877665555566888888776  578899999999999999999


Q ss_pred             CCCCccccccccCCCeEEEEEeccCCEEEEeeCCCeEEEEEcCCceeeeeeecccceeeEeeeCCCcccccCccceeEEE
Q psy8152         115 KTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKNIFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGIS  194 (444)
Q Consensus       115 ~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~vwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~  194 (444)
                      .+++++..+..|...+.+++|+|++++|++|+.++.|++|++.+++....+..+..                  .|.+++
T Consensus       110 ~~~~~~~~~~~~~~~~~~~~~spdg~~l~~g~~dg~v~i~~~~~~~~~~~~~~~~~------------------~v~~~~  171 (321)
T 3ow8_A          110 ENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGK------------------FILSIA  171 (321)
T ss_dssp             TTTEEEEEEECCTTCCCCEEECTTSSEEEEECTTSEEEEEETTTCSEEEEEECSSS------------------CEEEEE
T ss_pred             CCCCEEEEEeCCCccEEEEEECCCCCEEEEEcCCCcEEEEEcCCCceeEEecCCCc------------------eEEEEE
Confidence            99998877778889999999999999999999999999999999988888877766                  799999


Q ss_pred             EecCCCEEEEEeCCceEEEEEcCCCCCccceEEEeCCCCCeeEEEEccCCCEEEEEcCCCcEEEEEcCCCCcceeEeccc
Q psy8152         195 FLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGF  274 (444)
Q Consensus       195 ~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~h  274 (444)
                      |+|++++|++++.|+.|++||++   ..+.+..+.+|..+|.+++|+|++++|++|+.|+.|++||++. ++++..+.+|
T Consensus       172 ~spdg~~lasg~~dg~i~iwd~~---~~~~~~~~~~h~~~v~~l~~spd~~~l~s~s~dg~i~iwd~~~-~~~~~~~~~h  247 (321)
T 3ow8_A          172 YSPDGKYLASGAIDGIINIFDIA---TGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQH-ANLAGTLSGH  247 (321)
T ss_dssp             ECTTSSEEEEEETTSCEEEEETT---TTEEEEEECCCSSCCCEEEECTTSCEEEEECTTSCEEEEETTT-CCEEEEECCC
T ss_pred             ECCCCCEEEEEcCCCeEEEEECC---CCcEEEEEcccCCceeEEEEcCCCCEEEEEcCCCeEEEEECCC-cceeEEEcCC
Confidence            99999999999999999999999   7888899999999999999999999999999999999999999 9999999999


Q ss_pred             cCceeEEEecCCCCEEEEEECCCcEEEEEcCCCceEEEee-cCCceeEEEEcCCCcccccchhhhhccccccCCCccccC
Q psy8152         275 AGCVKDIACPLNENLILSVSLDRHFRVHDFHSKKLLRKDY-MQSRLTSILVRSDFSLENETKKEEQEHSEEKGDSDEKYD  353 (444)
Q Consensus       275 ~~~i~~~~~s~~~~~l~s~~~dg~i~vw~~~~~~~~~~~~-~~~~i~~~~~~~~~~~~~~~~~~~~~~s~~~d~~i~~W~  353 (444)
                      ...|++++|+|++++|++++.|++|++||+.+++++..+. |...|.+++|+++         +.++++++.|+.|++|+
T Consensus       248 ~~~v~~~~~sp~~~~l~s~s~D~~v~iwd~~~~~~~~~~~~h~~~v~~v~~s~~---------g~~l~s~~~d~~i~vwd  318 (321)
T 3ow8_A          248 ASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGN---------GSKIVSVGDDQEIHIYD  318 (321)
T ss_dssp             SSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEEECTT---------SSEEEEEETTCCEEEEE
T ss_pred             CCceEEEEECCCCCEEEEEeCCCcEEEEeCCCCEEEEEEcCCCCcEEEEEECCC---------CCEEEEEeCCCeEEEEe
Confidence            9999999999999999999999999999999999988875 8899999999854         57899999999999998


Q ss_pred             C
Q psy8152         354 P  354 (444)
Q Consensus       354 ~  354 (444)
                      .
T Consensus       319 ~  319 (321)
T 3ow8_A          319 C  319 (321)
T ss_dssp             C
T ss_pred             C
Confidence            5



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3no0_A DNA gyrase subunit A; DNA topology, topoisomerase, C-terminal DO gyrase, DNA binding protein, isomerase; HET: DNA GOL; 1.30A {Aquifex aeolicus} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 444
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.001
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.004
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-06
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-06
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-06
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.001
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.002
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.003
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 62.1 bits (149), Expect = 3e-11
 Identities = 26/194 (13%), Positives = 56/194 (28%), Gaps = 20/194 (10%)

Query: 110 KLWRYKTEPDQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKNIFSAKNVS 169
            LW  +T     T       +  +     + +  +G  +   KLWD+       +     
Sbjct: 167 ALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHE 226

Query: 170 HRVLVYSVKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVD 229
                               +N I F PN +  A  S     R++D +   +       D
Sbjct: 227 S------------------DINAICFFPNGNAFATGSDDATCRLFDLRADQELMTY-SHD 267

Query: 230 IPDVALSCITTTNQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENL 289
                ++ ++ +     ++ G    +    D   K        G    V  +    +   
Sbjct: 268 NIICGITSVSFSKSGRLLLAGYDDFNCNVWDAL-KADRAGVLAGHDNRVSCLGVTDDGMA 326

Query: 290 ILSVSLDRHFRVHD 303
           + + S D   ++ +
Sbjct: 327 VATGSWDSFLKIWN 340


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query444
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.95
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.94
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.94
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.94
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.92
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.92
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.92
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.91
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.89
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.84
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.84
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.83
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.82
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.81
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.71
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.67
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.64
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.63
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.59
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.48
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.45
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.39
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.32
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.29
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.27
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.27
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.24
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.22
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.13
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.1
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.1
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.07
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.03
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.02
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.98
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.92
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.83
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.72
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.67
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.65
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.63
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.62
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.53
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 98.48
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.47
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.44
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 98.33
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.31
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.17
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.1
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 98.07
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 98.06
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.99
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.93
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.91
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 97.73
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.69
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.52
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.5
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.47
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 97.18
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.89
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 96.6
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 96.36
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.03
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 95.58
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 95.57
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.52
d1jtdb_273 beta-lactamase inhibitor protein-II, BLIP-II {Stre 93.7
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 93.15
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 92.38
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 91.82
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 91.18
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 90.53
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 89.11
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 86.64
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 82.56
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1e-43  Score=322.69  Aligned_cols=307  Identities=11%  Similarity=0.149  Sum_probs=260.7

Q ss_pred             cCCCcEEEEEcCCCcc----ceeeeeeecccCcccceEEEeeeccCCcEEEEEEcCCeEEEEeCCCCcccc---ceeecc
Q psy8152          13 SSTGAFKGVNLSKDKC----IIKNIQNVKYITNKASVLALNWGNVEESELLIAYSGQKIKIYDTDFKNFNT---NTDVSF   85 (444)
Q Consensus        13 ~~dg~i~i~~~~~~~~----~~~~~~~~~~~~h~~~v~~~~~~~~~~~~l~~~~~d~~i~vw~~~~~~~~~---~~~~~~   85 (444)
                      +.+|.+.-..+.....    ...+.+.+..+.|...|+|++|+ |++.+|++|+ ||.|+|||+.++....   .+....
T Consensus        18 ~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~H~~~V~~v~fs-~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~   95 (337)
T d1gxra_          18 TADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTIS-NPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLN   95 (337)
T ss_dssp             CSSSCEEECCCCTTSSSSTTCCSEEEEEEEECCSSCCCEEEEC-SSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSC
T ss_pred             CCCCCEEeeccCCcceecCCCCCCceEEEECCCCCcEEEEEEC-CCCCEEEEEE-CCEEEEEEccCCcccceeEEeeecC
Confidence            5566666666544332    13345566666899999999999 7999999987 7999999997654433   333446


Q ss_pred             ccccEEEE--EeCCCeEEEEecCCcEEEEEcCCCC--ccccccccCCCeEEEEEeccCCEEEEeeCCCeEEEEEcCCcee
Q psy8152          86 GEGDIVGV--SRYDECILTAVKSGDVKLWRYKTEP--DQWTNFNVGPQLECMKHNKHSNIIATGGKENDLKLWDLNTTKN  161 (444)
Q Consensus        86 ~~~~v~~~--s~~~~~l~~~~~dg~i~iw~~~~~~--~~~~~~~~~~~v~~~~~~~~~~~l~~~~~d~~i~vwd~~~~~~  161 (444)
                      |...|.++  +|++++|++++.||.|++|++....  ....+..|...+.+++|+|++.++++++.++.|++|++.++++
T Consensus        96 h~~~I~~v~~s~dg~~l~s~~~dg~i~iwd~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~  175 (337)
T d1gxra_          96 RDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTL  175 (337)
T ss_dssp             TTSBEEEEEECTTSSEEEEEESSSEEEEEECCCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEE
T ss_pred             CCCcEEEEEEcCCCCEEEEeeccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            77777655  6899999999999999999987554  3335567889999999999999999999999999999999998


Q ss_pred             eeeeecccceeeEeeeCCCcccccCccceeEEEEecCCCEEEEEeCCceEEEEEcCCCCCccceEEEeCCCCCeeEEEEc
Q psy8152         162 IFSAKNVSHRVLVYSVKPDEFDLRRPVWVNGISFLPNSDKVAVCSKQGYVRVYDPKITTQRRPVLKVDIPDVALSCITTT  241 (444)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~~~~~~~~i~~~~~~  241 (444)
                      ......+..                  .|++++|++++.++++++.|+.|++||++   ..+.+..+. +...|.+++|+
T Consensus       176 ~~~~~~~~~------------------~v~~l~~s~~~~~~~~~~~d~~v~i~d~~---~~~~~~~~~-~~~~i~~l~~~  233 (337)
T d1gxra_         176 VRQFQGHTD------------------GASCIDISNDGTKLWTGGLDNTVRSWDLR---EGRQLQQHD-FTSQIFSLGYC  233 (337)
T ss_dssp             EEEECCCSS------------------CEEEEEECTTSSEEEEEETTSEEEEEETT---TTEEEEEEE-CSSCEEEEEEC
T ss_pred             ccccccccc------------------ccccccccccccccccccccccccccccc---cceeecccc-cccceEEEEEc
Confidence            888777766                  79999999999999999999999999999   666666554 77889999999


Q ss_pred             cCCCEEEEEcCCCcEEEEEcCCCCcceeEeccccCceeEEEecCCCCEEEEEECCCcEEEEEcCCCceEEEeecCCceeE
Q psy8152         242 NQSHYVIVGSTTGDMMAVDLRGKGKPCYKYKGFAGCVKDIACPLNENLILSVSLDRHFRVHDFHSKKLLRKDYMQSRLTS  321 (444)
Q Consensus       242 ~~~~~l~~~~~dg~i~iwd~~~~~~~~~~~~~h~~~i~~~~~s~~~~~l~s~~~dg~i~vw~~~~~~~~~~~~~~~~i~~  321 (444)
                      |++++|++|+.++.|++||++. +... ....|...|++++|+|++++|++++.||.|++|++.+++++....|...|.+
T Consensus       234 ~~~~~l~~~~~d~~i~i~d~~~-~~~~-~~~~~~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~~~~~~v~~  311 (337)
T d1gxra_         234 PTGEWLAVGMESSNVEVLHVNK-PDKY-QLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLS  311 (337)
T ss_dssp             TTSSEEEEEETTSCEEEEETTS-SCEE-EECCCSSCEEEEEECTTSSEEEEEETTSEEEEEETTTCCEEEEEECSSCEEE
T ss_pred             ccccccceeccccccccccccc-cccc-cccccccccceEEECCCCCEEEEEeCCCeEEEEECCCCCEEEEccCCCCEEE
Confidence            9999999999999999999997 6554 5567999999999999999999999999999999999999999889999999


Q ss_pred             EEEcCCCcccccchhhhhccccccCCCccccCC
Q psy8152         322 ILVRSDFSLENETKKEEQEHSEEKGDSDEKYDP  354 (444)
Q Consensus       322 ~~~~~~~~~~~~~~~~~~~~s~~~d~~i~~W~~  354 (444)
                      ++|+++         ++++++++.|+.|+||++
T Consensus       312 ~~~s~d---------~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         312 CDISVD---------DKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             EEECTT---------SCEEEEEETTSCEEEEEE
T ss_pred             EEEeCC---------CCEEEEEeCCCeEEEEEE
Confidence            998754         578999999999999986



>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1jtdb_ b.69.5.2 (B:) beta-lactamase inhibitor protein-II, BLIP-II {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure