Psyllid ID: psy8155

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------

NANIANIDNQPGAIGFVSRLIPTIYPISIIRVDPVTSEPIRNKKGLCTRCEPGEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSDPPKNTTYNKKGLCSRCEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIFTDVFEIGDSAFLSGDLLVMDKWGYLYFKDRTGDTFPALKSRALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFSWSPDTDSSSSPVPRSQALSPLLSEVPTSPPSLSYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIGEMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGMAAILDINKSLDVSAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQGNIRL

cEEEEEccccccEEEcccccccccccEEEEEEccccccccccccccEEEcccccccEEEEEEcccccccccccccccccccccEEEcccccccEEEEccccccccccccccEEEccccEEEEEEcccccccccccccccccccccEEccccccccEEEEEccEEEEEccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEccEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccEEEccccccccHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccEEEcHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHccccEEEEcHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccccEEEEEEEEEEccccEEEEcccccccccccccccccEEEEcccccEEEccHHHHHHHHcccccc

cccEHccccccccHHHHHHHHHHHHHHHHHHccEEEccccccccccEEcHccccEEEEEHEEEEcccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEcccccccEEEEEEEEEEccccccccHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccEEEEEcccEEcHHHHHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHccccEccccccccHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHcccccEEEEEcccccccccccccHHHHHHHHHHcccccccccccccHHcEEEEEEEccccccccccEccHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHcccEEEEccHHHHHHHHHcccHccccccEEEEEEcccccHHHHHHHHHHccccEEEEccccccEEEEEEEcccccccccccccccEEcccccccccccccEEEEEcccccccccHHHHHHccccccccccEEccccHEEcccccEEEEccccccEcc

nanianidnqpgaigfvsrliptiypisiirvdpvtsepirnkkglctrcepgepgvfigkivpsnparaylgyvnekdsakKIVTDVFeigdsaflsdppknttynkkglcsrcepgvfigkivpsnparaylgyvnekdsaKKIFTDVfeigdsaflsgdllvmdkwgylyfkdrtgdtfpaLKSRALQRYLRFLWAARRVAQKDLTIADIFRehavrspnkVIFMFENTEWTAQQVEAYSNRVANFFLaqglkkgdSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLgsnvklfswspdtdsssspvprsqalspllsevptsppslsyrvgvQDKLIYIYTsgttglpkaaviSNHRYYFLGGAIAYQIGfrtkdrfytplplyhtaggamCIGQALIFGCCVVIRkkfsasnyfsdvckyKCTVGQYIGEMCRYLlstpekpedkahNVRLMfgnglrpqiWSEFVDRFRIAQIgefygategMAAILDINKSLDVSAVSEGIKKALPSYARPLFIRCLREVEMtgtyklkkldlqkegfdpnviQDRLYYLsskgvyeeltPEVYKDLVQGNIRL

nanianidnqpgaiGFVSRLIPTIYPisiirvdpvtsepirnKKGLCTRCEPGEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEigdsaflsdppknttynkkglcsrCEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIFTDVFEIGDSAFLSGDLLVMDKWGYLYFKDRTGDTFPALKSRALQRYLRFLWAARRVAQKDLTIADIfrehavrspnKVIFMFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFSwspdtdsssspVPRSQALSpllsevptsppslsyrvGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIGEMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGMAAILDINKSLDVSAVSEGIkkalpsyarplFIRCLREVEMTGTyklkkldlqkegfdpnvIQDRLYYLSSkgvyeeltpevykdlvqgnirl

NANIANIDNQPGAIGFVSRLIPTIYPISIIRVDPVTSEPIRNKKGLCTRCEPGEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSDPPKNTTYNKKGLCSRCEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIFTDVFEIGDSAFLSGDLLVMDKWGYLYFKDRTGDTFPALKSRALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFswspdtdsssspvprsqalsPLLSEVPTSPPSLSYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIGEMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGMAAILDINKSLDVSAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQGNIRL

**********PGAIGFVSRLIPTIYPISIIRVDPVTSEPIRNKKGLCTRCEPGEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSDPPKNTTYNKKGLCSRCEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIFTDVFEIGDSAFLSGDLLVMDKWGYLYFKDRTGDTFPALKSRALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFSW*******************************SYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIGEMCRYLLST*******AHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGMAAILDINKSLDVSAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLV******

NANIANIDNQPGAIGFVSRLIPTIYPISIIRVDPVTSEPIRNKKGLCTRCEPGEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSDPPKNTTYNKKGLCSRCEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIFTDVFEIGDSAFLSGDLLVMDKWGYLYFKDRTGDTFPALKSRALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFSWSPDTDSSSSPVPRSQALSPL**************VGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIGEMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGMAAILDINKSLDVSAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQGNIRL

NANIANIDNQPGAIGFVSRLIPTIYPISIIRVDPVTSEPIRNKKGLCTRCEPGEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAFLSDPPKNTTYNKKGLCSRCEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIFTDVFEIGDSAFLSGDLLVMDKWGYLYFKDRTGDTFPALKSRALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFSWS**************************PPSLSYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIGEMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGMAAILDINKSLDVSAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQGNIRL

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		617	2.2.26 [Sep-21-2011]
Q91VE0		643	Long-chain fatty acid tra	yes	N/A	0.513	0.493	0.487	2e-83
Q4R3Y4		643	Long-chain fatty acid tra	N/A	N/A	0.573	0.550	0.444	2e-83
Q6P1M0		643	Long-chain fatty acid tra	yes	N/A	0.573	0.550	0.442	5e-83
P97849		646	Long-chain fatty acid tra	yes	N/A	0.554	0.529	0.459	2e-82
Q60714		646	Long-chain fatty acid tra	no	N/A	0.534	0.510	0.470	5e-82
Q5RDY4		643	Long-chain fatty acid tra	yes	N/A	0.573	0.550	0.436	3e-81
Q3ZKN0		646	Long-chain fatty acid tra	no	N/A	0.533	0.509	0.480	1e-80
Q6PCB7		646	Long-chain fatty acid tra	no	N/A	0.534	0.510	0.461	2e-79
Q9Y2P4		619	Long-chain fatty acid tra	no	N/A	0.510	0.508	0.415	9e-65
O14975		620	Very long-chain acyl-CoA	no	N/A	0.575	0.572	0.386	2e-62

>sp\|Q91VE0\|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1	Back alignment and function desciption

 Score =  310 bits (795), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 160/328 (48%), Positives = 210/328 (64%), Gaps = 11/328 (3%)

Query: 201 RRVAQKDLTIADIFREHAVRSPNKVIFMFE--NTEWTAQQVEAYSNRVANFFLAQGLKKG 258
           RR  Q+  T+  +F     R P+K   +FE  +T WT +Q++ YS+ VANF  A+GL  G
Sbjct: 67  RRYLQERKTVPLLFASMVQRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQARGLASG 126

Query: 259 DSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDA 318
           + VAL +ENR EFV LWLG++KLGV  ALIN NLR+++L HC++ +   A I+G+E+  A
Sbjct: 127 NVVALFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALRHCLDTSKARALIFGSEMASA 186

Query: 319 VQEISTSLGSNVKLF---SWSPDTDSSSSPVPRSQALSPLLSEVPTSPPSLSYRVGVQDK 375
           + EI  SL   + LF   SW P    S+ PV  ++ L PLL + P   PS   + G  DK
Sbjct: 187 ICEIHASLEPTLSLFCSGSWEP----STVPVS-TEHLDPLLEDAPKHLPSHPDK-GFTDK 240

Query: 376 LIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQ 435
           L YIYTSGTTGLPKAA++ + RYY +   + Y    R  D  Y  LPLYH+AG  + IGQ
Sbjct: 241 LFYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGFRMRPDDIVYDCLPLYHSAGNIVGIGQ 300

Query: 436 ALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIGEMCRYLLSTPEKPEDKAHNVRLMFG 495
            L+ G  VVIRKKFSAS ++ D  KY CT+ QYIGE+CRYLL+ P +  +  H VR+  G
Sbjct: 301 CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAESRHKVRMALG 360

Query: 496 NGLRPQIWSEFVDRFRIAQIGEFYGATE 523
           NGLR  IW++F  RF I Q+ EFYGATE
Sbjct: 361 NGLRQSIWTDFSSRFHIPQVAEFYGATE 388

Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption in early embryogenesis. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: -

>sp\|Q4R3Y4\|S27A4_MACFA Long-chain fatty acid transport protein 4 OS=Macaca fascicularis GN=SLC27A4 PE=2 SV=1	Back alignment and function description

>sp\|Q6P1M0\|S27A4_HUMAN Long-chain fatty acid transport protein 4 OS=Homo sapiens GN=SLC27A4 PE=1 SV=1	Back alignment and function description

>sp\|P97849\|S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus GN=Slc27a1 PE=2 SV=1	Back alignment and function description

>sp\|Q60714\|S27A1_MOUSE Long-chain fatty acid transport protein 1 OS=Mus musculus GN=Slc27a1 PE=1 SV=1	Back alignment and function description

>sp\|Q5RDY4\|S27A4_PONAB Long-chain fatty acid transport protein 4 OS=Pongo abelii GN=SLC27A4 PE=2 SV=1	Back alignment and function description

>sp\|Q3ZKN0\|S27A1_BOVIN Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1	Back alignment and function description

>sp\|Q6PCB7\|S27A1_HUMAN Long-chain fatty acid transport protein 1 OS=Homo sapiens GN=SLC27A1 PE=2 SV=1	Back alignment and function description

>sp\|Q9Y2P4\|S27A6_HUMAN Long-chain fatty acid transport protein 6 OS=Homo sapiens GN=SLC27A6 PE=1 SV=1	Back alignment and function description

>sp\|O14975\|S27A2_HUMAN Very long-chain acyl-CoA synthetase OS=Homo sapiens GN=SLC27A2 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		617
332030012		998	Long-chain fatty acid transport protein	0.585	0.361	0.540	1e-117
322789745		749	hypothetical protein SINV_09772 [Solenop	0.614	0.506	0.529	1e-115
345493601		760	PREDICTED: long-chain fatty acid transpo	0.562	0.456	0.557	1e-113
328696708		624	PREDICTED: long-chain fatty acid transpo	0.557	0.551	0.538	1e-111
157104991		723	AMP dependent ligase [Aedes aegypti] gi\|	0.635	0.542	0.528	1e-111
328696706		737	PREDICTED: long-chain fatty acid transpo	0.557	0.466	0.538	1e-111
307197649		789	Long-chain fatty acid transport protein	0.596	0.466	0.539	1e-110
307186259		1086	Long-chain fatty acid transport protein	0.617	0.350	0.522	1e-110
350405775		812	PREDICTED: long-chain fatty acid transpo	0.585	0.444	0.524	1e-110
91082889		695	PREDICTED: similar to AMP dependent liga	0.593	0.526	0.526	1e-110

>gi\|332030012\|gb\|EGI69837.1\| Long-chain fatty acid transport protein 4 [Acromyrmex echinatior]	Back alignment and taxonomy information

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 199/368 (54%), Positives = 264/368 (71%), Gaps = 7/368 (1%)

Query: 168 KWGYLYFKDRTGDTFPALKSRALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIF 227
           +W Y+  K  + D       + L  Y+R LW+A    +K+  +ADIFR+H  R PNK+ F
Sbjct: 418 RWFYVALKTISRD------CKGLIGYIRMLWSAHGHGRKNRNVADIFRQHVNRYPNKICF 471

Query: 228 MFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITAL 287
           +FE+ EWT QQ+E +SN++A  F   G KKGD++AL+LENRPEF+ +WLGL+KLGV+T+L
Sbjct: 472 IFEDKEWTFQQIEDFSNKIATIFKTHGYKKGDAIALLLENRPEFIAIWLGLNKLGVVTSL 531

Query: 288 INHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFSWSPDTDSSSSPVP 347
           IN+NLR++SLLHCINIA   A IYG E  DAV +I++SL + + L+ +    ++ S  + 
Sbjct: 532 INNNLRKSSLLHCINIAKCQALIYGTEFFDAVTDIASSLDAKLTLYRFGNHPNTMSVGL- 590

Query: 348 RSQALSPLLSEVPTSPPSLSYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAY 407
           + + L+ LL + P +P  +  + G  DKL+YIYTSGTTGLPKAAVI+N RY F+  ++ Y
Sbjct: 591 KEKDLNTLLLDTPAAPLGVQEKSGYHDKLLYIYTSGTTGLPKAAVITNSRYIFITSSVRY 650

Query: 408 QIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQ 467
               R  DR YT LPLYHTAGG M +G ALI+G   VIRKKFSAS YF+D  KYKCTVGQ
Sbjct: 651 MGTLRDSDRIYTSLPLYHTAGGIMAVGLALIYGHTTVIRKKFSASAYFADCIKYKCTVGQ 710

Query: 468 YIGEMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGMAA 527
           YIGEMCRY+L+ P K ED+ HN+RL+FGNGLRPQIW EFV RF+I Q+ EFYGATEG A 
Sbjct: 711 YIGEMCRYILAVPSKKEDQEHNIRLIFGNGLRPQIWDEFVKRFKIPQVLEFYGATEGNAN 770

Query: 528 ILDINKSL 535
           +++I+  +
Sbjct: 771 VMNIDNKM 778

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|322789745\|gb\|EFZ14911.1\| hypothetical protein SINV_09772 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|345493601\|ref\|XP_001603923.2\| PREDICTED: long-chain fatty acid transport protein 4-like [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|328696708\|ref\|XP_003240103.1\| PREDICTED: long-chain fatty acid transport protein 4-like isoform 2 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|157104991\|ref\|XP_001648665.1\| AMP dependent ligase [Aedes aegypti] gi\|108884157\|gb\|EAT48382.1\| AAEL000572-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|328696706\|ref\|XP_001942878.2\| PREDICTED: long-chain fatty acid transport protein 4-like isoform 1 [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|307197649\|gb\|EFN78828.1\| Long-chain fatty acid transport protein 4 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|307186259\|gb\|EFN71922.1\| Long-chain fatty acid transport protein 4 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|350405775\|ref\|XP_003487546.1\| PREDICTED: long-chain fatty acid transport protein 4-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|91082889\|ref\|XP_971856.1\| PREDICTED: similar to AMP dependent ligase [Tribolium castaneum] gi\|270007071\|gb\|EFA03519.1\| hypothetical protein TcasGA2_TC013521 [Tribolium castaneum]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		617
FB\|FBgn0021953		705	Fatp "Fatty acid (long chain)	0.619	0.541	0.484	7.6e-118
ZFIN\|ZDB-GENE-050417-248		643	slc27a4 "solute carrier family	0.502	0.482	0.482	2e-100
ZFIN\|ZDB-GENE-061013-672		648	slc27a1b "solute carrier famil	0.641	0.611	0.407	2.9e-99
UNIPROTKB\|E1BT18		654	SLC27A4 "Uncharacterized prote	0.528	0.498	0.471	4.7e-97
UNIPROTKB\|Q0VCQ2		643	SLC27A4 "Solute carrier family	0.529	0.508	0.472	1.3e-96
ZFIN\|ZDB-GENE-050320-112		647	slc27a1a "solute carrier famil	0.562	0.536	0.458	4.2e-96
UNIPROTKB\|G3V7V3		643	Slc27a4 "Solute carrier family	0.578	0.555	0.442	1.3e-94
MGI\|MGI:1347347		643	Slc27a4 "solute carrier family	0.578	0.555	0.442	1.6e-94
UNIPROTKB\|J9P1R3		701	SLC27A4 "Uncharacterized prote	0.551	0.485	0.446	5.4e-94
FB\|FBgn0034999		687	CG3394 [Drosophila melanogaste	0.606	0.544	0.423	8.9e-94

FB\|FBgn0021953 Fatp "Fatty acid (long chain) transport protein" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 911 (325.7 bits), Expect = 7.6e-118, Sum P(2) = 7.6e-118
 Identities = 189/390 (48%), Positives = 245/390 (62%)

Query:   163 LLVMDKWGYLYFKDRTGDTFPALKSRALQRYLRFLWAARRVAQKDLTIADIFREHAVRSP 222
             LL    W + Y    T          AL  Y++ L   +R  + + T+AD+F  +    P
Sbjct:    94 LLTKPGWRWFYIAGATASR----DLTALWAYIKLLRYTKRHERLNYTVADVFERNVQAHP 149

Query:   223 NKVIFMFENTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLG 282
             +KV  + E   WT +QV  ++N+VAN   AQG KKGD VAL+LENR E+V  WLGLSK+G
Sbjct:   150 DKVAVVSETQRWTFRQVNEHANKVANVLQAQGYKKGDVVALLLENRAEYVATWLGLSKIG 209

Query:   283 VITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFXXXXXXXXX 342
             VIT LIN NLR  SLLH I +A  SA IYG +  +AV +++  L +N+ LF         
Sbjct:   210 VITPLINTNLRGPSLLHSITVAHCSALIYGEDFLEAVTDVAKDLPANLTLFQFNNENNNS 269

Query:   343 XXXXXX--XXXXXPLLSEVPTSPPSLSYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYF 400
                           LL+      P+ + +V   DKL+YIYTSGTTGLPKAAVIS+ RY F
Sbjct:   270 ETEKNIPQAKNLNALLTTASYEKPNKT-QVNHHDKLVYIYTSGTTGLPKAAVISHSRYLF 328

Query:   401 LGGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCK 460
             +   I Y +GF+ +D FYTPLPLYHTAGG MC+GQ+++FG  V IRKKFSASNYF+D  K
Sbjct:   329 IAAGIHYTMGFQEEDIFYTPLPLYHTAGGIMCMGQSVLFGSTVSIRKKFSASNYFADCAK 388

Query:   461 YKCTVGQYIGEMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYG 520
             Y  T+GQYIGEM RY+L+T     D+ H VRL+FGNGLRPQIW +FV RF IA++GEFYG
Sbjct:   389 YNATIGQYIGEMARYILATKPSEYDQKHRVRLVFGNGLRPQIWPQFVQRFNIAKVGEFYG 448

Query:   521 ATEGMAAILDINKSLD-VSAVSEGIKKALP 549
             ATEG A I++ + ++  +  VS  + K  P
Sbjct:   449 ATEGNANIMNHDNTVGAIGFVSRILPKIYP 478

GO:0005324 "long-chain fatty acid transporter activity" evidence=ISS

GO:0015909 "long-chain fatty acid transport" evidence=ISS

GO:0005886 "plasma membrane" evidence=ISS

GO:0008152 "metabolic process" evidence=IEA

GO:0003824 "catalytic activity" evidence=IEA

GO:0070328 "triglyceride homeostasis" evidence=IMP

ZFIN\|ZDB-GENE-050417-248 slc27a4 "solute carrier family 27 (fatty acid transporter), member 4" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-061013-672 slc27a1b "solute carrier family 27 (fatty acid transporter), member 1b" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BT18 SLC27A4 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q0VCQ2 SLC27A4 "Solute carrier family 27 (Fatty acid transporter), member 4" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-050320-112 slc27a1a "solute carrier family 27 (fatty acid transporter), member 1a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|G3V7V3 Slc27a4 "Solute carrier family 27 (Fatty acid transporter), member 4" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1347347 Slc27a4 "solute carrier family 27 (fatty acid transporter), member 4" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|J9P1R3 SLC27A4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

FB\|FBgn0034999 CG3394 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.2.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		617
cd05939		474	cd05939, hsFATP4_like, Fatty acid transport protei	1e-133
PRK08279		600	PRK08279, PRK08279, long-chain-acyl-CoA synthetase	1e-130
cd05938		535	cd05938, hsFATP2a_ACSVL_like, Fatty acid transport	4e-92
cd05940		444	cd05940, FATP_FACS, Fatty acid transport proteins	2e-89
cd05937		468	cd05937, FATP_chFAT1_like, Uncharacterized subfami	2e-72
cd05934		421	cd05934, FACL_DitJ_like, Uncharacterized subfamily	4e-59
COG0318		534	COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/	3e-58
PRK06155		542	PRK06155, PRK06155, crotonobetaine/carnitine-CoA l	5e-57
pfam00501		412	pfam00501, AMP-binding, AMP-binding enzyme	7e-57
cd05939		474	cd05939, hsFATP4_like, Fatty acid transport protei	4e-40
PRK08008		517	PRK08008, caiC, putative crotonobetaine/carnitine-	1e-35
PRK06187		521	PRK06187, PRK06187, long-chain-fatty-acid--CoA lig	7e-35
cd05936		468	cd05936, FC-FACS_FadD_like, Prokaryotic long-chain	3e-31
PRK13388		540	PRK13388, PRK13388, acyl-CoA synthetase; Provision	1e-30
cd05939		474	cd05939, hsFATP4_like, Fatty acid transport protei	3e-30
PRK07867		529	PRK07867, PRK07867, acyl-CoA synthetase; Validated	5e-30
PRK08316		523	PRK08316, PRK08316, acyl-CoA synthetase; Validated	4e-29
PRK07788		549	PRK07788, PRK07788, acyl-CoA synthetase; Validated	5e-29
COG0365		528	COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat	3e-28
cd05911		487	cd05911, Firefly_Luc_like, Firefly luciferase of l	1e-27
PRK08279		600	PRK08279, PRK08279, long-chain-acyl-CoA synthetase	7e-27
cd05920		483	cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l	2e-25
cd04433		338	cd04433, AFD_class_I, Adenylate forming domain, Cl	6e-25
PRK08276		502	PRK08276, PRK08276, long-chain-fatty-acid--CoA lig	2e-23
PRK07798		533	PRK07798, PRK07798, acyl-CoA synthetase; Validated	2e-22
PRK06839		496	PRK06839, PRK06839, acyl-CoA synthetase; Validated	6e-22
PRK08279		600	PRK08279, PRK08279, long-chain-acyl-CoA synthetase	1e-21
PRK03640		483	PRK03640, PRK03640, O-succinylbenzoic acid--CoA li	4e-20
PRK07656		513	PRK07656, PRK07656, long-chain-fatty-acid--CoA lig	6e-20
cd05940		444	cd05940, FATP_FACS, Fatty acid transport proteins	1e-19
PRK07868		994	PRK07868, PRK07868, acyl-CoA synthetase; Validated	1e-19
PRK13382		537	PRK13382, PRK13382, acyl-CoA synthetase; Provision	1e-18
cd05970		537	cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA s	2e-18
cd05940		444	cd05940, FATP_FACS, Fatty acid transport proteins	3e-18
PRK12583		558	PRK12583, PRK12583, acyl-CoA synthetase; Provision	3e-18
cd05939		474	cd05939, hsFATP4_like, Fatty acid transport protei	4e-18
PRK13391		511	PRK13391, PRK13391, acyl-CoA synthetase; Provision	5e-18
PRK08279		600	PRK08279, PRK08279, long-chain-acyl-CoA synthetase	1e-17
cd05926		345	cd05926, FACL_fum10p_like, Subfamily of fatty acid	8e-17
PRK06178		567	PRK06178, PRK06178, acyl-CoA synthetase; Validated	9e-17
cd05929		342	cd05929, BACL_like, Bacterial Bile acid CoA ligase	1e-16
cd05938		535	cd05938, hsFATP2a_ACSVL_like, Fatty acid transport	2e-16
cd05938		535	cd05938, hsFATP2a_ACSVL_like, Fatty acid transport	2e-16
COG1020		642	COG1020, EntF, Non-ribosomal peptide synthetase mo	4e-16
cd05907		456	cd05907, VL_LC_FACS_like, Long-chain fatty acid Co	6e-16
cd05959		506	cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and	7e-16
cd05917		347	cd05917, FACL_like_2, Uncharacterized subfamily of	8e-16
cd05932		504	cd05932, LC_FACS_bac, Bacterial long-chain fatty a	9e-16
TIGR01923		436	TIGR01923, menE, O-succinylbenzoate-CoA ligase	1e-15
cd05940		444	cd05940, FATP_FACS, Fatty acid transport proteins	2e-15
COG1022		613	COG1022, FAA1, Long-chain acyl-CoA synthetases (AM	5e-15
PRK06087		547	PRK06087, PRK06087, short chain acyl-CoA synthetas	5e-15
cd05938		535	cd05938, hsFATP2a_ACSVL_like, Fatty acid transport	6e-15
TIGR03098		517	TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-form	6e-15
cd05903		437	cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li	6e-15
cd05904		504	cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL)	1e-14
cd05937		468	cd05937, FATP_chFAT1_like, Uncharacterized subfami	2e-14
PRK08315		559	PRK08315, PRK08315, AMP-binding domain protein; Va	3e-14
PRK08314		546	PRK08314, PRK08314, long-chain-fatty-acid--CoA lig	7e-14
cd12118		520	cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt	2e-13
PRK06164		540	PRK06164, PRK06164, acyl-CoA synthetase; Validated	4e-13
cd05971		439	cd05971, MACS_like_3, Uncharacterized subfamily of	5e-13
PRK06145		497	PRK06145, PRK06145, acyl-CoA synthetase; Validated	7e-13
cd05923		495	cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL)	8e-13
PRK07786		542	PRK07786, PRK07786, long-chain-fatty-acid--CoA lig	2e-12
PRK09029		458	PRK09029, PRK09029, O-succinylbenzoic acid--CoA li	2e-12
COG1021		542	COG1021, EntE, Peptide arylation enzymes [Secondar	2e-12
TIGR02275		526	TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP	4e-12
PRK13390		501	PRK13390, PRK13390, acyl-CoA synthetase; Provision	7e-12
PRK06188		524	PRK06188, PRK06188, acyl-CoA synthetase; Validated	7e-12
cd05919		436	cd05919, BCL_like, Benzoate CoA ligase (BCL) and s	8e-12
cd05941		430	cd05941, MCS, Malonyl-CoA synthetase (MCS)	1e-11
PLN02246		537	PLN02246, PLN02246, 4-coumarate--CoA ligase	2e-11
cd05906		560	cd05906, A_NRPS_TubE_like, The adenylation domain	3e-11
cd05909		489	cd05909, AAS_C, C-terminal domain of the acyl-acyl	8e-11
PRK07470		528	PRK07470, PRK07470, acyl-CoA synthetase; Validated	8e-11
cd05918		447	cd05918, A_NRPS_SidN3_like, The adenylation (A) do	9e-11
PRK07514		504	PRK07514, PRK07514, malonyl-CoA synthase; Validate	9e-11
cd05912		407	cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase	2e-10
PRK13295		547	PRK13295, PRK13295, cyclohexanecarboxylate-CoA lig	2e-10
cd05937		468	cd05937, FATP_chFAT1_like, Uncharacterized subfami	4e-10
cd05912		407	cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase	4e-10
cd05931		547	cd05931, FAAL, Fatty acyl-AMP ligase (FAAL)	4e-10
PRK05852		534	PRK05852, PRK05852, acyl-CoA synthetase; Validated	1e-09
cd12117		474	cd12117, A_NRPS_Srf_like, The adenylation domain o	1e-09
PRK05605		573	PRK05605, PRK05605, long-chain-fatty-acid--CoA lig	2e-09
PRK09274		552	PRK09274, PRK09274, peptide synthase; Provisional	4e-09
cd05972		430	cd05972, MACS_like, Medium-chain acyl-CoA syntheta	5e-09
cd05941		430	cd05941, MCS, Malonyl-CoA synthetase (MCS)	6e-09
PRK05857		540	PRK05857, PRK05857, acyl-CoA synthetase; Validated	9e-09
cd12119		517	cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth	1e-08
PRK12467		3956	PRK12467, PRK12467, peptide synthase; Provisional	2e-08
cd05914		448	cd05914, FACL_like_3, Uncharacterized subfamily of	2e-08
cd05927		539	cd05927, LC-FACS_euk, Eukaryotic long-chain fatty	2e-08
PRK05691		4334	PRK05691, PRK05691, peptide synthase; Validated	7e-08
PRK07638		487	PRK07638, PRK07638, acyl-CoA synthetase; Validated	7e-08
cd05943		616	cd05943, AACS, Acetoacetyl-CoA synthetase (acetoac	8e-08
TIGR01217		652	TIGR01217, ac_ac_CoA_syn, acetoacetyl-CoA synthase	1e-07
PLN02574		560	PLN02574, PLN02574, 4-coumarate--CoA ligase-like	1e-07
cd05935		430	cd05935, LC_FACS_like, Putative long-chain fatty a	2e-07
cd05935		430	cd05935, LC_FACS_like, Putative long-chain fatty a	3e-07
PRK12406		509	PRK12406, PRK12406, long-chain-fatty-acid--CoA lig	3e-07
PRK12582		624	PRK12582, PRK12582, acyl-CoA synthetase; Provision	4e-07
PRK03584		655	PRK03584, PRK03584, acetoacetyl-CoA synthetase; Pr	4e-07
PLN02860		563	PLN02860, PLN02860, o-succinylbenzoate-CoA ligase	5e-07
PRK07529		632	PRK07529, PRK07529, AMP-binding domain protein; Va	6e-07
cd05922		350	cd05922, FACL_like_6, Uncharacterized subfamily of	6e-07
cd05974		433	cd05974, MACS_like_1, Uncharacterized subfamily of	6e-07
cd12114		476	cd12114, A_NRPS_TlmIV_like, The adenylation domain	6e-07
PRK09192		579	PRK09192, PRK09192, acyl-CoA synthetase; Validated	6e-07
PLN02387		696	PLN02387, PLN02387, long-chain-fatty-acid-CoA liga	7e-07
TIGR01734		502	TIGR01734, D-ala-DACP-lig, D-alanine--poly(phospho	8e-07
cd05937		468	cd05937, FATP_chFAT1_like, Uncharacterized subfami	9e-07
PLN03102		579	PLN03102, PLN03102, acyl-activating enzyme; Provis	1e-06
TIGR02262		508	TIGR02262, benz_CoA_lig, benzoate-CoA ligase famil	1e-06
cd05928		530	cd05928, MACS_euk, Eukaryotic Medium-chain acyl-Co	2e-06
cd05915		509	cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetase	2e-06
cd05930		445	cd05930, A_NRPS, The adenylation domain of nonribo	2e-06
cd05968		474	cd05968, AACS_like, Uncharacterized acyl-CoA synth	2e-06
TIGR03208		538	TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate	3e-06
TIGR03205		541	TIGR03205, pimA, dicarboxylate--CoA ligase PimA	4e-06
cd05972		430	cd05972, MACS_like, Medium-chain acyl-CoA syntheta	5e-06
cd05910		455	cd05910, FACL_like_1, Uncharacterized subfamily of	5e-06
TIGR01733		409	TIGR01733, AA-adenyl-dom, amino acid adenylation d	6e-06
PRK08751		560	PRK08751, PRK08751, putative long-chain fatty acyl	7e-06
PRK12316		5163	PRK12316, PRK12316, peptide synthase; Provisional	1e-05
PRK06710		563	PRK06710, PRK06710, long-chain-fatty-acid--CoA lig	1e-05
PRK06018		542	PRK06018, PRK06018, putative acyl-CoA synthetase;	2e-05
PLN02736		651	PLN02736, PLN02736, long-chain acyl-CoA synthetase	3e-05
cd05922		350	cd05922, FACL_like_6, Uncharacterized subfamily of	4e-05
PRK12467		3956	PRK12467, PRK12467, peptide synthase; Provisional	7e-05
cd04433		338	cd04433, AFD_class_I, Adenylate forming domain, Cl	8e-05
cd05933		594	cd05933, ACSBG_like, Bubblegum-like very long-chai	8e-05
PRK12467		3956	PRK12467, PRK12467, peptide synthase; Provisional	9e-05
PRK12316		5163	PRK12316, PRK12316, peptide synthase; Provisional	1e-04
PRK10946		536	PRK10946, entE, enterobactin synthase subunit E; P	1e-04
PRK05620		576	PRK05620, PRK05620, long-chain-fatty-acid--CoA lig	2e-04
PRK09088		488	PRK09088, PRK09088, acyl-CoA synthetase; Validated	2e-04
cd05973		440	cd05973, MACS_like_2, Uncharacterized subfamily of	2e-04
PRK12316		5163	PRK12316, PRK12316, peptide synthase; Provisional	3e-04
cd12116		438	cd12116, A_NRPS_Ta1_like, The adenylation domain o	3e-04
PRK13383		516	PRK13383, PRK13383, acyl-CoA synthetase; Provision	9e-04
cd05969		443	cd05969, MACS_like_4, Uncharacterized subfamily of	0.001
PRK10252		1296	PRK10252, entF, enterobactin synthase subunit F; P	0.001
pfam00501		412	pfam00501, AMP-binding, AMP-binding enzyme	0.002
PRK06060		705	PRK06060, PRK06060, acyl-CoA synthetase; Validated	0.002
PRK06814		1140	PRK06814, PRK06814, acylglycerophosphoethanolamine	0.002
TIGR03443		1389	TIGR03443, alpha_am_amid, L-aminoadipate-semialdeh	0.002
PRK04813		503	PRK04813, PRK04813, D-alanine--poly(phosphoribitol	0.002
cd05973		440	cd05973, MACS_like_2, Uncharacterized subfamily of	0.003
cd05921		559	cd05921, FCS, Feruloyl-CoA synthetase (FCS)	0.003
cd05958		487	cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL)	0.003
TIGR02188		625	TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase	0.004
cd05966		602	cd05966, ACS, Acetyl-CoA synthetase (also known as	0.004

>gnl\|CDD\|213305 cd05939, hsFATP4_like, Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins	Back alignment and domain information

 Score =  397 bits (1021), Expect = e-133
 Identities = 166/337 (49%), Positives = 204/337 (60%), Gaps = 45/337 (13%)

Query: 231 NTEWTAQQVEAYSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINH 290
           +  WT +++  YSN+VANFF AQG + GD VAL +ENR EFV LWLGL+K+GV TALIN 
Sbjct: 1   DRHWTFRELNEYSNKVANFFQAQGYRSGDVVALFMENRLEFVALWLGLAKIGVETALINS 60

Query: 291 NLRQNSLLHCINIAGVSAFIYGAELTDAVQEISTSLGSNVKLFSWSPDTDSSSSPVPRSQ 350
           NLR  SLLHCI ++   A I+                                       
Sbjct: 61  NLRLESLLHCITVSKAKALIF--------------------------------------N 82

Query: 351 ALSPLLSEVPTSPPSLSYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYFLGGAIAYQIG 410
            L PLL++  T PPS    V  +DKL YIYTSGTTGLPKAAVI + RYY +     Y  G
Sbjct: 83  LLDPLLTQSSTEPPSQD-DVNFRDKLFYIYTSGTTGLPKAAVIVHSRYYRIAAGAYYAFG 141

Query: 411 FRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKKFSASNYFSDVCKYKCTVGQYIG 470
            R +D  Y  LPLYH+AGG M +GQAL+ G  VVIRKKFSASN++ D  KY CT+ QYIG
Sbjct: 142 MRPEDVVYDCLPLYHSAGGIMGVGQALLHGSTVVIRKKFSASNFWDDCVKYNCTIVQYIG 201

Query: 471 EMCRYLLSTPEKPEDKAHNVRLMFGNGLRPQIWSEFVDRFRIAQIGEFYGATEGMAAILD 530
           E+CRYLL+ P   E++ HNVRL  GNGLRPQIW +FV RF I QIGEFYGATEG +++++
Sbjct: 202 EICRYLLAQPPSEEEQKHNVRLAVGNGLRPQIWEQFVRRFGIPQIGEFYGATEGNSSLVN 261

Query: 531 INKSLDVSAVSEGIKKALPSYARPLFIRCLREVEMTG 567
           I+    V A   G    +     P  IR ++  E TG
Sbjct: 262 IDNH--VGAC--GFNSRILPSVYP--IRLIKVDEDTG 292

Fatty acid transport protein (FATP) transports long-chain or very-long-chain fatty acids across the plasma membrane. At least five copies of FATPs are identified in mammalian cells. This family includes FATP4, FATP1, and homologous proteins. Each FATP has unique patterns of tissue distribution. FATP4 is mainly expressed in the brain, testis, colon and kidney. FATPs also have fatty acid CoA synthetase activity, thus playing dual roles as fatty acid transporters and its activation enzymes. FATPs are the key players in the trafficking of exogenous fatty acids into the cell and in intracellular fatty acid homeostasis. Length = 474

>gnl\|CDD\|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213304 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins	Back alignment and domain information

>gnl\|CDD\|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes	Back alignment and domain information

>gnl\|CDD\|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi	Back alignment and domain information

>gnl\|CDD\|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL)	Back alignment and domain information

>gnl\|CDD\|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|235719 PRK06155, PRK06155, crotonobetaine/carnitine-CoA ligase; Provisional	Back alignment and domain information

>gnl\|CDD\|215954 pfam00501, AMP-binding, AMP-binding enzyme	Back alignment and domain information

>gnl\|CDD\|213305 cd05939, hsFATP4_like, Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins	Back alignment and domain information

>gnl\|CDD\|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated	Back alignment and domain information

>gnl\|CDD\|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>gnl\|CDD\|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD	Back alignment and domain information

>gnl\|CDD\|237374 PRK13388, PRK13388, acyl-CoA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|213305 cd05939, hsFATP4_like, Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins	Back alignment and domain information

>gnl\|CDD\|236120 PRK07867, PRK07867, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism]	Back alignment and domain information

>gnl\|CDD\|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL)	Back alignment and domain information

>gnl\|CDD\|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase	Back alignment and domain information

>gnl\|CDD\|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I	Back alignment and domain information

>gnl\|CDD\|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>gnl\|CDD\|236100 PRK07798, PRK07798, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional	Back alignment and domain information

>gnl\|CDD\|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>gnl\|CDD\|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes	Back alignment and domain information

>gnl\|CDD\|236121 PRK07868, PRK07868, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|172019 PRK13382, PRK13382, acyl-CoA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|213317 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like	Back alignment and domain information

>gnl\|CDD\|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes	Back alignment and domain information

>gnl\|CDD\|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|213305 cd05939, hsFATP4_like, Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins	Back alignment and domain information

>gnl\|CDD\|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis	Back alignment and domain information

>gnl\|CDD\|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins	Back alignment and domain information

>gnl\|CDD\|213304 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins	Back alignment and domain information

>gnl\|CDD\|213304 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins	Back alignment and domain information

>gnl\|CDD\|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases	Back alignment and domain information

>gnl\|CDD\|213312 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase)	Back alignment and domain information

>gnl\|CDD\|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL)	Back alignment and domain information

>gnl\|CDD\|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase	Back alignment and domain information

>gnl\|CDD\|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase	Back alignment and domain information

>gnl\|CDD\|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes	Back alignment and domain information

>gnl\|CDD\|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism]	Back alignment and domain information

>gnl\|CDD\|180393 PRK06087, PRK06087, short chain acyl-CoA synthetase; Reviewed	Back alignment and domain information

>gnl\|CDD\|213304 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins	Back alignment and domain information

>gnl\|CDD\|211788 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-forming), exosortase A-associated	Back alignment and domain information

>gnl\|CDD\|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase)	Back alignment and domain information

>gnl\|CDD\|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL)	Back alignment and domain information

>gnl\|CDD\|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi	Back alignment and domain information

>gnl\|CDD\|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated	Back alignment and domain information

>gnl\|CDD\|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>gnl\|CDD\|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis	Back alignment and domain information

>gnl\|CDD\|235722 PRK06164, PRK06164, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS)	Back alignment and domain information

>gnl\|CDD\|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213290 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL)	Back alignment and domain information

>gnl\|CDD\|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>gnl\|CDD\|236363 PRK09029, PRK09029, O-succinylbenzoic acid--CoA ligase; Provisional	Back alignment and domain information

>gnl\|CDD\|223952 COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|233807 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP ligase	Back alignment and domain information

>gnl\|CDD\|139538 PRK13390, PRK13390, acyl-CoA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes	Back alignment and domain information

>gnl\|CDD\|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS)	Back alignment and domain information

>gnl\|CDD\|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase	Back alignment and domain information

>gnl\|CDD\|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents	Back alignment and domain information

>gnl\|CDD\|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas)	Back alignment and domain information

>gnl\|CDD\|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS)	Back alignment and domain information

>gnl\|CDD\|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated	Back alignment and domain information

>gnl\|CDD\|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE)	Back alignment and domain information

>gnl\|CDD\|171961 PRK13295, PRK13295, cyclohexanecarboxylate-CoA ligase; Reviewed	Back alignment and domain information

>gnl\|CDD\|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi	Back alignment and domain information

>gnl\|CDD\|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE)	Back alignment and domain information

>gnl\|CDD\|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL)	Back alignment and domain information

>gnl\|CDD\|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C)	Back alignment and domain information

>gnl\|CDD\|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>gnl\|CDD\|236443 PRK09274, PRK09274, peptide synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM)	Back alignment and domain information

>gnl\|CDD\|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS)	Back alignment and domain information

>gnl\|CDD\|180293 PRK05857, PRK05857, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles	Back alignment and domain information

>gnl\|CDD\|237108 PRK12467, PRK12467, peptide synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|213282 cd05914, FACL_like_3, Uncharacterized subfamily of fatty acid CoA ligase (FACL)	Back alignment and domain information

>gnl\|CDD\|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS)	Back alignment and domain information

>gnl\|CDD\|235564 PRK05691, PRK05691, peptide synthase; Validated	Back alignment and domain information

>gnl\|CDD\|236071 PRK07638, PRK07638, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213308 cd05943, AACS, Acetoacetyl-CoA synthetase (acetoacetate-CoA ligase, AACS)	Back alignment and domain information

>gnl\|CDD\|233316 TIGR01217, ac_ac_CoA_syn, acetoacetyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like	Back alignment and domain information

>gnl\|CDD\|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase	Back alignment and domain information

>gnl\|CDD\|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase	Back alignment and domain information

>gnl\|CDD\|183506 PRK12406, PRK12406, long-chain-fatty-acid--CoA ligase; Provisional	Back alignment and domain information

>gnl\|CDD\|237144 PRK12582, PRK12582, acyl-CoA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|235134 PRK03584, PRK03584, acetoacetyl-CoA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|215464 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase	Back alignment and domain information

>gnl\|CDD\|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated	Back alignment and domain information

>gnl\|CDD\|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL)	Back alignment and domain information

>gnl\|CDD\|213321 cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS)	Back alignment and domain information

>gnl\|CDD\|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes	Back alignment and domain information

>gnl\|CDD\|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|215217 PLN02387, PLN02387, long-chain-fatty-acid-CoA ligase family protein	Back alignment and domain information

>gnl\|CDD\|233551 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phosphoribitol) ligase, subunit 1	Back alignment and domain information

>gnl\|CDD\|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi	Back alignment and domain information

>gnl\|CDD\|215576 PLN03102, PLN03102, acyl-activating enzyme; Provisional	Back alignment and domain information

>gnl\|CDD\|233803 TIGR02262, benz_CoA_lig, benzoate-CoA ligase family	Back alignment and domain information

>gnl\|CDD\|213294 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM)	Back alignment and domain information

>gnl\|CDD\|213283 cd05915, ttLC_FACS_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles	Back alignment and domain information

>gnl\|CDD\|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS)	Back alignment and domain information

>gnl\|CDD\|213315 cd05968, AACS_like, Uncharacterized acyl-CoA synthetase subfamily similar to Acetoacetyl-CoA synthetase	Back alignment and domain information

>gnl\|CDD\|132252 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate-CoA ligase	Back alignment and domain information

>gnl\|CDD\|132249 TIGR03205, pimA, dicarboxylate--CoA ligase PimA	Back alignment and domain information

>gnl\|CDD\|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM)	Back alignment and domain information

>gnl\|CDD\|213278 cd05910, FACL_like_1, Uncharacterized subfamily of fatty acid CoA ligase (FACL)	Back alignment and domain information

>gnl\|CDD\|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain	Back alignment and domain information

>gnl\|CDD\|181546 PRK08751, PRK08751, putative long-chain fatty acyl CoA ligase; Provisional	Back alignment and domain information

>gnl\|CDD\|237054 PRK12316, PRK12316, peptide synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>gnl\|CDD\|235673 PRK06018, PRK06018, putative acyl-CoA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase	Back alignment and domain information

>gnl\|CDD\|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL)	Back alignment and domain information

>gnl\|CDD\|237108 PRK12467, PRK12467, peptide synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I	Back alignment and domain information

>gnl\|CDD\|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS)	Back alignment and domain information

>gnl\|CDD\|237108 PRK12467, PRK12467, peptide synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|237054 PRK12316, PRK12316, peptide synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|236803 PRK10946, entE, enterobactin synthase subunit E; Provisional	Back alignment and domain information

>gnl\|CDD\|180167 PRK05620, PRK05620, long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>gnl\|CDD\|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS)	Back alignment and domain information

>gnl\|CDD\|237054 PRK12316, PRK12316, peptide synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase	Back alignment and domain information

>gnl\|CDD\|139531 PRK13383, PRK13383, acyl-CoA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS)	Back alignment and domain information

>gnl\|CDD\|236668 PRK10252, entF, enterobactin synthase subunit F; Provisional	Back alignment and domain information

>gnl\|CDD\|215954 pfam00501, AMP-binding, AMP-binding enzyme	Back alignment and domain information

>gnl\|CDD\|180374 PRK06060, PRK06060, acyl-CoA synthetase; Validated	Back alignment and domain information

>gnl\|CDD\|235865 PRK06814, PRK06814, acylglycerophosphoethanolamine acyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase	Back alignment and domain information

>gnl\|CDD\|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional	Back alignment and domain information

>gnl\|CDD\|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS)	Back alignment and domain information

>gnl\|CDD\|213288 cd05921, FCS, Feruloyl-CoA synthetase (FCS)	Back alignment and domain information

>gnl\|CDD\|213311 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL)	Back alignment and domain information

>gnl\|CDD\|233770 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase	Back alignment and domain information

>gnl\|CDD\|213313 cd05966, ACS, Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		617
PRK12467		3956	peptide synthase; Provisional	100.0
PRK12467		3956	peptide synthase; Provisional	100.0
PRK12316		5163	peptide synthase; Provisional	100.0
PRK10252		1296	entF enterobactin synthase subunit F; Provisional	100.0
PRK05691		4334	peptide synthase; Validated	100.0
PRK05691		4334	peptide synthase; Validated	100.0
PRK12316		5163	peptide synthase; Provisional	100.0
TIGR03443		1389	alpha_am_amid L-aminoadipate-semialdehyde dehydrog	100.0
COG1020		642	EntF Non-ribosomal peptide synthetase modules and	100.0
KOG1177\|consensus		596		100.0
COG0318		534	CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l	100.0
KOG1176\|consensus		537		100.0
KOG1179\|consensus		649		100.0
PRK07788		549	acyl-CoA synthetase; Validated	100.0
PLN02736		651	long-chain acyl-CoA synthetase	100.0
PLN02860		563	o-succinylbenzoate-CoA ligase	100.0
PTZ00342		746	acyl-CoA synthetase; Provisional	100.0
PRK06334		539	long chain fatty acid--[acyl-carrier-protein] liga	100.0
PLN02861		660	long-chain-fatty-acid-CoA ligase	100.0
PLN02614		666	long-chain acyl-CoA synthetase	100.0
PRK08279		600	long-chain-acyl-CoA synthetase; Validated	100.0
COG0365		528	Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l	100.0
TIGR02316		628	propion_prpE propionate--CoA ligase. This family c	100.0
PRK07529		632	AMP-binding domain protein; Validated	100.0
PTZ00216		700	acyl-CoA synthetase; Provisional	100.0
PLN02654		666	acetate-CoA ligase	100.0
TIGR02188		625	Ac_CoA_lig_AcsA acetate--CoA ligase. This model de	100.0
PRK00174		637	acetyl-CoA synthetase; Provisional	100.0
PRK13382		537	acyl-CoA synthetase; Provisional	100.0
PRK13295		547	cyclohexanecarboxylate-CoA ligase; Reviewed	100.0
PRK07868		994	acyl-CoA synthetase; Validated	100.0
PRK06060		705	acyl-CoA synthetase; Validated	100.0
PLN02246		537	4-coumarate--CoA ligase	100.0
COG1021		542	EntE Peptide arylation enzymes [Secondary metaboli	100.0
PTZ00237		647	acetyl-CoA synthetase; Provisional	100.0
PLN03052		728	acetate--CoA ligase; Provisional	100.0
PRK07656		513	long-chain-fatty-acid--CoA ligase; Validated	100.0
PLN02387		696	long-chain-fatty-acid-CoA ligase family protein	100.0
PRK08043		718	bifunctional acyl-[acyl carrier protein] synthetas	100.0
PRK08314		546	long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK08180		614	feruloyl-CoA synthase; Reviewed	100.0
PRK06155		542	crotonobetaine/carnitine-CoA ligase; Provisional	100.0
COG1022		613	FAA1 Long-chain acyl-CoA synthetases (AMP-forming)	100.0
PRK13388		540	acyl-CoA synthetase; Provisional	100.0
PRK10524		629	prpE propionyl-CoA synthetase; Provisional	100.0
TIGR03208		538	cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase.	100.0
PF00501		417	AMP-binding: AMP-binding enzyme; InterPro: IPR0008	100.0
PRK03584		655	acetoacetyl-CoA synthetase; Provisional	100.0
PRK09274		552	peptide synthase; Provisional	100.0
PLN03102		579	acyl-activating enzyme; Provisional	100.0
PRK04319		570	acetyl-CoA synthetase; Provisional	100.0
PRK07638		487	acyl-CoA synthetase; Validated	100.0
TIGR02275		527	DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot	100.0
PRK06187		521	long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK07769		631	long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK08008		517	caiC putative crotonobetaine/carnitine-CoA ligase;	100.0
PRK06839		496	acyl-CoA synthetase; Validated	100.0
PRK05852		534	acyl-CoA synthetase; Validated	100.0
PLN02430		660	long-chain-fatty-acid-CoA ligase	100.0
PLN02574		560	4-coumarate--CoA ligase-like	100.0
PRK06145		497	acyl-CoA synthetase; Validated	100.0
PRK07867		529	acyl-CoA synthetase; Validated	100.0
PRK12582		624	acyl-CoA synthetase; Provisional	100.0
PRK08316		523	acyl-CoA synthetase; Validated	100.0
PRK05605		573	long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK03640		483	O-succinylbenzoic acid--CoA ligase; Provisional	100.0
PRK05857		540	acyl-CoA synthetase; Validated	100.0
PRK08315		559	AMP-binding domain protein; Validated	100.0
PRK06087		547	short chain acyl-CoA synthetase; Reviewed	100.0
TIGR03098		515	ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor	100.0
PLN02330		546	4-coumarate--CoA ligase-like 1	100.0
PRK07514		504	malonyl-CoA synthase; Validated	100.0
PRK12583		558	acyl-CoA synthetase; Provisional	100.0
TIGR01217		652	ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym	100.0
PRK05851		525	long-chain-fatty-acid--[acyl-carrier-protein] liga	100.0
PRK05677		562	long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK07008		539	long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK06018		542	putative acyl-CoA synthetase; Provisional	100.0
PRK12476		612	putative fatty-acid--CoA ligase; Provisional	100.0
PRK07470		528	acyl-CoA synthetase; Validated	100.0
PRK08633		1146	2-acyl-glycerophospho-ethanolamine acyltransferase	100.0
PRK06188		524	acyl-CoA synthetase; Validated	100.0
PRK05620		576	long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK07786		542	long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK06814		1140	acylglycerophosphoethanolamine acyltransferase; Pr	100.0
PRK07798		533	acyl-CoA synthetase; Validated	100.0
PRK10946		536	entE enterobactin synthase subunit E; Provisional	100.0
PRK13383		516	acyl-CoA synthetase; Provisional	100.0
KOG1256\|consensus		691		100.0
PRK06164		540	acyl-CoA synthetase; Validated	100.0
TIGR02262		508	benz_CoA_lig benzoate-CoA ligase family. Character	100.0
TIGR03205		541	pimA dicarboxylate--CoA ligase PimA. PimA, a membe	100.0
PRK06178		567	acyl-CoA synthetase; Validated	100.0
PRK12492		562	long-chain-fatty-acid--CoA ligase; Provisional	100.0
PRK08162		545	acyl-CoA synthetase; Validated	100.0
PRK09088		488	acyl-CoA synthetase; Validated	100.0
TIGR01734		502	D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig	100.0
PLN02479		567	acetate-CoA ligase	100.0
PRK07059		557	Long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK08751		560	putative long-chain fatty acyl CoA ligase; Provisi	100.0
PRK05850		578	acyl-CoA synthetase; Validated	100.0
PRK06710		563	long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK08308		414	acyl-CoA synthetase; Validated	100.0
PRK07787		471	acyl-CoA synthetase; Validated	100.0
PRK04813		503	D-alanine--poly(phosphoribitol) ligase subunit 1;	100.0
PRK08974		560	long-chain-fatty-acid--CoA ligase; Validated	100.0
PRK13390		501	acyl-CoA synthetase; Provisional	100.0
PRK13391		511	acyl-CoA synthetase; Provisional	100.0
PRK09029		458	O-succinylbenzoic acid--CoA ligase; Provisional	100.0
PRK07445		452	O-succinylbenzoic acid--CoA ligase; Reviewed	100.0
PRK09192		579	acyl-CoA synthetase; Validated	100.0
PRK12406		509	long-chain-fatty-acid--CoA ligase; Provisional	100.0
PRK08276		502	long-chain-fatty-acid--CoA ligase; Validated	100.0
KOG1180\|consensus		678		100.0
PRK07768		545	long-chain-fatty-acid--CoA ligase; Validated	100.0
PLN03051		499	acyl-activating enzyme; Provisional	100.0
TIGR01733		408	AA-adenyl-dom amino acid adenylation domain. This	100.0
TIGR01923		436	menE O-succinylbenzoate-CoA ligase. This model rep	100.0
KOG1175\|consensus		626		100.0
PTZ00297		1452	pantothenate kinase; Provisional	100.0
TIGR02372		386	4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv	99.96
TIGR03089		227	conserved hypothetical protein TIGR03089. This pro	99.96
PRK07824		358	O-succinylbenzoic acid--CoA ligase; Provisional	99.95
KOG1178\|consensus		1032		99.91
TIGR02155		422	PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet	99.91
TIGR03335		445	F390_ftsA coenzyme F390 synthetase. This enzyme, c	99.84
KOG3628\|consensus		1363		99.63
COG1541		438	PaaK Coenzyme F390 synthetase [Coenzyme metabolism	99.57
TIGR02304		430	aden_form_hyp probable adenylate-forming enzyme. M	99.19
KOG3628\|consensus		1363		98.75
PF13745		91	HxxPF_rpt: HxxPF-repeated domain; PDB: 2JGP_A.	98.5
KOG1179\|consensus		649		98.45
PF04443		365	LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR	98.14
KOG1176\|consensus		537		98.09
PRK07656		513	long-chain-fatty-acid--CoA ligase; Validated	98.08
COG0318		534	CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l	98.04
PRK08315		559	AMP-binding domain protein; Validated	98.0
PRK12583		558	acyl-CoA synthetase; Provisional	97.96
PRK04319		570	acetyl-CoA synthetase; Provisional	97.88
TIGR01923		436	menE O-succinylbenzoate-CoA ligase. This model rep	97.88
TIGR03098		515	ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor	97.86
KOG1177\|consensus		596		97.85
PRK06187		521	long-chain-fatty-acid--CoA ligase; Validated	97.83
PRK06839		496	acyl-CoA synthetase; Validated	97.82
PRK08308		414	acyl-CoA synthetase; Validated	97.81
PRK07868		994	acyl-CoA synthetase; Validated	97.81
PRK06334		539	long chain fatty acid--[acyl-carrier-protein] liga	97.74
PRK13295		547	cyclohexanecarboxylate-CoA ligase; Reviewed	97.72
PLN02860		563	o-succinylbenzoate-CoA ligase	97.72
PRK03640		483	O-succinylbenzoic acid--CoA ligase; Provisional	97.7
TIGR02275		527	DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot	97.66
PRK06164		540	acyl-CoA synthetase; Validated	97.6
PRK06188		524	acyl-CoA synthetase; Validated	97.59
PRK09188		365	serine/threonine protein kinase; Provisional	97.58
PRK08316		523	acyl-CoA synthetase; Validated	97.53
COG1021		542	EntE Peptide arylation enzymes [Secondary metaboli	97.5
PRK10252		1296	entF enterobactin synthase subunit F; Provisional	97.5
PRK07824		358	O-succinylbenzoic acid--CoA ligase; Provisional	97.49
PRK07445		452	O-succinylbenzoic acid--CoA ligase; Reviewed	97.49
PRK07788		549	acyl-CoA synthetase; Validated	97.46
PRK08279		600	long-chain-acyl-CoA synthetase; Validated	97.43
PRK06814		1140	acylglycerophosphoethanolamine acyltransferase; Pr	97.41
PRK08633		1146	2-acyl-glycerophospho-ethanolamine acyltransferase	97.35
PRK07638		487	acyl-CoA synthetase; Validated	97.35
PRK05677		562	long-chain-fatty-acid--CoA ligase; Validated	97.25
PRK06155		542	crotonobetaine/carnitine-CoA ligase; Provisional	97.23
PRK07787		471	acyl-CoA synthetase; Validated	97.22
PF13193		73	AMP-binding_C: AMP-binding enzyme C-terminal domai	97.18
PRK13382		537	acyl-CoA synthetase; Provisional	97.16
PRK08314		546	long-chain-fatty-acid--CoA ligase; Validated	97.15
TIGR02372		386	4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv	97.12
PRK06060		705	acyl-CoA synthetase; Validated	97.1
PRK07470		528	acyl-CoA synthetase; Validated	97.05
PRK05852		534	acyl-CoA synthetase; Validated	97.05
PRK07798		533	acyl-CoA synthetase; Validated	97.04
PRK07867		529	acyl-CoA synthetase; Validated	97.0
TIGR01217		652	ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym	97.0
PRK07529		632	AMP-binding domain protein; Validated	96.99
PRK03584		655	acetoacetyl-CoA synthetase; Provisional	96.96
PRK05620		576	long-chain-fatty-acid--CoA ligase; Validated	96.96
PRK13388		540	acyl-CoA synthetase; Provisional	96.95
PRK00174		637	acetyl-CoA synthetase; Provisional	96.94
PRK06145		497	acyl-CoA synthetase; Validated	96.94
PLN02246		537	4-coumarate--CoA ligase	96.94
PRK08751		560	putative long-chain fatty acyl CoA ligase; Provisi	96.89
PLN02574		560	4-coumarate--CoA ligase-like	96.88
PRK07008		539	long-chain-fatty-acid--CoA ligase; Validated	96.87
PRK08043		718	bifunctional acyl-[acyl carrier protein] synthetas	96.85
PRK06710		563	long-chain-fatty-acid--CoA ligase; Validated	96.85
PLN02654		666	acetate-CoA ligase	96.83
PRK06018		542	putative acyl-CoA synthetase; Provisional	96.81
PLN03102		579	acyl-activating enzyme; Provisional	96.81
PRK09029		458	O-succinylbenzoic acid--CoA ligase; Provisional	96.8
TIGR02316		628	propion_prpE propionate--CoA ligase. This family c	96.8
PRK09088		488	acyl-CoA synthetase; Validated	96.79
TIGR02188		625	Ac_CoA_lig_AcsA acetate--CoA ligase. This model de	96.78
PRK13390		501	acyl-CoA synthetase; Provisional	96.77
PRK09188		365	serine/threonine protein kinase; Provisional	96.77
PRK12406		509	long-chain-fatty-acid--CoA ligase; Provisional	96.77
PRK05605		573	long-chain-fatty-acid--CoA ligase; Validated	96.73
PRK10946		536	entE enterobactin synthase subunit E; Provisional	96.71
PLN03051		499	acyl-activating enzyme; Provisional	96.71
PLN02330		546	4-coumarate--CoA ligase-like 1	96.7
PRK10524		629	prpE propionyl-CoA synthetase; Provisional	96.69
PRK07059		557	Long-chain-fatty-acid--CoA ligase; Validated	96.69
PRK07514		504	malonyl-CoA synthase; Validated	96.67
PRK12492		562	long-chain-fatty-acid--CoA ligase; Provisional	96.67
TIGR01734		502	D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig	96.65
PRK07786		542	long-chain-fatty-acid--CoA ligase; Validated	96.62
PTZ00237		647	acetyl-CoA synthetase; Provisional	96.62
PRK08008		517	caiC putative crotonobetaine/carnitine-CoA ligase;	96.58
TIGR03208		538	cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase.	96.56
PRK08974		560	long-chain-fatty-acid--CoA ligase; Validated	96.48
PRK04813		503	D-alanine--poly(phosphoribitol) ligase subunit 1;	96.46
PRK06087		547	short chain acyl-CoA synthetase; Reviewed	96.4
PRK06178		567	acyl-CoA synthetase; Validated	96.32
PRK08276		502	long-chain-fatty-acid--CoA ligase; Validated	96.32
TIGR03443		1389	alpha_am_amid L-aminoadipate-semialdehyde dehydrog	96.29
PRK13383		516	acyl-CoA synthetase; Provisional	96.17
TIGR03205		541	pimA dicarboxylate--CoA ligase PimA. PimA, a membe	96.16
PRK13391		511	acyl-CoA synthetase; Provisional	96.13
PF00668		301	Condensation: Condensation domain; InterPro: IPR00	96.03
KOG1175\|consensus		626		95.99
PRK05857		540	acyl-CoA synthetase; Validated	95.99
PF03321		528	GH3: GH3 auxin-responsive promoter; InterPro: IPR0	95.99
PRK05851		525	long-chain-fatty-acid--[acyl-carrier-protein] liga	95.98
PRK08162		545	acyl-CoA synthetase; Validated	95.9
PLN03052		728	acetate--CoA ligase; Provisional	95.66
PLN02249		597	indole-3-acetic acid-amido synthetase	95.59
COG0365		528	Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l	95.55
TIGR02262		508	benz_CoA_lig benzoate-CoA ligase family. Character	95.42
COG1541		438	PaaK Coenzyme F390 synthetase [Coenzyme metabolism	95.25
PLN02479		567	acetate-CoA ligase	95.03
PRK09274		552	peptide synthase; Provisional	95.0
PRK07769		631	long-chain-fatty-acid--CoA ligase; Validated	94.12
PRK09192		579	acyl-CoA synthetase; Validated	93.26
PRK12476		612	putative fatty-acid--CoA ligase; Provisional	93.09
KOG1178\|consensus		1032		90.61
PLN02736		651	long-chain acyl-CoA synthetase	89.28
TIGR02946		446	acyl_WS_DGAT acyltransferase, WS/DGAT/MGAT. This b	87.57
TIGR02155		422	PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet	86.55
TIGR03335		445	F390_ftsA coenzyme F390 synthetase. This enzyme, c	85.33
PRK07768		545	long-chain-fatty-acid--CoA ligase; Validated	83.61

>PRK12467 peptide synthase; Provisional	Back alignment and domain information

Probab=100.00  E-value=7.9e-74  Score=739.81  Aligned_cols=565  Identities=18%  Similarity=0.162  Sum_probs=458.5

Q ss_pred             ccceeEEEeccCCCccccCCCCCcccCCCCCcceeEEEecCCCCccccccccccccchhhhhhhhhhcCCccc-----cc
Q psy8155          24 IYPISIIRVDPVTSEPIRNKKGLCTRCEPGEPGVFIGKIVPSNPARAYLGYVNEKDSAKKIVTDVFEIGDSAF-----LS   98 (617)
Q Consensus        24 ~~~~~~~~~D~~~G~pva~R~~~~~~~~~~~iG~fvNtl~lr~~~~~~~~f~~ll~~v~~~~~~a~~hqd~Pf-----~~   98 (617)
                      +++.+--+.|+++|+|++||+..++   +++||+|+||||+|++++++.||.++|+++++..+++++||++||     .+
T Consensus      1372 lL~r~sg~~dvv~G~pvsgR~~~~~---~~~vG~fvNtlplR~~~~~~~t~~~~l~~v~~~~~~a~~hq~~p~~~i~~~l 1448 (3956)
T PRK12467       1372 LLHRYSGQDDIRVGVPIANRNRAET---EGLIGFFVNTQVLRAEVDGQASFQQLLQQVKQAALEAQAHQDLPFEQLVEAL 1448 (3956)
T ss_pred             HHHHhhCCCCEEEEecccCCCchhh---hcceeeeeeeeEEEEecCCCCCHHHHHHHHHHHHHHHHhccCCCHHHHHHHh
Confidence            3444567889999999999998777   999999999999999999999999999999999999999999999     77


Q ss_pred             CCCCccccCcCCcccc-----------CCCCccccc-cCCCCCccccccccccccc-----chhhhhhhhhccchhhhcc
Q psy8155          99 DPPKNTTYNKKGLCSR-----------CEPGVFIGK-IVPSNPARAYLGYVNEKDS-----AKKIFTDVFEIGDSAFLSG  161 (617)
Q Consensus        99 ~~~r~~~~~~l~~~~~-----------~~~gl~~~~-~~~~~~~~~dl~~~~~~~~-----~~~~~~~~f~~~~~~~~~~  161 (617)
                      ++.|+.+++|+||+-.           ..+|+.+.. ......++|||++.+.+.+     ..+|.+++|+.++++++..
T Consensus      1449 ~~~r~~~~~pLFq~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dL~l~v~~~~~~l~l~~~y~~~lf~~~~i~~l~~ 1528 (3956)
T PRK12467       1449 QPERSLSHSPLFQVMFNHQRDDHQAQAQLPGLSVESLSWESQTAQFDLTLDTYESSEGLQASLTYATDLFEASTIERLAG 1528 (3956)
T ss_pred             cccccCCCCCceeEEEEeecccccccccCCCceeEeeecCCcccccceEEEEEecCCeEEEEEEEeCCcCCHHHHHHHHH
Confidence            8999999999999711           114444444 3346789999999998755     3599999999999999999


Q ss_pred             cEEEEeccccceeecccCCCcccccHHHHHHHHHHHHHHHHhhccCCCHHHHHHHHHhhCCCceEEEECCceecHHHHHH
Q psy8155         162 DLLVMDKWGYLYFKDRTGDTFPALKSRALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVEA  241 (617)
Q Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~tl~~~~~~~a~~~p~~~Al~~~~~~lTy~eL~~  241 (617)
                      +|..++ ..++.+|..++.+++++++.++++++..|+.+....+...+++++|+++++++|+++|++++++.+||+||++
T Consensus      1529 ~~~~lL-~~l~~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~p~~~Av~~~~~~lTY~eL~~ 1607 (3956)
T PRK12467       1529 HWLNLL-QGLVADPERRLGELDLLDEAERRQILEGWNATHTGYPLARLVHQLIEDQAAATPEAVALVFGEQELTYGELNR 1607 (3956)
T ss_pred             HHHHHH-HHHhhCccCceeeccccchHHhhhhHHhhcCCccCCCccccHHHHHHHHHHhCCCCeEEEeCCcEEeHHHHHH
Confidence            999888 7778899999999999999999999888877766666678999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEEcCCCHHHHHHHHHHHhcCCeEEecCCCCChHHHHHHHHhcCceEEEEccchHHHHHH
Q psy8155         242 YSNRVANFFLAQGLKKGDSVALMLENRPEFVCLWLGLSKLGVITALINHNLRQNSLLHCINIAGVSAFIYGAELTDAVQE  321 (617)
Q Consensus       242 ~a~~lA~~L~~~gv~~g~~V~i~~~~s~~~iva~lA~~~aG~~~vpldp~~p~~~l~~il~~~~~~~vl~~~~~~~~~~~  321 (617)
                      +++++|++|.++|+++|++|+++++||+++++++|||+|+|++||||||.+|.+|+.+++++++++++|++....+.+..
T Consensus      1608 ~a~~lA~~L~~~Gv~~~~~V~l~~~~s~~~vv~~lavlkaG~~~vpldp~~p~~rl~~il~~~~~~~~l~~~~~~~~~~~ 1687 (3956)
T PRK12467       1608 RANRLAHRLIALGVGPEVLVGIAVERSLEMVVGLLAILKAGGAYVPLDPEYPRERLAYMIEDSGIELLLTQSHLQARLPL 1687 (3956)
T ss_pred             HHHHHHHHHHHcCCCCCCEEEEEccCCHHHHHHHHHhhccCceeeecCCCCCHHHHHHHHHhCCCCEEEeChhhhhhCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998765543321


Q ss_pred             HHHhcCCCeEEEEeCCCCCCCCCCCCCcCCcchhhccCCCCCCCCCCCCCCCCeEEEEEccCCCCCCceEEechHHHHHH
Q psy8155         322 ISTSLGSNVKLFSWSPDTDSSSSPVPRSQALSPLLSEVPTSPPSLSYRVGVQDKLIYIYTSGTTGLPKAAVISNHRYYFL  401 (617)
Q Consensus       322 ~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~ii~TSGSTG~PKgV~~sh~~l~~~  401 (617)
                           .....++.++...              ..........  ......++++|||+|||||||+||||+++|+++.+.
T Consensus      1688 -----~~~~~~~~~~~~~--------------~~~~~~~~~~--~~~~~~~~~~ayiiyTSGSTG~PKGV~~th~~l~~~ 1746 (3956)
T PRK12467       1688 -----PDGLRSLVLDQED--------------DWLEGYSDSN--PAVNLAPQNLAYVIYTSGSTGRPKGAGNRHGALVNR 1746 (3956)
T ss_pred             -----ccCCcEEEecccc--------------chhccCCCCC--CCCCCCCcCcEEEEECCCcCCCCCEEEEcCHHHHHH
Confidence                 1122344443211              0011111111  112356899999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCCCEEEEcCcchhhHHHHHHHHHHhHcCcEEEEcCC---CCHHHHHHHHHHcCCcEEeecHHHHHHHHc
Q psy8155         402 GGAIAYQIGFRTKDRFYTPLPLYHTAGGAMCIGQALIFGCCVVIRKK---FSASNYFSDVCKYKCTVGQYIGEMCRYLLS  478 (617)
Q Consensus       402 ~~~~~~~~~~~~~d~~l~~~p~~~~~~~~~~~~~~L~~G~~lvi~~~---~d~~~l~~~i~~~~vt~~~~~P~~~~~l~~  478 (617)
                      +.+....++++++|++++++|++|+.+ ++++|.+|+.|+++++.+.   .|+..+++.|+++++|++.++|++++.|++
T Consensus      1747 ~~~~~~~~~~~~~d~~l~~~~~~fd~~-~~~~~~~L~~G~~lvi~~~~~~~~~~~l~~~i~~~~vt~~~~~Ps~~~~l~~ 1825 (3956)
T PRK12467       1747 LCATQEAYQLSAADVVLQFTSFAFDVS-VWELFWPLINGARLVIAPPGAHRDPEQLIQLIERQQVTTLHFVPSMLQQLLQ 1825 (3956)
T ss_pred             HHHHHHhcCCCcccEEEEecCccHHHH-HHHHHHHHhCCCEEEEcChhhcCCHHHHHHHHHHcCCeEEECCHHHHHHHHh
Confidence            999999999999999999999999988 5899999999999999873   689999999999999999999999999987


Q ss_pred             CCCCCCCccCceeeee--ccCCCHHHHHHHHHHcCcccccccccccccceEEeC-CCCCCCHHH-HHHHHhhcCCC----
Q psy8155         479 TPEKPEDKAHNVRLMF--GNGLRPQIWSEFVDRFRIAQIGEFYGATEGMAAILD-INKSLDVSA-VSEGIKKALPS----  550 (617)
Q Consensus       479 ~~~~~~~~l~~lr~v~--Ge~l~~~~~~~~~~~~~~~~l~n~YG~TE~~~~v~~-~~~~~~~~~-l~~~l~~~Lp~----  550 (617)
                      ... ....+++||.++  ||+++++++++|.+.++..+++|.|||||+++.+.. .....+... -...+++.++.    
T Consensus      1826 ~~~-~~~~~~~lr~v~~gGe~l~~~~~~~~~~~~~~~~l~n~YG~TE~t~~~t~~~~~~~~~~~~~~~~iG~p~~~~~~~ 1904 (3956)
T PRK12467       1826 MDE-QVEHPLSLRRVVCGGEALEVEALRPWLERLPDTGLFNLYGPTETAVDVTHWTCRRKDLEGRDSVPIGQPIANLSTY 1904 (3956)
T ss_pred             hcc-ccccCCCceEEEEccccCCHHHHHHHHHhCCCCeEEeCccCCcCEEeEEEEeccccccccCCCCCcccccCCCEEE
Confidence            532 223567898776  899999999999999887689999999999755441 100000000 00011222221    


Q ss_pred             ----CCcCcEEEEeecc----cCCccchhhhHHHhhcCC----------CCCccCCeeEEEeCCCceeeCCHHHHHHHhc
Q psy8155         551 ----YARPLFIRCLREV----EMTGTYKLKKLDLQKEGF----------DPNVIQDRLYYLSSKGVYEELTPEVYKDLVQ  612 (617)
Q Consensus       551 ----~~~P~~~~~~~~l----P~t~~GK~dr~~L~~~g~----------~~~~TGD~lg~~d~d~G~l~i~GR~~d~I~~  612 (617)
                          ...|......+++    |.-..|++++..++++.|          .+|+||| +|++++| |+|+|+||+|||||+
T Consensus      1905 vld~~~~~vp~G~~GEl~i~G~~v~~GYl~~p~~t~~~f~~~p~~~~~~r~yrTGD-l~~~~~d-G~l~~~GR~D~qVki 1982 (3956)
T PRK12467       1905 ILDASLNPVPIGVAGELYLGGVGLARGYLNRPALTAERFVADPFGTVGSRLYRTGD-LARYRAD-GVIEYLGRIDHQVKI 1982 (3956)
T ss_pred             EECCCCCCCCCCCceEEEeccccccccccCChhhhhhhCcCCCCCCCCccceeccc-eEEECCC-CCEEEecccCceEEe
Confidence                1111111112222    223457777777766544          2488999 9999998 999999999999999


Q ss_pred             CCcCC
Q psy8155         613 GNIRL  617 (617)
Q Consensus       613 ~G~~v  617 (617)
                      +|+||
T Consensus      1983 ~G~rI 1987 (3956)
T PRK12467       1983 RGFRI 1987 (3956)
T ss_pred             CeEEe
Confidence            99997

>PRK12467 peptide synthase; Provisional	Back alignment and domain information

>PRK12316 peptide synthase; Provisional	Back alignment and domain information

>PRK10252 entF enterobactin synthase subunit F; Provisional	Back alignment and domain information

>PRK05691 peptide synthase; Validated	Back alignment and domain information

>PRK05691 peptide synthase; Validated	Back alignment and domain information

>PRK12316 peptide synthase; Provisional	Back alignment and domain information

>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase	Back alignment and domain information

>COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG1177\|consensus	Back alignment and domain information

>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG1176\|consensus	Back alignment and domain information

>KOG1179\|consensus	Back alignment and domain information

>PRK07788 acyl-CoA synthetase; Validated	Back alignment and domain information

>PLN02736 long-chain acyl-CoA synthetase	Back alignment and domain information

>PLN02860 o-succinylbenzoate-CoA ligase	Back alignment and domain information

>PTZ00342 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated	Back alignment and domain information

>PLN02861 long-chain-fatty-acid-CoA ligase	Back alignment and domain information

>PLN02614 long-chain acyl-CoA synthetase	Back alignment and domain information

>PRK08279 long-chain-acyl-CoA synthetase; Validated	Back alignment and domain information

>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism]	Back alignment and domain information

>TIGR02316 propion_prpE propionate--CoA ligase	Back alignment and domain information

>PRK07529 AMP-binding domain protein; Validated	Back alignment and domain information

>PTZ00216 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PLN02654 acetate-CoA ligase	Back alignment and domain information

>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase	Back alignment and domain information

>PRK00174 acetyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK13382 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed	Back alignment and domain information

>PRK07868 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK06060 acyl-CoA synthetase; Validated	Back alignment and domain information

>PLN02246 4-coumarate--CoA ligase	Back alignment and domain information

>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PTZ00237 acetyl-CoA synthetase; Provisional	Back alignment and domain information

>PLN03052 acetate--CoA ligase; Provisional	Back alignment and domain information

>PRK07656 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PLN02387 long-chain-fatty-acid-CoA ligase family protein	Back alignment and domain information

>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated	Back alignment and domain information

>PRK08314 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK08180 feruloyl-CoA synthase; Reviewed	Back alignment and domain information

>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional	Back alignment and domain information

>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism]	Back alignment and domain information

>PRK13388 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK10524 prpE propionyl-CoA synthetase; Provisional	Back alignment and domain information

>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase	Back alignment and domain information

>PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ]	Back alignment and domain information

>PRK03584 acetoacetyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK09274 peptide synthase; Provisional	Back alignment and domain information

>PLN03102 acyl-activating enzyme; Provisional	Back alignment and domain information

>PRK04319 acetyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK07638 acyl-CoA synthetase; Validated	Back alignment and domain information

>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase	Back alignment and domain information

>PRK06187 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK07769 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated	Back alignment and domain information

>PRK06839 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK05852 acyl-CoA synthetase; Validated	Back alignment and domain information

>PLN02430 long-chain-fatty-acid-CoA ligase	Back alignment and domain information

>PLN02574 4-coumarate--CoA ligase-like	Back alignment and domain information

>PRK06145 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK07867 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK12582 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK08316 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK05605 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional	Back alignment and domain information

>PRK05857 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK08315 AMP-binding domain protein; Validated	Back alignment and domain information

>PRK06087 short chain acyl-CoA synthetase; Reviewed	Back alignment and domain information

>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated	Back alignment and domain information

>PLN02330 4-coumarate--CoA ligase-like 1	Back alignment and domain information

>PRK07514 malonyl-CoA synthase; Validated	Back alignment and domain information

>PRK12583 acyl-CoA synthetase; Provisional	Back alignment and domain information

>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase	Back alignment and domain information

>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated	Back alignment and domain information

>PRK05677 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK07008 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK06018 putative acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK12476 putative fatty-acid--CoA ligase; Provisional	Back alignment and domain information

>PRK07470 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated	Back alignment and domain information

>PRK06188 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK05620 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK07786 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional	Back alignment and domain information

>PRK07798 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK10946 entE enterobactin synthase subunit E; Provisional	Back alignment and domain information

>PRK13383 acyl-CoA synthetase; Provisional	Back alignment and domain information

>KOG1256\|consensus	Back alignment and domain information

>PRK06164 acyl-CoA synthetase; Validated	Back alignment and domain information

>TIGR02262 benz_CoA_lig benzoate-CoA ligase family	Back alignment and domain information

>TIGR03205 pimA dicarboxylate--CoA ligase PimA	Back alignment and domain information

>PRK06178 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional	Back alignment and domain information

>PRK08162 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK09088 acyl-CoA synthetase; Validated	Back alignment and domain information

>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1	Back alignment and domain information

>PLN02479 acetate-CoA ligase	Back alignment and domain information

>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional	Back alignment and domain information

>PRK05850 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK06710 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK08308 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK07787 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional	Back alignment and domain information

>PRK08974 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK13390 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK13391 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional	Back alignment and domain information

>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed	Back alignment and domain information

>PRK09192 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional	Back alignment and domain information

>PRK08276 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>KOG1180\|consensus	Back alignment and domain information

>PRK07768 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PLN03051 acyl-activating enzyme; Provisional	Back alignment and domain information

>TIGR01733 AA-adenyl-dom amino acid adenylation domain	Back alignment and domain information

>TIGR01923 menE O-succinylbenzoate-CoA ligase	Back alignment and domain information

>KOG1175\|consensus	Back alignment and domain information

>PTZ00297 pantothenate kinase; Provisional	Back alignment and domain information

>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family	Back alignment and domain information

>TIGR03089 conserved hypothetical protein TIGR03089	Back alignment and domain information

>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional	Back alignment and domain information

>KOG1178\|consensus	Back alignment and domain information

>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase	Back alignment and domain information

>TIGR03335 F390_ftsA coenzyme F390 synthetase	Back alignment and domain information

>KOG3628\|consensus	Back alignment and domain information

>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism]	Back alignment and domain information

>TIGR02304 aden_form_hyp probable adenylate-forming enzyme	Back alignment and domain information

>KOG3628\|consensus	Back alignment and domain information

>PF13745 HxxPF_rpt: HxxPF-repeated domain; PDB: 2JGP_A	Back alignment and domain information

>KOG1179\|consensus	Back alignment and domain information

>PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria	Back alignment and domain information

>KOG1176\|consensus	Back alignment and domain information

>PRK07656 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK08315 AMP-binding domain protein; Validated	Back alignment and domain information

>PRK12583 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK04319 acetyl-CoA synthetase; Provisional	Back alignment and domain information

>TIGR01923 menE O-succinylbenzoate-CoA ligase	Back alignment and domain information

>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated	Back alignment and domain information

>KOG1177\|consensus	Back alignment and domain information

>PRK06187 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK06839 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK08308 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK07868 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated	Back alignment and domain information

>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed	Back alignment and domain information

>PLN02860 o-succinylbenzoate-CoA ligase	Back alignment and domain information

>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional	Back alignment and domain information

>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase	Back alignment and domain information

>PRK06164 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK06188 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK09188 serine/threonine protein kinase; Provisional	Back alignment and domain information

>PRK08316 acyl-CoA synthetase; Validated	Back alignment and domain information

>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK10252 entF enterobactin synthase subunit F; Provisional	Back alignment and domain information

>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional	Back alignment and domain information

>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed	Back alignment and domain information

>PRK07788 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK08279 long-chain-acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional	Back alignment and domain information

>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated	Back alignment and domain information

>PRK07638 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK05677 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional	Back alignment and domain information

>PRK07787 acyl-CoA synthetase; Validated	Back alignment and domain information

>PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B	Back alignment and domain information

>PRK13382 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK08314 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family	Back alignment and domain information

>PRK06060 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK07470 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK05852 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK07798 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK07867 acyl-CoA synthetase; Validated	Back alignment and domain information

>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase	Back alignment and domain information

>PRK07529 AMP-binding domain protein; Validated	Back alignment and domain information

>PRK03584 acetoacetyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK05620 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK13388 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK00174 acetyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK06145 acyl-CoA synthetase; Validated	Back alignment and domain information

>PLN02246 4-coumarate--CoA ligase	Back alignment and domain information

>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional	Back alignment and domain information

>PLN02574 4-coumarate--CoA ligase-like	Back alignment and domain information

>PRK07008 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated	Back alignment and domain information

>PRK06710 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PLN02654 acetate-CoA ligase	Back alignment and domain information

>PRK06018 putative acyl-CoA synthetase; Provisional	Back alignment and domain information

>PLN03102 acyl-activating enzyme; Provisional	Back alignment and domain information

>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional	Back alignment and domain information

>TIGR02316 propion_prpE propionate--CoA ligase	Back alignment and domain information

>PRK09088 acyl-CoA synthetase; Validated	Back alignment and domain information

>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase	Back alignment and domain information

>PRK13390 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK09188 serine/threonine protein kinase; Provisional	Back alignment and domain information

>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional	Back alignment and domain information

>PRK05605 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK10946 entE enterobactin synthase subunit E; Provisional	Back alignment and domain information

>PLN03051 acyl-activating enzyme; Provisional	Back alignment and domain information

>PLN02330 4-coumarate--CoA ligase-like 1	Back alignment and domain information

>PRK10524 prpE propionyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK07514 malonyl-CoA synthase; Validated	Back alignment and domain information

>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional	Back alignment and domain information

>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1	Back alignment and domain information

>PRK07786 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PTZ00237 acetyl-CoA synthetase; Provisional	Back alignment and domain information

>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated	Back alignment and domain information

>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase	Back alignment and domain information

>PRK08974 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional	Back alignment and domain information

>PRK06087 short chain acyl-CoA synthetase; Reviewed	Back alignment and domain information

>PRK06178 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK08276 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase	Back alignment and domain information

>PRK13383 acyl-CoA synthetase; Provisional	Back alignment and domain information

>TIGR03205 pimA dicarboxylate--CoA ligase PimA	Back alignment and domain information

>PRK13391 acyl-CoA synthetase; Provisional	Back alignment and domain information

>PF00668 Condensation: Condensation domain; InterPro: IPR001242 This domain is found in many multi-domain enzymes which synthesize peptide antibiotics	Back alignment and domain information

>KOG1175\|consensus	Back alignment and domain information

>PRK05857 acyl-CoA synthetase; Validated	Back alignment and domain information

>PF03321 GH3: GH3 auxin-responsive promoter; InterPro: IPR004993 Transcription of the gene family, GH3, has been shown to be specifically induced by the plant hormone auxin	Back alignment and domain information

>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated	Back alignment and domain information

>PRK08162 acyl-CoA synthetase; Validated	Back alignment and domain information

>PLN03052 acetate--CoA ligase; Provisional	Back alignment and domain information

>PLN02249 indole-3-acetic acid-amido synthetase	Back alignment and domain information

>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism]	Back alignment and domain information

>TIGR02262 benz_CoA_lig benzoate-CoA ligase family	Back alignment and domain information

>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism]	Back alignment and domain information

>PLN02479 acetate-CoA ligase	Back alignment and domain information

>PRK09274 peptide synthase; Provisional	Back alignment and domain information

>PRK07769 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

>PRK09192 acyl-CoA synthetase; Validated	Back alignment and domain information

>PRK12476 putative fatty-acid--CoA ligase; Provisional	Back alignment and domain information

>KOG1178\|consensus	Back alignment and domain information

>PLN02736 long-chain acyl-CoA synthetase	Back alignment and domain information

>TIGR02946 acyl_WS_DGAT acyltransferase, WS/DGAT/MGAT	Back alignment and domain information

>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase	Back alignment and domain information

>TIGR03335 F390_ftsA coenzyme F390 synthetase	Back alignment and domain information

>PRK07768 long-chain-fatty-acid--CoA ligase; Validated	Back alignment and domain information

Homologous Structure Templates