Psyllid ID: psy816
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 138 | ||||||
| 350410644 | 1374 | PREDICTED: hypothetical protein LOC10074 | 0.862 | 0.086 | 0.479 | 3e-26 | |
| 242004622 | 813 | ubiquitin-protein ligase BRE1, putative | 0.905 | 0.153 | 0.492 | 4e-26 | |
| 345486050 | 1341 | PREDICTED: hypothetical protein LOC10067 | 0.862 | 0.088 | 0.479 | 1e-25 | |
| 321466421 | 728 | hypothetical protein DAPPUDRAFT_247447 [ | 0.731 | 0.138 | 0.539 | 2e-24 | |
| 307173815 | 1069 | Activating transcription factor 7-intera | 0.862 | 0.111 | 0.471 | 8e-24 | |
| 383862985 | 1289 | PREDICTED: uncharacterized protein LOC10 | 0.913 | 0.097 | 0.436 | 1e-23 | |
| 332031515 | 1052 | Activating transcription factor 7-intera | 0.862 | 0.113 | 0.463 | 2e-23 | |
| 307205402 | 753 | Activating transcription factor 7-intera | 0.862 | 0.158 | 0.471 | 3e-23 | |
| 328707914 | 916 | PREDICTED: hypothetical protein LOC10057 | 0.862 | 0.129 | 0.424 | 7e-23 | |
| 427781561 | 951 | Putative activating transcription factor | 0.702 | 0.101 | 0.535 | 1e-22 |
| >gi|350410644|ref|XP_003489101.1| PREDICTED: hypothetical protein LOC100743311 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 122 bits (307), Expect = 3e-26, Method: Composition-based stats.
Identities = 59/123 (47%), Positives = 83/123 (67%), Gaps = 4/123 (3%)
Query: 7 APVPPTPSVSNVVGAMYEMVPAAPKLRVQLADAGKGIQLTWSLDTTSDMAAIESYQLYAY 66
AP+P T + + V ++++ P AP L++ + GI L+W+++ + A I SYQLYAY
Sbjct: 1256 APLPDTRNYA--VNPLWKLSPPAPSLKI--SKVAHGIVLSWNMNLSDKYADIVSYQLYAY 1311
Query: 67 QENKNVPVNSSLWKNIGKLEALPLPMACTLTQFTAGHTYHFLVRAIDVYKRYSAFSNPGT 126
QE VP N+SLWK +G + ALPLPMACTLTQF+ G+ YHF VRA+D++ R +S PG
Sbjct: 1312 QEIAGVPPNTSLWKKVGDVRALPLPMACTLTQFSEGNNYHFAVRAVDIHSRKGQYSIPGN 1371
Query: 127 IHL 129
I L
Sbjct: 1372 ISL 1374
|
Source: Bombus impatiens Species: Bombus impatiens Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242004622|ref|XP_002423179.1| ubiquitin-protein ligase BRE1, putative [Pediculus humanus corporis] gi|212506144|gb|EEB10441.1| ubiquitin-protein ligase BRE1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|345486050|ref|XP_003425394.1| PREDICTED: hypothetical protein LOC100678585 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|321466421|gb|EFX77416.1| hypothetical protein DAPPUDRAFT_247447 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|307173815|gb|EFN64593.1| Activating transcription factor 7-interacting protein 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383862985|ref|XP_003706963.1| PREDICTED: uncharacterized protein LOC100881659 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|332031515|gb|EGI70987.1| Activating transcription factor 7-interacting protein 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307205402|gb|EFN83743.1| Activating transcription factor 7-interacting protein 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|328707914|ref|XP_003243539.1| PREDICTED: hypothetical protein LOC100575593 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|427781561|gb|JAA56232.1| Putative activating transcription factor 7 [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 138 | ||||||
| ZFIN|ZDB-GENE-061103-178 | 858 | atf7ip "activating transcripti | 0.782 | 0.125 | 0.442 | 3.7e-20 | |
| UNIPROTKB|F6Q7P1 | 1199 | F6Q7P1 "Uncharacterized protei | 0.710 | 0.081 | 0.47 | 5.6e-19 | |
| UNIPROTKB|Q6VMQ6 | 1270 | ATF7IP "Activating transcripti | 0.710 | 0.077 | 0.47 | 6e-19 | |
| UNIPROTKB|I3LGZ6 | 1275 | ATF7IP "Uncharacterized protei | 0.710 | 0.076 | 0.47 | 6.1e-19 | |
| UNIPROTKB|F1NLP9 | 1085 | ATF7IP "Activating transcripti | 0.710 | 0.090 | 0.45 | 6.2e-19 | |
| UNIPROTKB|Q5ZIE8 | 1085 | ATF7IP "Activating transcripti | 0.710 | 0.090 | 0.45 | 6.2e-19 | |
| MGI|MGI:1858965 | 1306 | Atf7ip "activating transcripti | 0.710 | 0.075 | 0.47 | 6.3e-19 | |
| UNIPROTKB|Q5U623 | 682 | ATF7IP2 "Activating transcript | 0.666 | 0.134 | 0.437 | 1.8e-16 | |
| UNIPROTKB|E1B7J2 | 688 | ATF7IP2 "Uncharacterized prote | 0.666 | 0.133 | 0.427 | 8.2e-16 | |
| FB|FBgn0027499 | 1420 | wde "windei" [Drosophila melan | 0.731 | 0.071 | 0.4 | 3.7e-15 |
| ZFIN|ZDB-GENE-061103-178 atf7ip "activating transcription factor 7 interacting protein" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 250 (93.1 bits), Expect = 3.7e-20, P = 3.7e-20
Identities = 50/113 (44%), Positives = 73/113 (64%)
Query: 27 PAAPKLRVQLADAGKGIQLTWSL-DTTSDMAAIESYQLYAYQENKNVPVNSS----LWKN 81
P P+L++ + GI L+W + +T + AA+++Y LYAY ++ V+ + LWK
Sbjct: 742 PQQPQLKLARVQSQNGIVLSWCVAETDRNCAAVDTYHLYAYHQDHQSSVSGASAQMLWKK 801
Query: 82 IGKLEALPLPMACTLTQFTAGHTYHFLVRAIDVYKRYSAFSNPGTIHLRTPAT 134
IG+++ALPLPMACTLTQF +G TY+F VRA DVY R+ F P + TPA+
Sbjct: 802 IGEVKALPLPMACTLTQFVSGSTYYFAVRAKDVYGRFGPFCEPQCTDVITPAS 854
|
|
| UNIPROTKB|F6Q7P1 F6Q7P1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6VMQ6 ATF7IP "Activating transcription factor 7-interacting protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LGZ6 ATF7IP "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLP9 ATF7IP "Activating transcription factor 7-interacting protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZIE8 ATF7IP "Activating transcription factor 7-interacting protein 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1858965 Atf7ip "activating transcription factor 7 interacting protein" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5U623 ATF7IP2 "Activating transcription factor 7-interacting protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B7J2 ATF7IP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0027499 wde "windei" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 98.77 | |
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 97.69 | |
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 97.46 | |
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 97.16 | |
| KOG3513|consensus | 1051 | 95.86 | ||
| KOG0196|consensus | 996 | 95.3 | ||
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 91.36 | |
| KOG4802|consensus | 516 | 90.02 | ||
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 89.83 | |
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 84.99 |
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
Probab=98.77 E-value=1.1e-07 Score=61.57 Aligned_cols=82 Identities=22% Similarity=0.353 Sum_probs=65.3
Q ss_pred ceEEEEEeecCCcEEEEEeCCCCCcccceeeEEEEEEEeCCCCCCCCccceeeceecccCceeeEEeeecCCCcEEEEEE
Q psy816 30 PKLRVQLADAGKGIQLTWSLDTTSDMAAIESYQLYAYQENKNVPVNSSLWKNIGKLEALPLPMACTLTQFTAGHTYHFLV 109 (138)
Q Consensus 30 P~L~l~i~~~~~gIvLsWn~~~~~~~A~v~sYeLyayqe~~~~~~~~~~WKKig~VkAlPLPMaCtLtqf~~g~~YyFaV 109 (138)
..|++. ....+.|.|+|+.+. .....+.+|+|+...++... .|..+ .+.+. -+.+++++..++.+|.|.|
T Consensus 4 ~~l~v~-~~~~~sv~v~W~~~~-~~~~~~~~y~v~~~~~~~~~-----~~~~~-~~~~~--~~~~~i~~L~p~t~Y~~~v 73 (85)
T PF00041_consen 4 ENLSVS-NISPTSVTVSWKPPS-SGNGPITGYRVEYRSVNSTS-----DWQEV-TVPGN--ETSYTITGLQPGTTYEFRV 73 (85)
T ss_dssp EEEEEE-EECSSEEEEEEEESS-STSSSESEEEEEEEETTSSS-----EEEEE-EEETT--SSEEEEESCCTTSEEEEEE
T ss_pred cCeEEE-ECCCCEEEEEEECCC-CCCCCeeEEEEEEEecccce-----eeeee-eeeee--eeeeeeccCCCCCEEEEEE
Confidence 366765 247999999999998 77788999999998777542 45555 33433 4489999999999999999
Q ss_pred EEeeecCccCCCC
Q psy816 110 RAIDVYKRYSAFS 122 (138)
Q Consensus 110 RavDi~~R~GpFs 122 (138)
+|++-.| .|++|
T Consensus 74 ~a~~~~g-~g~~S 85 (85)
T PF00041_consen 74 RAVNSDG-EGPPS 85 (85)
T ss_dssp EEEETTE-EEEEE
T ss_pred EEEeCCc-CcCCC
Confidence 9999999 88875
|
They contain multiple copies of 3 repeat regions (types I, II and III), which bind to a variety of substances including heparin, collagen, DNA, actin, fibrin and fibronectin receptors on cell surfaces. The wide variety of these substances means that fibronectins are involved in a number of important functions: e.g., wound healing; cell adhesion; blood coagulation; cell differentiation and migration; maintenance of the cellular cytoskeleton; and tumour metastasis []. The role of fibronectin in cell differentiation is demonstrated by the marked reduction in the expression of its gene when neoplastic transformation occurs. Cell attachment has been found to be mediated by the binding of the tetrapeptide RGDS to integrins on the cell surface [], although related sequences can also display cell adhesion activity. Plasma fibronectin occurs as a dimer of 2 different subunits, linked together by 2 disulphide bonds near the C terminus. The difference in the 2 chains occurs in the type III repeat region and is caused by alternative splicing of the mRNA from one gene []. The observation that, in a given protein, an individual repeat of one of the 3 types (e.g., the first FnIII repeat) shows much less similarity to its subsequent tandem repeats within that protein than to its equivalent repeat between fibronectins from other species, has suggested that the repeating structure of fibronectin arose at an early stage of evolution. It also seems to suggest that the structure is subject to high selective pressure []. The fibronectin type III repeat region is an approximately 100 amino acid domain, different tandem repeats of which contain binding sites for DNA, heparin and the cell surface []. The superfamily of sequences believed to contain FnIII repeats represents 45 different families, the majority of which are involved in cell surface binding in some manner, or are receptor protein tyrosine kinases, or cytokine receptors.; GO: 0005515 protein binding; PDB: 1UEM_A 1TDQ_A 1X5I_A 2IC2_B 2IBG_C 2IBB_A 3R8Q_A 2FNB_A 1FNH_A 2EDB_A .... |
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 138 | |||
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 4e-04 |
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
Score = 36.7 bits (85), Expect = 4e-04
Identities = 20/108 (18%), Positives = 36/108 (33%), Gaps = 15/108 (13%)
Query: 26 VPAAPKLRVQLADAGKG-IQLTWSLDTTSDMAAIESYQLYAYQENKNVPVNSSLWKNIGK 84
VPA P L+++ L+W + Y L N ++ +
Sbjct: 9 VPATPILQLEECCTHNNSATLSWK-QPPLSTVPADGYILELD------DGNGGQFREVYV 61
Query: 85 LEALPLPMACTLTQFTAGHTYHFLVRAIDVYKRYSAFSNPGTIHLRTP 132
+ CT+ TY+ V+A + S +S + L+T
Sbjct: 62 GKET----MCTVDGLHFNSTYNARVKAFNKTG-VSPYSKT--LVLQTS 102
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 98.94 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 98.91 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 98.87 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 98.87 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 98.86 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 98.86 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.8 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 98.76 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 98.76 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 98.75 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 98.75 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 98.73 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 98.73 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 98.69 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 98.69 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 98.68 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 98.67 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 98.65 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.65 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 98.64 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 98.63 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 98.61 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 98.61 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 98.6 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.6 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 98.58 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.57 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 98.56 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 98.55 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 98.54 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 98.53 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 98.53 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 98.53 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 98.53 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 98.49 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 98.49 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 98.49 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 98.48 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 98.48 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 98.45 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 98.43 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 98.42 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 98.4 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 98.4 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 98.37 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 98.37 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 98.36 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.34 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 98.33 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 98.3 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 98.28 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 98.28 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 98.27 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 98.26 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 98.25 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 98.17 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 98.15 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 98.15 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 98.14 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 98.12 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 98.12 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 98.11 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 98.1 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 98.04 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 98.03 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 98.03 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 98.03 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 98.02 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 98.01 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 98.01 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 98.01 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 98.0 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 98.0 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 97.99 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 97.98 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 97.95 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 97.93 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 97.92 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 97.91 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 97.88 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 97.88 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 97.87 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 97.87 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 97.86 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 97.86 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 97.85 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 97.81 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 97.78 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 97.77 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 97.77 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 97.76 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 97.75 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 97.74 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 97.7 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 97.7 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 97.65 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 97.63 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 97.62 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 97.6 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 97.56 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 97.55 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 97.55 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 97.55 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 97.53 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 97.5 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 97.46 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 97.44 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 97.42 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 97.4 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 97.39 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 97.39 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 97.38 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 97.37 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 97.37 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 97.37 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 97.37 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 97.33 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 97.33 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 97.31 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 97.29 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 97.25 | |
| 3og6_B | 226 | Interleukin 28 receptor, alpha (interferon, lambd | 97.25 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 97.17 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 97.16 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 97.15 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 97.12 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 97.05 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 97.04 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 97.03 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 97.02 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 96.97 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 96.93 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 96.9 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 96.88 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 96.87 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 96.78 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 96.71 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 96.66 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 96.66 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 96.56 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 96.54 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 96.51 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 96.48 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 96.42 | |
| 1wft_A | 123 | 1700129L13RIK protein; FN3 domain, similar to HOST | 96.41 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 96.37 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 96.35 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 96.31 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 96.14 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 95.83 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 95.77 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 95.63 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 95.59 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 95.38 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 95.32 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 95.13 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 95.03 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 94.97 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 94.95 | |
| 1fyh_B | 229 | Interferon-gamma receptor alpha chain; cytokine-re | 94.87 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 94.21 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 93.94 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 93.52 | |
| 2uvf_A | 608 | Exopolygalacturonase; GH28, pectin, cell WALL, hyd | 93.52 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 93.23 | |
| 3b4n_A | 344 | Endo-pectate lyase; pectin, galacturonic acid, rig | 93.11 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 92.78 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 92.72 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 91.88 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 91.06 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 91.03 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 90.86 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 90.74 | |
| 3bes_R | 250 | Interferon-gamma binding protein C4R; orthopoxviru | 87.44 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 86.11 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 85.63 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 84.77 | |
| 3og6_B | 226 | Interleukin 28 receptor, alpha (interferon, lambd | 84.42 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 83.74 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 83.7 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 81.95 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 81.49 |
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
Probab=98.94 E-value=2.5e-08 Score=65.37 Aligned_cols=82 Identities=27% Similarity=0.465 Sum_probs=62.4
Q ss_pred CCCc-eEEEEEeecCCcEEEEEeCCCCCcccceeeEEEEEEEeCCCCCCCCccceeeceecccCceeeEEeeecCCCcEE
Q psy816 27 PAAP-KLRVQLADAGKGIQLTWSLDTTSDMAAIESYQLYAYQENKNVPVNSSLWKNIGKLEALPLPMACTLTQFTAGHTY 105 (138)
Q Consensus 27 P~~P-~L~l~i~~~~~gIvLsWn~~~~~~~A~v~sYeLyayqe~~~~~~~~~~WKKig~VkAlPLPMaCtLtqf~~g~~Y 105 (138)
|.+| .|++. ....+.|.|+|+-..+. ..+.+|+||. +. ..++.+.. ..++++....|..|
T Consensus 4 P~~P~~l~~~-~~~~~sv~L~W~~~~~~--~~i~~Y~v~~--~~----------~~~~~~~~----~~~~~~~L~~~t~Y 64 (88)
T 1k85_A 4 PTAPTNLAST-AQTTSSITLSWTASTDN--VGVTGYDVYN--GT----------ALATTVTG----TTATISGLAADTSY 64 (88)
T ss_dssp CCCCEEEEEE-EECSSCEEEEEECCSCC--SSEEEEEEEE--SS----------SEEEEESS----SEEEECCCCSSCEE
T ss_pred cCCCCccEEE-eccCCEEEEEECCCCCC--CCccEEEEEE--CC----------EEEeecCC----CEEEeCCCCCCCEE
Confidence 4445 56664 24588999999977632 2489999992 11 13555554 47899999999999
Q ss_pred EEEEEEeeecCccCCCCCceEE
Q psy816 106 HFLVRAIDVYKRYSAFSNPGTI 127 (138)
Q Consensus 106 yFaVRavDi~~R~GpFs~~~ti 127 (138)
+|.|||+|..|..|++|...++
T Consensus 65 ~~~V~A~n~~G~~s~~S~~v~v 86 (88)
T 1k85_A 65 TFTVKAKDAAGNVSAASNAVSV 86 (88)
T ss_dssp EEEEEEEETTTEECCCCCCEEE
T ss_pred EEEEEEEeCCCCcCCCCCCEEE
Confidence 9999999999999999988765
|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R | Back alignment and structure |
|---|
| >2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 138 | |||
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 98.98 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 98.98 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 98.92 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 98.91 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 98.86 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.81 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 98.78 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 98.77 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 98.77 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 98.73 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 98.71 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 98.71 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.69 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 98.68 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 98.68 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 98.68 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.66 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 98.66 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 98.64 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.63 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.62 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 98.62 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 98.59 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 98.58 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 98.57 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 98.55 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 98.53 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 98.53 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 98.52 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 98.52 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 98.49 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 98.48 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 98.47 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 98.47 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.46 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 98.4 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.38 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.35 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 98.34 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 98.33 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 98.32 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.32 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.29 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.29 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 98.28 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 98.26 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 98.25 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 98.24 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 98.23 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.22 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 98.15 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 98.14 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 98.14 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 98.12 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.1 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 98.08 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.02 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.0 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.99 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 97.99 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.92 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.92 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.9 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 97.87 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 97.87 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.8 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 97.75 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.69 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.66 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 97.64 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 97.63 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 97.6 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 97.58 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 97.58 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 97.55 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 97.55 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 97.55 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.54 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 97.53 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.47 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 97.38 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 97.26 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 97.22 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.05 | |
| d2c4fu1 | 116 | Extracellular region of human tissue factor {Human | 94.4 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 93.3 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 91.29 | |
| d2qfra1 | 112 | Purple acid phosphatase, N-terminal domain {Kidney | 80.58 |
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Neural cell adhesion molecule 1, NCAM species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.98 E-value=3.3e-09 Score=70.21 Aligned_cols=95 Identities=13% Similarity=0.162 Sum_probs=69.3
Q ss_pred CCCCceEEEEEeecCCcEEEEEeCCCCCcccceeeEEEEEEEeCCCCCCCCccceeeceecccCceeeEEeeecCCCcEE
Q psy816 26 VPAAPKLRVQLADAGKGIQLTWSLDTTSDMAAIESYQLYAYQENKNVPVNSSLWKNIGKLEALPLPMACTLTQFTAGHTY 105 (138)
Q Consensus 26 ~P~~P~L~l~i~~~~~gIvLsWn~~~~~~~A~v~sYeLyayqe~~~~~~~~~~WKKig~VkAlPLPMaCtLtqf~~g~~Y 105 (138)
+|.+|.+.. +....+.|.|+|+-+..+..++|..|+|.....+.. . ....|.. +.....-..|+|++...|.+|
T Consensus 2 vP~~P~~~~-~~~~~~sv~l~W~~P~~~gg~~I~~Y~v~~~~~~~~-~-~~~~~~~---~~~~~~~~~~~i~~L~p~t~Y 75 (101)
T d2haza1 2 TPSSPSIDQ-VEPYSSTAQVQFDEPEATGGVPILKYKAEWRAVGEE-V-WHSKWYD---AKEASMEGIVTIVGLKPETTY 75 (101)
T ss_dssp CCCCCEEEE-EEECSSCEEEEEECCSCCTTSCCCEEEEEEEETTCC-C-CEEEEEE---HHHHHHHSEEEECSCCTTCEE
T ss_pred cCcCCccCE-EEeeCCEEEEEEeCCCcCccccEEEEEEEEeecCCc-c-eeeeeee---eecccceeEEEecCCCCCeEE
Confidence 356665443 335678999999988777778999999986654432 1 1222333 233344567999999999999
Q ss_pred EEEEEEeeecCccCCCCCceEE
Q psy816 106 HFLVRAIDVYKRYSAFSNPGTI 127 (138)
Q Consensus 106 yFaVRavDi~~R~GpFs~~~ti 127 (138)
+|-|||+...|+ |+||.+.++
T Consensus 76 ~frV~A~N~~G~-g~~S~~~~~ 96 (101)
T d2haza1 76 AVRLAALNGKGL-GEISAASEF 96 (101)
T ss_dssp EEEEEEEETTEE-CCCCCCEEE
T ss_pred EEEEEEEeCCcC-cCCCCceeE
Confidence 999999999995 999987654
|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|