Psyllid ID: psy8255
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 117 | ||||||
| 328721670 | 416 | PREDICTED: splicing factor U2AF 50 kDa s | 0.606 | 0.170 | 0.738 | 3e-25 | |
| 193629757 | 446 | PREDICTED: splicing factor U2AF 50 kDa s | 0.606 | 0.159 | 0.738 | 3e-25 | |
| 328721668 | 451 | PREDICTED: splicing factor U2AF 50 kDa s | 1.0 | 0.259 | 0.589 | 6e-25 | |
| 312372039 | 384 | hypothetical protein AND_20681 [Anophele | 0.572 | 0.174 | 0.730 | 1e-24 | |
| 347968827 | 446 | AGAP002908-PA [Anopheles gambiae str. PE | 0.572 | 0.150 | 0.730 | 1e-24 | |
| 345480698 | 455 | PREDICTED: splicing factor U2AF 50 kDa s | 0.581 | 0.149 | 0.721 | 3e-24 | |
| 95103124 | 306 | U2 small nuclear ribonucleoprotein auxil | 0.521 | 0.199 | 0.763 | 3e-24 | |
| 157132061 | 418 | splicing factor u2af large subunit [Aede | 0.572 | 0.160 | 0.730 | 1e-23 | |
| 170054347 | 438 | splicing factor u2af large subunit [Cule | 0.572 | 0.152 | 0.730 | 1e-23 | |
| 270011684 | 432 | hypothetical protein TcasGA2_TC005736 [T | 1.0 | 0.270 | 0.538 | 3e-23 |
| >gi|328721670|ref|XP_001951521.2| PREDICTED: splicing factor U2AF 50 kDa subunit-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 119 bits (297), Expect = 3e-25, Method: Composition-based stats.
Identities = 62/84 (73%), Positives = 65/84 (77%), Gaps = 13/84 (15%)
Query: 45 RSRSRSPRDKTKSRRRKASLYWDVPPPGFEHVSPSQYKAMQAAA-----------AAAVP 93
RSRS+SP K KSRRRK SLYWDVPPPGFEH++P QYKAMQAA AVP
Sbjct: 32 RSRSKSP--KNKSRRRKPSLYWDVPPPGFEHIAPLQYKAMQAAGQIPANTMPDTPQTAVP 89
Query: 94 VVGSTITRQARRLYVGNIPFGVTE 117
VVGSTITRQARRLYVGNIPFGVTE
Sbjct: 90 VVGSTITRQARRLYVGNIPFGVTE 113
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193629757|ref|XP_001950852.1| PREDICTED: splicing factor U2AF 50 kDa subunit-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328721668|ref|XP_003247369.1| PREDICTED: splicing factor U2AF 50 kDa subunit-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|312372039|gb|EFR20089.1| hypothetical protein AND_20681 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|347968827|ref|XP_311994.4| AGAP002908-PA [Anopheles gambiae str. PEST] gi|333467820|gb|EAA08228.4| AGAP002908-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|345480698|ref|XP_001604333.2| PREDICTED: splicing factor U2AF 50 kDa subunit-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|95103124|gb|ABF51503.1| U2 small nuclear ribonucleoprotein auxiliary factor 2 isoform 2 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|157132061|ref|XP_001662443.1| splicing factor u2af large subunit [Aedes aegypti] gi|108881728|gb|EAT45953.1| AAEL002818-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170054347|ref|XP_001863087.1| splicing factor u2af large subunit [Culex quinquefasciatus] gi|167874693|gb|EDS38076.1| splicing factor u2af large subunit [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|270011684|gb|EFA08132.1| hypothetical protein TcasGA2_TC005736 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 117 | ||||||
| FB|FBgn0005411 | 416 | U2af50 "U2 small nuclear ribop | 0.529 | 0.149 | 0.671 | 9.6e-20 | |
| WB|WBGene00006697 | 496 | uaf-1 [Caenorhabditis elegans | 0.529 | 0.125 | 0.507 | 2e-11 | |
| FB|FBgn0034834 | 449 | LS2 "Large Subunit 2" [Drosoph | 0.538 | 0.140 | 0.434 | 3.1e-09 | |
| ZFIN|ZDB-GENE-040426-1881 | 475 | u2af2b "U2 small nuclear RNA a | 0.384 | 0.094 | 0.466 | 3e-07 | |
| UNIPROTKB|E2R0G3 | 471 | U2AF2 "Uncharacterized protein | 0.367 | 0.091 | 0.488 | 4.8e-07 | |
| UNIPROTKB|Q24JZ8 | 475 | U2AF2 "Uncharacterized protein | 0.367 | 0.090 | 0.488 | 4.9e-07 | |
| UNIPROTKB|P26368 | 475 | U2AF2 "Splicing factor U2AF 65 | 0.367 | 0.090 | 0.488 | 4.9e-07 | |
| MGI|MGI:98886 | 475 | U2af2 "U2 small nuclear ribonu | 0.367 | 0.090 | 0.488 | 4.9e-07 | |
| RGD|1597319 | 475 | LOC690372 "similar to U2 (RNU2 | 0.367 | 0.090 | 0.488 | 4.9e-07 | |
| ZFIN|ZDB-GENE-050706-131 | 470 | u2af2a "U2 small nuclear RNA a | 0.222 | 0.055 | 0.884 | 1e-06 |
| FB|FBgn0005411 U2af50 "U2 small nuclear riboprotein auxiliary factor 50" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 239 (89.2 bits), Expect = 9.6e-20, P = 9.6e-20
Identities = 49/73 (67%), Positives = 53/73 (72%)
Query: 56 KSRRRKASLYWDVPPPGFEHVSPSQYKAMQXXXX-----------XXVPVVGSTITRQAR 104
++ RRK SLYWDVPPPGFEH++P QYKAMQ VPVVGSTITRQAR
Sbjct: 34 RNSRRKPSLYWDVPPPGFEHITPMQYKAMQASGQIPASVVPDTPQTAVPVVGSTITRQAR 93
Query: 105 RLYVGNIPFGVTE 117
RLYVGNIPFGVTE
Sbjct: 94 RLYVGNIPFGVTE 106
|
|
| WB|WBGene00006697 uaf-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034834 LS2 "Large Subunit 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1881 u2af2b "U2 small nuclear RNA auxiliary factor 2b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0G3 U2AF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q24JZ8 U2AF2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P26368 U2AF2 "Splicing factor U2AF 65 kDa subunit" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98886 U2af2 "U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1597319 LOC690372 "similar to U2 (RNU2) small nuclear RNA auxiliary factor 2 isoform b" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050706-131 u2af2a "U2 small nuclear RNA auxiliary factor 2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 117 | |||
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 1e-21 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 1e-05 | |
| cd12230 | 82 | cd12230, RRM1_U2AF65, RNA recognition motif 1 foun | 5e-05 | |
| TIGR01642 | 509 | TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la | 1e-04 | |
| TIGR01622 | 457 | TIGR01622, SF-CC1, splicing factor, CC1-like famil | 2e-04 | |
| PRK10864 | 346 | PRK10864, PRK10864, putative methyltransferase; Pr | 0.003 |
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
Score = 88.4 bits (219), Expect = 1e-21
Identities = 47/139 (33%), Positives = 58/139 (41%), Gaps = 26/139 (18%)
Query: 4 DRDKDRERDRRRRSRSRDHKKRSRSR-DRRSRSRSKDKKRAARSRSRSPRDKTKSRRRKA 62
RD+ R R RS +RSR R RRSRS ++ R R RSP ++ + +K
Sbjct: 52 PRDRRRYDSRSPRSLRYSSVRRSRDRPRRRSRSVRSIEQHRRRLRDRSPSNQWRKDDKKR 111
Query: 63 SLYWDVPPPGFEHVSPSQYKAMQAA------------------------AAAAVPVVGST 98
S WD+ PPG+E V+ Q KA Q V
Sbjct: 112 S-LWDIKPPGYELVTADQAKASQVFSVPGTAPRPAMTDPEKLLAEGSIITPLPVLPYQQQ 170
Query: 99 ITRQARRLYVGNIPFGVTE 117
TRQARRLYVG IP E
Sbjct: 171 ATRQARRLYVGGIPPEFVE 189
|
These splicing factors consist of an N-terminal arginine-rich low complexity domain followed by three tandem RNA recognition motifs (pfam00076). The well-characterized members of this family are auxilliary components of the U2 small nuclear ribonuclearprotein splicing factor (U2AF). These proteins are closely related to the CC1-like subfamily of splicing factors (TIGR01622). Members of this subfamily are found in plants, metazoa and fungi. Length = 509 |
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|240676 cd12230, RRM1_U2AF65, RNA recognition motif 1 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >gnl|CDD|236779 PRK10864, PRK10864, putative methyltransferase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 99.28 | |
| KOG0120|consensus | 500 | 99.21 | ||
| PF06495 | 182 | Transformer: Fruit fly transformer protein; InterP | 98.58 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 97.59 | |
| TIGR01622 | 457 | SF-CC1 splicing factor, CC1-like family. A homolog | 95.18 | |
| PLN03134 | 144 | glycine-rich RNA-binding protein 4; Provisional | 89.58 | |
| COG0724 | 306 | RNA-binding proteins (RRM domain) [General functio | 87.54 | |
| TIGR01642 | 509 | U2AF_lg U2 snRNP auxilliary factor, large subunit, | 85.41 | |
| KOG0126|consensus | 219 | 84.24 | ||
| TIGR01661 | 352 | ELAV_HUD_SF ELAV/HuD family splicing factor. These | 83.58 | |
| TIGR01648 | 578 | hnRNP-R-Q heterogeneous nuclear ribonucleoprotein | 80.9 | |
| TIGR01645 | 612 | half-pint poly-U binding splicing factor, half-pin | 80.29 |
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
Probab=99.28 E-value=3e-12 Score=106.62 Aligned_cols=57 Identities=46% Similarity=0.675 Sum_probs=44.2
Q ss_pred cCCCCCCCCCCCCCCCChhHHHHHHH---hhh---------------------ccCCCCCCccccccceeEeecCCCCCC
Q psy8255 61 KASLYWDVPPPGFEHVSPSQYKAMQA---AAA---------------------AAVPVVGSTITRQARRLYVGNIPFGVT 116 (117)
Q Consensus 61 k~~s~WDv~PpG~E~vta~QaK~mq~---ag~---------------------~~~p~~~~~~SRQaRRLYVGNLP~~vt 116 (117)
+....||.+|++|+.+++.|++++++ ++. .+++++.+++++++++|||||||+++|
T Consensus 109 ~~~~~~d~~p~~~~~~~~~~~~~~~~~~~p~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~lyVgnLp~~~t 188 (509)
T TIGR01642 109 KKRSLWDIKPPGYELVTADQAKASQVFSVPGTAPRPAMTDPEKLLAEGSIITPLPVLPYQQQATRQARRLYVGGIPPEFV 188 (509)
T ss_pred ccccccccCCCcccccchHHHhhccccCCCCCCCCCCCCCcccccccccccCCccccccCccCCccccEEEEeCCCCCCC
Confidence 34578999999999999999997642 220 011235678899999999999999998
Q ss_pred C
Q psy8255 117 E 117 (117)
Q Consensus 117 E 117 (117)
|
T Consensus 189 ~ 189 (509)
T TIGR01642 189 E 189 (509)
T ss_pred H
Confidence 6
|
Members of this subfamily are found in plants, metazoa and fungi. |
| >KOG0120|consensus | Back alignment and domain information |
|---|
| >PF06495 Transformer: Fruit fly transformer protein; InterPro: IPR010519 This family consists of transformer proteins from several Drosophila species and also from Ceratitis capitata (Mediterranean fruit fly) | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >TIGR01622 SF-CC1 splicing factor, CC1-like family | Back alignment and domain information |
|---|
| >PLN03134 glycine-rich RNA-binding protein 4; Provisional | Back alignment and domain information |
|---|
| >COG0724 RNA-binding proteins (RRM domain) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor | Back alignment and domain information |
|---|
| >KOG0126|consensus | Back alignment and domain information |
|---|
| >TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor | Back alignment and domain information |
|---|
| >TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family | Back alignment and domain information |
|---|
| >TIGR01645 half-pint poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 117 | ||||
| 1jmt_B | 28 | X-Ray Structure Of A Core U2af65U2AF35 HETERODIMER | 5e-07 |
| >pdb|1JMT|B Chain B, X-Ray Structure Of A Core U2af65U2AF35 HETERODIMER Length = 28 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 117 | |||
| 1jmt_B | 28 | Splicing factor U2AF 65 kDa subunit; RRM, RNA spli | 6e-10 | |
| 2hzc_A | 87 | Splicing factor U2AF 65 kDa subunit; RNA splicing, | 7e-06 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 5e-04 |
| >1jmt_B Splicing factor U2AF 65 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} Length = 28 | Back alignment and structure |
|---|
Score = 49.8 bits (118), Expect = 6e-10
Identities = 20/28 (71%), Positives = 24/28 (85%)
Query: 59 RRKASLYWDVPPPGFEHVSPSQYKAMQA 86
++K YWDVPPPGFEH++P QYKAMQA
Sbjct: 1 KKKVRKYWDVPPPGFEHITPMQYKAMQA 28
|
| >2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| 1jmt_B | 28 | Splicing factor U2AF 65 kDa subunit; RRM, RNA spli | 99.47 | |
| 4fxv_A | 99 | ELAV-like protein 1; RNA recognition motif, putati | 95.41 | |
| 2cpz_A | 115 | CUG triplet repeat RNA-binding protein 1; RRM doma | 94.99 | |
| 1oo0_B | 110 | CG8781-PA, drosophila Y14; RNA recognition motif, | 94.83 | |
| 2e5j_A | 97 | Methenyltetrahydrofolate synthetase domain contain | 94.82 | |
| 2err_A | 109 | Ataxin-2-binding protein 1; protein-RNA complex, R | 94.78 | |
| 1p27_B | 106 | RNA-binding protein 8A; nuclear protein, mRNA spli | 94.72 | |
| 1u6f_A | 139 | Tcubp1, RNA-binding protein UBP1; trypanosome, mRN | 94.45 | |
| 2hgm_A | 126 | HNRPF protein, heterogeneous nuclear ribonucleopro | 94.37 | |
| 2i2y_A | 150 | Fusion protein consists of immunoglobin G- binding | 94.16 | |
| 2cq4_A | 114 | RNA binding motif protein 23; RRM domain, structur | 94.09 | |
| 1x5o_A | 114 | RNA binding motif, single-stranded interacting pro | 93.96 | |
| 2cpx_A | 115 | Hypothetical protein FLJ11016; RRM domain, structu | 93.94 | |
| 2jvr_A | 111 | Nucleolar protein 3; RNA recognition motif, nucleu | 93.88 | |
| 2khc_A | 118 | Testis-specific RNP-type RNA binding protein; RRM, | 93.82 | |
| 2la4_A | 101 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 93.78 | |
| 2ad9_A | 119 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 93.72 | |
| 1rk8_A | 165 | CG8781-PA, CG8781-PA protein; mRNA processing, RRM | 93.7 | |
| 2jrs_A | 108 | RNA-binding protein 39; RNA binding motif of RBM39 | 93.66 | |
| 3r27_A | 100 | HnRNP L, heterogeneous nuclear ribonucleoprotein L | 93.62 | |
| 1wel_A | 124 | RNA-binding protein 12; structural genomics, NPPSF | 93.6 | |
| 3ulh_A | 107 | THO complex subunit 4; nuclear protein, RNA bindin | 93.59 | |
| 1x4b_A | 116 | Heterogeneous nuclear ribonucleoproteins A2/B1; st | 93.51 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 93.48 | |
| 2xnq_A | 97 | Nuclear polyadenylated RNA-binding protein 3; tran | 93.45 | |
| 2jvo_A | 108 | Nucleolar protein 3; nucleus, phosphorylation, rib | 93.36 | |
| 2a3j_A | 127 | U1 small nuclear ribonucleoprotein A; computationa | 93.27 | |
| 1x4g_A | 109 | Nucleolysin TIAR; structural genomics, RRM domain, | 93.25 | |
| 2hgl_A | 136 | HNRPF protein, heterogeneous nuclear ribonucleopro | 93.23 | |
| 2rs2_A | 109 | Musashi-1, RNA-binding protein musashi homolog 1; | 93.18 | |
| 3egn_A | 143 | RNA-binding protein 40; RNA recognition motif (RRM | 93.13 | |
| 1x4f_A | 112 | Matrin 3; structural genomics, RRM domain, NPPSFA, | 92.93 | |
| 3n9u_C | 156 | Cleavage and polyadenylation specificity factor S; | 92.78 | |
| 2lea_A | 135 | Serine/arginine-rich splicing factor 2; SR protein | 92.59 | |
| 2jwn_A | 124 | Embryonic polyadenylate-binding protein 2-B; epabp | 92.56 | |
| 2hgn_A | 139 | Heterogeneous nuclear ribonucleoprotein F; RNA rec | 92.32 | |
| 2kt5_A | 124 | RNA and export factor-binding protein 2; chaperone | 92.28 | |
| 1wf1_A | 110 | RNA-binding protein RALY; structural genomics, RRM | 92.15 | |
| 1h2v_Z | 156 | 20 kDa nuclear CAP binding protein; CAP-binding-co | 91.84 | |
| 2kn4_A | 158 | Immunoglobulin G-binding protein G, splicing FACT | 91.73 | |
| 3pgw_S | 437 | U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM | 91.63 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 91.43 | |
| 2kxn_B | 129 | Transformer-2 protein homolog beta; SR protein, RR | 90.57 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 90.53 | |
| 4f25_A | 115 | Polyadenylate-binding protein 1; RRM fold, transla | 89.95 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 89.76 | |
| 1sjr_A | 164 | Polypyrimidine tract-binding protein 1; extended b | 89.51 | |
| 3zzy_A | 130 | Polypyrimidine tract-binding protein 1; protein bi | 89.37 | |
| 2f3j_A | 177 | RNA and export factor binding protein 2; RRM domai | 88.9 | |
| 2adc_A | 229 | Polypyrimidine tract-binding protein 1; RBD, RRM, | 88.24 | |
| 1fje_B | 175 | Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin | 88.09 | |
| 2voo_A | 193 | Lupus LA protein; RNA-binding protein, RNA recogni | 87.99 | |
| 2e5i_A | 124 | Heterogeneous nuclear ribonucleoprotein L-like; RR | 87.94 | |
| 1l3k_A | 196 | Heterogeneous nuclear ribonucleoprotein A1; nuclea | 87.49 | |
| 3nmr_A | 175 | Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl | 86.78 | |
| 2g4b_A | 172 | Splicing factor U2AF 65 kDa subunit; protein-RNA c | 85.59 | |
| 2yh0_A | 198 | Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli | 85.52 | |
| 2cjk_A | 167 | Nuclear polyadenylated RNA-binding protein 4; HRP1 | 85.11 | |
| 3tyt_A | 205 | Heterogeneous nuclear ribonucleoprotein L; ferredo | 84.46 | |
| 3md3_A | 166 | Nuclear and cytoplasmic polyadenylated RNA-bindin | 84.33 | |
| 4f02_A | 213 | Polyadenylate-binding protein 1; mRNA, eukaryotic | 83.7 | |
| 1fxl_A | 167 | Paraneoplastic encephalomyelitis antigen HUD; prot | 83.1 | |
| 2qfj_A | 216 | FBP-interacting repressor; protein-DNA complex; HE | 81.77 | |
| 2ghp_A | 292 | U4/U6 snRNA-associated splicing factor PRP24; RNA | 81.64 | |
| 1b7f_A | 168 | Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP | 80.81 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 80.44 |
| >1jmt_B Splicing factor U2AF 65 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.47 E-value=8.1e-15 Score=83.22 Aligned_cols=27 Identities=74% Similarity=1.431 Sum_probs=21.6
Q ss_pred ccCCCCCCCCCCCCCCCChhHHHHHHH
Q psy8255 60 RKASLYWDVPPPGFEHVSPSQYKAMQA 86 (117)
Q Consensus 60 rk~~s~WDv~PpG~E~vta~QaK~mq~ 86 (117)
++++++|||||||||+|||+|||+||+
T Consensus 2 r~p~~~WDvpP~GyE~vtp~qykamq~ 28 (28)
T 1jmt_B 2 KKVRKYWDVPPPGFEHITPMQYKAMQA 28 (28)
T ss_dssp ----CCBTCCCTTCTTSCHHHHHHTCC
T ss_pred CCcccccCCCCCCccccCHHHHhhccC
Confidence 466779999999999999999999874
|
| >4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A | Back alignment and structure |
|---|
| >1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* | Back alignment and structure |
|---|
| >2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A | Back alignment and structure |
|---|
| >2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A | Back alignment and structure |
|---|
| >2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A | Back alignment and structure |
|---|
| >2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A | Back alignment and structure |
|---|
| >2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} | Back alignment and structure |
|---|
| >1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A | Back alignment and structure |
|---|
| >1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A | Back alignment and structure |
|---|
| >2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A | Back alignment and structure |
|---|
| >2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A | Back alignment and structure |
|---|
| >2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 | Back alignment and structure |
|---|
| >3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A | Back alignment and structure |
|---|
| >2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} | Back alignment and structure |
|---|
| >2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A | Back alignment and structure |
|---|
| >2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A | Back alignment and structure |
|---|
| >1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X | Back alignment and structure |
|---|
| >2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} | Back alignment and structure |
|---|
| >3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C | Back alignment and structure |
|---|
| >1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A | Back alignment and structure |
|---|
| >3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A | Back alignment and structure |
|---|
| >2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A | Back alignment and structure |
|---|
| >1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A | Back alignment and structure |
|---|
| >2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A | Back alignment and structure |
|---|
| >2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A | Back alignment and structure |
|---|
| >3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A | Back alignment and structure |
|---|
| >2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A | Back alignment and structure |
|---|
| >2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A | Back alignment and structure |
|---|
| >2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C | Back alignment and structure |
|---|
| >3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A | Back alignment and structure |
|---|
| >3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* | Back alignment and structure |
|---|
| >1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A | Back alignment and structure |
|---|
| >2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A | Back alignment and structure |
|---|
| >2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A | Back alignment and structure |
|---|
| >1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| d1u6fa1 | 139 | RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId | 94.16 | |
| d1x4ga1 | 96 | Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 | 93.92 | |
| d1u1qa_ | 183 | Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human | 88.01 |
| >d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: RNA-binding domain, RBD family: Canonical RBD domain: RNA-binding protein UBP1 species: Trypanosoma cruzi [TaxId: 5693]
Probab=94.16 E-value=0.007 Score=40.31 Aligned_cols=16 Identities=44% Similarity=0.497 Sum_probs=13.5
Q ss_pred ccceeEeecCCCCCCC
Q psy8255 102 QARRLYVGNIPFGVTE 117 (117)
Q Consensus 102 QaRRLYVGNLP~~vtE 117 (117)
..+.|||||||+++||
T Consensus 41 ~~~~l~V~nLp~~~te 56 (139)
T d1u6fa1 41 VLRNLMVNYIPTTVDE 56 (139)
T ss_dssp TTSEEEEESCSTTCCH
T ss_pred CCCEEEEeCCCCCCCH
Confidence 3457999999999986
|
| >d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|