Psyllid ID: psy8255


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
MGEDRDKDRERDRRRRSRSRDHKKRSRSRDRRSRSRSKDKKRAARSRSRSPRDKTKSRRRKASLYWDVPPPGFEHVSPSQYKAMQAAAAAAVPVVGSTITRQARRLYVGNIPFGVTE
ccccccHHHHHHHHcccccHHHHHHccccccccccccHHHHHHcccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccHHHHHHHHHccccccccccHHHHHHHHHEEEccccccccc
mgedrdkdrerdrrrrsrsrdhkkrsrsrdrrsrsrskdkkraarsrsrsprdktksrrrkaslywdvpppgfehvspsQYKAMQAAAAAAVPVVGSTITRQARRLYvgnipfgvte
mgedrdkdrerdrrrrsrsrdhkkrsrsrdrrsrsrskdkkraarsrsrsprdktksrrrkaslywdvpppgFEHVSPSQYKAMQAAAAAAVPVVGSTItrqarrlyvgnipfgvte
MGEdrdkdrerdrrrrsrsrdhkkrsrsrdrrsrsrskdkkraarsrsrsprdkTKSRRRKASLYWDVPPPGFEHVSPSQYKAMQaaaaaaVPVVGSTITRQARRLYVGNIPFGVTE
***************************************************************LYWDV*************KAMQAAAAAAVPVVGSTITRQARRLYVGNIPFG***
******************************************************************DVPPPGFEHVSPSQYKAMQAAAA****V*****TRQARRLYVGNIPFG***
*************************************************************ASLYWDVPPPGFEHVSPSQ************PVVGSTITRQARRLYVGNIPFGVTE
*************************************************************ASLYWDVPPPGFEHVSPSQYKAMQAAAAAAVPVVGSTITRQARRLYVGNIPFGVT*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEDRDKDRERDRRRRSRSRDHKKRSRSRDRRSRSRSKDKKRAARSRSRSPRDKTKSRRRKASLYWDVPPPGFEHVSPSQYKAMQAAAAAAVPVVGSTITRQARRLYVGNIPFGVTE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query117 2.2.26 [Sep-21-2011]
Q24562 416 Splicing factor U2AF 50 k yes N/A 0.504 0.141 0.728 7e-23
P26369 475 Splicing factor U2AF 65 k yes N/A 0.564 0.138 0.568 5e-20
P26368 475 Splicing factor U2AF 65 k yes N/A 0.564 0.138 0.568 6e-20
P90727 488 Splicing factor U2AF 65 k N/A N/A 0.572 0.137 0.527 3e-15
P90978 496 Splicing factor U2AF 65 k yes N/A 0.615 0.145 0.518 1e-14
>sp|Q24562|U2AF2_DROME Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster GN=U2af50 PE=2 SV=1 Back     alignment and function desciption
 Score =  105 bits (262), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 51/70 (72%), Positives = 54/70 (77%), Gaps = 11/70 (15%)

Query: 59  RRKASLYWDVPPPGFEHVSPSQYKAMQAAA-----------AAAVPVVGSTITRQARRLY 107
           RRK SLYWDVPPPGFEH++P QYKAMQA+              AVPVVGSTITRQARRLY
Sbjct: 37  RRKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASVVPDTPQTAVPVVGSTITRQARRLY 96

Query: 108 VGNIPFGVTE 117
           VGNIPFGVTE
Sbjct: 97  VGNIPFGVTE 106




Necessary for the splicing of pre-mRNA. Binds to the polypyrimidine tract of introns early during spliceosome assembly.
Drosophila melanogaster (taxid: 7227)
>sp|P26369|U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3 Back     alignment and function description
>sp|P26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens GN=U2AF2 PE=1 SV=4 Back     alignment and function description
>sp|P90727|U2AF2_CAEBR Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis briggsae GN=uaf-1 PE=3 SV=2 Back     alignment and function description
>sp|P90978|U2AF2_CAEEL Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis elegans GN=uaf-1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
328721670 416 PREDICTED: splicing factor U2AF 50 kDa s 0.606 0.170 0.738 3e-25
193629757 446 PREDICTED: splicing factor U2AF 50 kDa s 0.606 0.159 0.738 3e-25
328721668 451 PREDICTED: splicing factor U2AF 50 kDa s 1.0 0.259 0.589 6e-25
312372039 384 hypothetical protein AND_20681 [Anophele 0.572 0.174 0.730 1e-24
347968827 446 AGAP002908-PA [Anopheles gambiae str. PE 0.572 0.150 0.730 1e-24
345480698 455 PREDICTED: splicing factor U2AF 50 kDa s 0.581 0.149 0.721 3e-24
95103124 306 U2 small nuclear ribonucleoprotein auxil 0.521 0.199 0.763 3e-24
157132061 418 splicing factor u2af large subunit [Aede 0.572 0.160 0.730 1e-23
170054347 438 splicing factor u2af large subunit [Cule 0.572 0.152 0.730 1e-23
270011684 432 hypothetical protein TcasGA2_TC005736 [T 1.0 0.270 0.538 3e-23
>gi|328721670|ref|XP_001951521.2| PREDICTED: splicing factor U2AF 50 kDa subunit-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  119 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 62/84 (73%), Positives = 65/84 (77%), Gaps = 13/84 (15%)

Query: 45  RSRSRSPRDKTKSRRRKASLYWDVPPPGFEHVSPSQYKAMQAAA-----------AAAVP 93
           RSRS+SP  K KSRRRK SLYWDVPPPGFEH++P QYKAMQAA              AVP
Sbjct: 32  RSRSKSP--KNKSRRRKPSLYWDVPPPGFEHIAPLQYKAMQAAGQIPANTMPDTPQTAVP 89

Query: 94  VVGSTITRQARRLYVGNIPFGVTE 117
           VVGSTITRQARRLYVGNIPFGVTE
Sbjct: 90  VVGSTITRQARRLYVGNIPFGVTE 113




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193629757|ref|XP_001950852.1| PREDICTED: splicing factor U2AF 50 kDa subunit-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328721668|ref|XP_003247369.1| PREDICTED: splicing factor U2AF 50 kDa subunit-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312372039|gb|EFR20089.1| hypothetical protein AND_20681 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|347968827|ref|XP_311994.4| AGAP002908-PA [Anopheles gambiae str. PEST] gi|333467820|gb|EAA08228.4| AGAP002908-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|345480698|ref|XP_001604333.2| PREDICTED: splicing factor U2AF 50 kDa subunit-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|95103124|gb|ABF51503.1| U2 small nuclear ribonucleoprotein auxiliary factor 2 isoform 2 [Bombyx mori] Back     alignment and taxonomy information
>gi|157132061|ref|XP_001662443.1| splicing factor u2af large subunit [Aedes aegypti] gi|108881728|gb|EAT45953.1| AAEL002818-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170054347|ref|XP_001863087.1| splicing factor u2af large subunit [Culex quinquefasciatus] gi|167874693|gb|EDS38076.1| splicing factor u2af large subunit [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|270011684|gb|EFA08132.1| hypothetical protein TcasGA2_TC005736 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
FB|FBgn0005411 416 U2af50 "U2 small nuclear ribop 0.529 0.149 0.671 9.6e-20
WB|WBGene00006697 496 uaf-1 [Caenorhabditis elegans 0.529 0.125 0.507 2e-11
FB|FBgn0034834 449 LS2 "Large Subunit 2" [Drosoph 0.538 0.140 0.434 3.1e-09
ZFIN|ZDB-GENE-040426-1881 475 u2af2b "U2 small nuclear RNA a 0.384 0.094 0.466 3e-07
UNIPROTKB|E2R0G3 471 U2AF2 "Uncharacterized protein 0.367 0.091 0.488 4.8e-07
UNIPROTKB|Q24JZ8 475 U2AF2 "Uncharacterized protein 0.367 0.090 0.488 4.9e-07
UNIPROTKB|P26368 475 U2AF2 "Splicing factor U2AF 65 0.367 0.090 0.488 4.9e-07
MGI|MGI:98886 475 U2af2 "U2 small nuclear ribonu 0.367 0.090 0.488 4.9e-07
RGD|1597319 475 LOC690372 "similar to U2 (RNU2 0.367 0.090 0.488 4.9e-07
ZFIN|ZDB-GENE-050706-131 470 u2af2a "U2 small nuclear RNA a 0.222 0.055 0.884 1e-06
FB|FBgn0005411 U2af50 "U2 small nuclear riboprotein auxiliary factor 50" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 239 (89.2 bits), Expect = 9.6e-20, P = 9.6e-20
 Identities = 49/73 (67%), Positives = 53/73 (72%)

Query:    56 KSRRRKASLYWDVPPPGFEHVSPSQYKAMQXXXX-----------XXVPVVGSTITRQAR 104
             ++ RRK SLYWDVPPPGFEH++P QYKAMQ                 VPVVGSTITRQAR
Sbjct:    34 RNSRRKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASVVPDTPQTAVPVVGSTITRQAR 93

Query:   105 RLYVGNIPFGVTE 117
             RLYVGNIPFGVTE
Sbjct:    94 RLYVGNIPFGVTE 106




GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS;NAS;IMP
GO:0005686 "U2 snRNP" evidence=TAS
GO:0008187 "poly-pyrimidine tract binding" evidence=NAS;IDA
GO:0005681 "spliceosomal complex" evidence=ISS;NAS
GO:0000245 "spliceosomal complex assembly" evidence=NAS
GO:0046982 "protein heterodimerization activity" evidence=NAS
GO:0005634 "nucleus" evidence=IC;NAS
GO:0003729 "mRNA binding" evidence=ISS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0051168 "nuclear export" evidence=IMP
GO:0000381 "regulation of alternative mRNA splicing, via spliceosome" evidence=IMP
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0008380 "RNA splicing" evidence=IMP
GO:0003723 "RNA binding" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
WB|WBGene00006697 uaf-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0034834 LS2 "Large Subunit 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1881 u2af2b "U2 small nuclear RNA auxiliary factor 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0G3 U2AF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q24JZ8 U2AF2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P26368 U2AF2 "Splicing factor U2AF 65 kDa subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:98886 U2af2 "U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1597319 LOC690372 "similar to U2 (RNU2) small nuclear RNA auxiliary factor 2 isoform b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050706-131 u2af2a "U2 small nuclear RNA auxiliary factor 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P26369U2AF2_MOUSENo assigned EC number0.56810.56410.1389yesN/A
P26368U2AF2_HUMANNo assigned EC number0.56810.56410.1389yesN/A
P90978U2AF2_CAEELNo assigned EC number0.51890.61530.1451yesN/A
Q24562U2AF2_DROMENo assigned EC number0.72850.50420.1418yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-21
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-05
cd1223082 cd12230, RRM1_U2AF65, RNA recognition motif 1 foun 5e-05
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-04
PRK10864 346 PRK10864, PRK10864, putative methyltransferase; Pr 0.003
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
 Score = 88.4 bits (219), Expect = 1e-21
 Identities = 47/139 (33%), Positives = 58/139 (41%), Gaps = 26/139 (18%)

Query: 4   DRDKDRERDRRRRSRSRDHKKRSRSR-DRRSRSRSKDKKRAARSRSRSPRDKTKSRRRKA 62
            RD+ R   R  RS      +RSR R  RRSRS    ++   R R RSP ++ +   +K 
Sbjct: 52  PRDRRRYDSRSPRSLRYSSVRRSRDRPRRRSRSVRSIEQHRRRLRDRSPSNQWRKDDKKR 111

Query: 63  SLYWDVPPPGFEHVSPSQYKAMQAA------------------------AAAAVPVVGST 98
           S  WD+ PPG+E V+  Q KA Q                              V      
Sbjct: 112 S-LWDIKPPGYELVTADQAKASQVFSVPGTAPRPAMTDPEKLLAEGSIITPLPVLPYQQQ 170

Query: 99  ITRQARRLYVGNIPFGVTE 117
            TRQARRLYVG IP    E
Sbjct: 171 ATRQARRLYVGGIPPEFVE 189


These splicing factors consist of an N-terminal arginine-rich low complexity domain followed by three tandem RNA recognition motifs (pfam00076). The well-characterized members of this family are auxilliary components of the U2 small nuclear ribonuclearprotein splicing factor (U2AF). These proteins are closely related to the CC1-like subfamily of splicing factors (TIGR01622). Members of this subfamily are found in plants, metazoa and fungi. Length = 509

>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240676 cd12230, RRM1_U2AF65, RNA recognition motif 1 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|236779 PRK10864, PRK10864, putative methyltransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 117
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.28
KOG0120|consensus 500 99.21
PF06495182 Transformer: Fruit fly transformer protein; InterP 98.58
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 97.59
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 95.18
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 89.58
COG0724 306 RNA-binding proteins (RRM domain) [General functio 87.54
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 85.41
KOG0126|consensus 219 84.24
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 83.58
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 80.9
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 80.29
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
Probab=99.28  E-value=3e-12  Score=106.62  Aligned_cols=57  Identities=46%  Similarity=0.675  Sum_probs=44.2

Q ss_pred             cCCCCCCCCCCCCCCCChhHHHHHHH---hhh---------------------ccCCCCCCccccccceeEeecCCCCCC
Q psy8255          61 KASLYWDVPPPGFEHVSPSQYKAMQA---AAA---------------------AAVPVVGSTITRQARRLYVGNIPFGVT  116 (117)
Q Consensus        61 k~~s~WDv~PpG~E~vta~QaK~mq~---ag~---------------------~~~p~~~~~~SRQaRRLYVGNLP~~vt  116 (117)
                      +....||.+|++|+.+++.|++++++   ++.                     .+++++.+++++++++|||||||+++|
T Consensus       109 ~~~~~~d~~p~~~~~~~~~~~~~~~~~~~p~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~lyVgnLp~~~t  188 (509)
T TIGR01642       109 KKRSLWDIKPPGYELVTADQAKASQVFSVPGTAPRPAMTDPEKLLAEGSIITPLPVLPYQQQATRQARRLYVGGIPPEFV  188 (509)
T ss_pred             ccccccccCCCcccccchHHHhhccccCCCCCCCCCCCCCcccccccccccCCccccccCccCCccccEEEEeCCCCCCC
Confidence            34578999999999999999997642   220                     011235678899999999999999998


Q ss_pred             C
Q psy8255         117 E  117 (117)
Q Consensus       117 E  117 (117)
                      |
T Consensus       189 ~  189 (509)
T TIGR01642       189 E  189 (509)
T ss_pred             H
Confidence            6



Members of this subfamily are found in plants, metazoa and fungi.

>KOG0120|consensus Back     alignment and domain information
>PF06495 Transformer: Fruit fly transformer protein; InterPro: IPR010519 This family consists of transformer proteins from several Drosophila species and also from Ceratitis capitata (Mediterranean fruit fly) Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
1jmt_B28 X-Ray Structure Of A Core U2af65U2AF35 HETERODIMER 5e-07
>pdb|1JMT|B Chain B, X-Ray Structure Of A Core U2af65U2AF35 HETERODIMER Length = 28 Back     alignment and structure

Iteration: 1

Score = 49.3 bits (116), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 19/27 (70%), Positives = 23/27 (85%) Query: 59 RRKASLYWDVPPPGFEHVSPSQYKAMQ 85 ++K YWDVPPPGFEH++P QYKAMQ Sbjct: 1 KKKVRKYWDVPPPGFEHITPMQYKAMQ 27

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
1jmt_B28 Splicing factor U2AF 65 kDa subunit; RRM, RNA spli 6e-10
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 7e-06
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 5e-04
>1jmt_B Splicing factor U2AF 65 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} Length = 28 Back     alignment and structure
 Score = 49.8 bits (118), Expect = 6e-10
 Identities = 20/28 (71%), Positives = 24/28 (85%)

Query: 59 RRKASLYWDVPPPGFEHVSPSQYKAMQA 86
          ++K   YWDVPPPGFEH++P QYKAMQA
Sbjct: 1  KKKVRKYWDVPPPGFEHITPMQYKAMQA 28


>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
1jmt_B28 Splicing factor U2AF 65 kDa subunit; RRM, RNA spli 99.47
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 95.41
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 94.99
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 94.83
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 94.82
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 94.78
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 94.72
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 94.45
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 94.37
2i2y_A150 Fusion protein consists of immunoglobin G- binding 94.16
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 94.09
1x5o_A114 RNA binding motif, single-stranded interacting pro 93.96
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 93.94
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 93.88
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 93.82
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 93.78
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 93.72
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 93.7
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 93.66
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 93.62
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 93.6
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 93.59
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 93.51
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 93.48
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 93.45
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 93.36
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 93.27
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 93.25
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 93.23
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 93.18
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 93.13
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 92.93
3n9u_C156 Cleavage and polyadenylation specificity factor S; 92.78
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 92.59
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 92.56
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 92.32
2kt5_A124 RNA and export factor-binding protein 2; chaperone 92.28
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 92.15
1h2v_Z 156 20 kDa nuclear CAP binding protein; CAP-binding-co 91.84
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 91.73
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 91.63
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 91.43
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 90.57
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 90.53
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 89.95
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 89.76
1sjr_A 164 Polypyrimidine tract-binding protein 1; extended b 89.51
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 89.37
2f3j_A177 RNA and export factor binding protein 2; RRM domai 88.9
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 88.24
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 88.09
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 87.99
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 87.94
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 87.49
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 86.78
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 85.59
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 85.52
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 85.11
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 84.46
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 84.33
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 83.7
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 83.1
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 81.77
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 81.64
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 80.81
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 80.44
>1jmt_B Splicing factor U2AF 65 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} Back     alignment and structure
Probab=99.47  E-value=8.1e-15  Score=83.22  Aligned_cols=27  Identities=74%  Similarity=1.431  Sum_probs=21.6

Q ss_pred             ccCCCCCCCCCCCCCCCChhHHHHHHH
Q psy8255          60 RKASLYWDVPPPGFEHVSPSQYKAMQA   86 (117)
Q Consensus        60 rk~~s~WDv~PpG~E~vta~QaK~mq~   86 (117)
                      ++++++|||||||||+|||+|||+||+
T Consensus         2 r~p~~~WDvpP~GyE~vtp~qykamq~   28 (28)
T 1jmt_B            2 KKVRKYWDVPPPGFEHITPMQYKAMQA   28 (28)
T ss_dssp             ----CCBTCCCTTCTTSCHHHHHHTCC
T ss_pred             CCcccccCCCCCCccccCHHHHhhccC
Confidence            466779999999999999999999874



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 94.16
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 93.92
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 88.01
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding protein UBP1
species: Trypanosoma cruzi [TaxId: 5693]
Probab=94.16  E-value=0.007  Score=40.31  Aligned_cols=16  Identities=44%  Similarity=0.497  Sum_probs=13.5

Q ss_pred             ccceeEeecCCCCCCC
Q psy8255         102 QARRLYVGNIPFGVTE  117 (117)
Q Consensus       102 QaRRLYVGNLP~~vtE  117 (117)
                      ..+.|||||||+++||
T Consensus        41 ~~~~l~V~nLp~~~te   56 (139)
T d1u6fa1          41 VLRNLMVNYIPTTVDE   56 (139)
T ss_dssp             TTSEEEEESCSTTCCH
T ss_pred             CCCEEEEeCCCCCCCH
Confidence            3457999999999986



>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure