Psyllid ID: psy8308


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MDPNYLSILKGRDTALEKIYKEKQLHRIFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLAYKGRTVLSLPQLRLLSASLSHNNIPGESMLHSDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIWGPLLSARCGGVLIIPRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLMFLKMTGTN
ccHHHHHHHHHcccccccccccccHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccEEEEcccHHHHcccccccEEEEccHHHHHHHccccccccccccccccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHcccc
cHHHHHHHHHHHcccHccccccHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHccccEccccccccHHHHHHHHHHcccEEEEEcHHHHHHcccccccEEEEcccHHHHHHcccHHHHHccccccccccccccccEEEEEEEccccccccccEccHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHcccc
MDPNYLSILKGRDTALEKIYKEKQLHRIFEknaalspdntalifeeqdkdtLVITNETYSELNSASNQLARGLLHFLhtkavpnenqdgdhiVAVSLAPSSGLIQVLLAVWKAGaaylpldvtapeQRVKHILNEARPLLVIAENEQACENLAykgrtvlslpQLRLLSASlshnnipgesmlhsdnnneqsNDIAIVLYTsgstgipkgvrlphEVILNRLAwqwatfpyspservgaFKTALTFVDAVSEIWGpllsarcggvliiprdvtrnpdqliGTLEKYKVERLVLVPSLLRSMLMFLKMTGTN
mdpnylsilkgrDTALEKIYKEKQLHRIFeknaalspdnTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLAYKGRTVLSLPQLRLLSASLSHNNIPGESMLHSDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIWGPLLSARCGGvliiprdvtrnPDQLigtlekykverLVLVPSLLRSMLMFLKMTGTN
MDPNYLSILKGRDTALEKIYKEKQLHRIFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLAYKGRTVLSLPQLRLLSASLSHNNIPGESMLHSDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIWGPLLSARCGGVLIIPRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLMFLKMTGTN
*****LSILKGRDTALEKIYKEKQLHRIFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLAYKGRTVLSLPQLRLLS************************DIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIWGPLLSARCGGVLIIPRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLMFLK*****
MDPNYLSILKGRDTALEKIYKEKQLHRIFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLAYKGRTVLSLPQLRLLSASLSHNNI***********NEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIWGPLLSARCGGVLIIPRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLMFL******
MDPNYLSILKGRDTALEKIYKEKQLHRIFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLAYKGRTVLSLPQLRLLSASLSHNNIPGESMLHSDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIWGPLLSARCGGVLIIPRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLMFLKMTGTN
MDPNYLSILKGRDTALEKIYKEKQLHRIFEKNAALSPDNTALIFEEQDK**L*ITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLAYKGRTVLSLPQLRLLSASLSHNNIPGESMLHSDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIWGPLLSARCGGVLIIPRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLMFLKMT***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPNYLSILKGRDTALEKIYKEKQLHRIFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLAYKGRTVLSLPQLRLLSASLSHNNIPGESMLHSDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIWGPLLSARCGGVLIIPRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLMFLKMTGTN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
FB|FBgn0000527 879 e "ebony" [Drosophila melanoga 0.929 0.328 0.477 6.3e-69
UNIPROTKB|Q81QP7 2385 dhbF "Nonribosomal peptide syn 0.726 0.094 0.323 5.3e-27
TIGR_CMR|BA_2372 2385 BA_2372 "nonribosomal peptide 0.726 0.094 0.323 5.3e-27
UNIPROTKB|Q4KES9 4901 ofaC "Non-ribosomal peptide sy 0.639 0.040 0.342 1.8e-23
UNIPROTKB|Q4KCD8 6675 rzxB "Polyketide synthase/nonr 0.700 0.032 0.338 1.1e-22
UNIPROTKB|Q4KET0 4367 ofaB "Non-ribosomal peptide sy 0.697 0.049 0.314 1.3e-21
UNIPROTKB|Q48KC2 2151 PSPPH_1925 "Pyoverdine sidecha 0.665 0.096 0.313 1.5e-21
ASPGD|ASPL0000037093 3770 acvA [Emericella nidulans (tax 0.839 0.069 0.292 6.3e-21
UNIPROTKB|Q0VZ70 3912 cmdD "Chondramide synthase cmd 0.823 0.065 0.333 2.8e-20
TAIR|locus:2142908 1040 AT5G35930 [Arabidopsis thalian 0.684 0.204 0.328 5e-20
FB|FBgn0000527 e "ebony" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 699 (251.1 bits), Expect = 6.3e-69, P = 6.3e-69
 Identities = 146/306 (47%), Positives = 204/306 (66%)

Query:     6 LSILKGRDTALEKIYKEKQLHRIFEKNAALSPDNTALIFEEQDKDT-LVITNETYSELNS 64
             LSI+KG    L++ +  + LHRIFE+      D  ALI++       +  +  +Y ++N 
Sbjct:     7 LSIVKG----LQQDFVPRALHRIFEEQQLRHADKVALIYQPSTTGQGMAPSQSSYRQMNE 62

Query:    65 ASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTA 124
              +N+ AR L+   H + +   N DGD IVAV + PS GL+  LLA+WKAG AYLP+D + 
Sbjct:    63 RANRAARLLVAETHGRFL-QPNSDGDFIVAVCMQPSEGLVTTLLAIWKAGGAYLPIDPSF 121

Query:   125 PEQRVKHILNEARPLLVIAENEQACENLAYKGRTVLSLPQLRLLSASLSHNNIPGESMLH 184
             P  R+ HIL EA+P LVI +++   +   ++G   LS  +L   S  L+ +N+  E ML 
Sbjct:   122 PANRIHHILLEAKPTLVIRDDD--IDAGRFQGTPTLSTTELYAKSLQLAGSNLLSEEMLR 179

Query:   185 SDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTAL 244
               N++      AIVLYTSGSTG+PKGVRLPHE ILNRL WQWATFPY+ +E V  FKTAL
Sbjct:   180 GGNDHT-----AIVLYTSGSTGVPKGVRLPHESILNRLQWQWATFPYTANEAVSVFKTAL 234

Query:   245 TFVDAVSEIWGPLLSARCG-GVLIIPRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLM 303
             TFVD+++E+WGPL+   CG  +L++P+ VT++P +L+  LE+YK+ RLVLVP+LLRS+LM
Sbjct:   235 TFVDSIAELWGPLM---CGLAILVVPKAVTKDPQRLVALLERYKIRRLVLVPTLLRSLLM 291

Query:   304 FLKMTG 309
             +LKM G
Sbjct:   292 YLKMEG 297




GO:0007593 "chitin-based cuticle sclerotization" evidence=IMP
GO:0003833 "beta-alanyl-dopamine synthase activity" evidence=IDA;IMP;TAS
GO:0045475 "locomotor rhythm" evidence=NAS
GO:0007623 "circadian rhythm" evidence=NAS
GO:0048067 "cuticle pigmentation" evidence=IGI;IMP
GO:0048022 "negative regulation of melanin biosynthetic process" evidence=IMP
GO:0042440 "pigment metabolic process" evidence=TAS
GO:0001692 "histamine metabolic process" evidence=IMP
GO:0048066 "developmental pigmentation" evidence=TAS
GO:0006583 "melanin biosynthetic process from tyrosine" evidence=TAS
GO:0042417 "dopamine metabolic process" evidence=IDA
GO:0043042 "amino acid adenylylation by nonribosomal peptide synthase" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0048082 "regulation of adult chitin-containing cuticle pigmentation" evidence=IGI;IMP
UNIPROTKB|Q81QP7 dhbF "Nonribosomal peptide synthetase DhbF" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_2372 BA_2372 "nonribosomal peptide synthetase DhbF" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KES9 ofaC "Non-ribosomal peptide synthetase OfaC" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KCD8 rzxB "Polyketide synthase/nonribosomal peptide synthetase hybrid RzxB" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KET0 ofaB "Non-ribosomal peptide synthetase OfaB" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q48KC2 PSPPH_1925 "Pyoverdine sidechain peptide synthetase III, L-Thr-L-Ser component" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
ASPGD|ASPL0000037093 acvA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VZ70 cmdD "Chondramide synthase cmdD" [Chondromyces crocatus (taxid:52)] Back     alignment and assigned GO terms
TAIR|locus:2142908 AT5G35930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
cd05930 445 cd05930, A_NRPS, The adenylation domain of nonribo 8e-60
pfam00501 412 pfam00501, AMP-binding, AMP-binding enzyme 1e-47
TIGR01733 409 TIGR01733, AA-adenyl-dom, amino acid adenylation d 2e-46
cd05918 447 cd05918, A_NRPS_SidN3_like, The adenylation (A) do 9e-37
cd12117 474 cd12117, A_NRPS_Srf_like, The adenylation domain o 1e-36
COG1020 642 COG1020, EntF, Non-ribosomal peptide synthetase mo 1e-36
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 6e-36
cd12116 438 cd12116, A_NRPS_Ta1_like, The adenylation domain o 1e-35
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 9e-35
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 3e-33
PRK10252 1296 PRK10252, entF, enterobactin synthase subunit F; P 5e-33
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 6e-32
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 5e-31
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 3e-29
cd12115 449 cd12115, A_NRPS_Sfm_like, The adenylation domain o 4e-29
cd12114 476 cd12114, A_NRPS_TlmIV_like, The adenylation domain 6e-28
COG0318 534 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ 8e-27
cd05945 447 cd05945, DltA, D-alanine:D-alanyl carrier protein 1e-26
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 2e-24
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 5e-23
COG0365 528 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat 6e-22
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 2e-20
TIGR01734 502 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phospho 2e-19
cd05936 468 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain 5e-18
cd05911 487 cd05911, Firefly_Luc_like, Firefly luciferase of l 1e-17
PRK04813 503 PRK04813, PRK04813, D-alanine--poly(phosphoribitol 2e-17
cd05941 430 cd05941, MCS, Malonyl-CoA synthetase (MCS) 2e-16
PRK08279 600 PRK08279, PRK08279, long-chain-acyl-CoA synthetase 4e-14
PRK07798 533 PRK07798, PRK07798, acyl-CoA synthetase; Validated 7e-14
cd04433 338 cd04433, AFD_class_I, Adenylate forming domain, Cl 9e-14
PRK06187 521 PRK06187, PRK06187, long-chain-fatty-acid--CoA lig 7e-13
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 1e-12
PRK07656 513 PRK07656, PRK07656, long-chain-fatty-acid--CoA lig 6e-12
cd05920 483 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l 7e-12
COG1022 613 COG1022, FAA1, Long-chain acyl-CoA synthetases (AM 1e-11
PRK06839 496 PRK06839, PRK06839, acyl-CoA synthetase; Validated 2e-11
cd05931 547 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) 2e-11
cd05904 504 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) 6e-11
cd05971 439 cd05971, MACS_like_3, Uncharacterized subfamily of 8e-11
TIGR03098 517 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-form 4e-10
PRK09274 552 PRK09274, PRK09274, peptide synthase; Provisional 5e-10
cd05973 440 cd05973, MACS_like_2, Uncharacterized subfamily of 6e-10
cd05907 456 cd05907, VL_LC_FACS_like, Long-chain fatty acid Co 7e-10
TIGR03443 1389 TIGR03443, alpha_am_amid, L-aminoadipate-semialdeh 1e-09
cd05929 342 cd05929, BACL_like, Bacterial Bile acid CoA ligase 3e-09
cd05927 539 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty 5e-09
PRK08316 523 PRK08316, PRK08316, acyl-CoA synthetase; Validated 8e-09
cd05959 506 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 3e-08
PRK03640 483 PRK03640, PRK03640, O-succinylbenzoic acid--CoA li 4e-08
cd05910 455 cd05910, FACL_like_1, Uncharacterized subfamily of 6e-08
PRK06087 547 PRK06087, PRK06087, short chain acyl-CoA synthetas 7e-08
cd05934 421 cd05934, FACL_DitJ_like, Uncharacterized subfamily 9e-08
cd05903 437 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li 1e-07
cd05935 430 cd05935, LC_FACS_like, Putative long-chain fatty a 2e-07
PRK07514 504 PRK07514, PRK07514, malonyl-CoA synthase; Validate 3e-07
cd05919 436 cd05919, BCL_like, Benzoate CoA ligase (BCL) and s 3e-07
PRK07788 549 PRK07788, PRK07788, acyl-CoA synthetase; Validated 4e-07
PRK12583 558 PRK12583, PRK12583, acyl-CoA synthetase; Provision 7e-07
cd05922 350 cd05922, FACL_like_6, Uncharacterized subfamily of 8e-07
cd05906 560 cd05906, A_NRPS_TubE_like, The adenylation domain 8e-07
PRK08276 502 PRK08276, PRK08276, long-chain-fatty-acid--CoA lig 8e-07
PRK06155 542 PRK06155, PRK06155, crotonobetaine/carnitine-CoA l 1e-06
PRK07786 542 PRK07786, PRK07786, long-chain-fatty-acid--CoA lig 1e-06
cd05914 448 cd05914, FACL_like_3, Uncharacterized subfamily of 1e-06
TIGR01923 436 TIGR01923, menE, O-succinylbenzoate-CoA ligase 2e-06
cd05917 347 cd05917, FACL_like_2, Uncharacterized subfamily of 2e-06
PRK05691 4334 PRK05691, PRK05691, peptide synthase; Validated 3e-06
PRK07787 471 PRK07787, PRK07787, acyl-CoA synthetase; Validated 3e-06
PRK08315 559 PRK08315, PRK08315, AMP-binding domain protein; Va 3e-06
PLN02387 696 PLN02387, PLN02387, long-chain-fatty-acid-CoA liga 5e-06
cd05940 444 cd05940, FATP_FACS, Fatty acid transport proteins 7e-06
PRK08008 517 PRK08008, caiC, putative crotonobetaine/carnitine- 1e-05
PRK08314 546 PRK08314, PRK08314, long-chain-fatty-acid--CoA lig 2e-05
PRK06145 497 PRK06145, PRK06145, acyl-CoA synthetase; Validated 3e-05
PRK06814 1140 PRK06814, PRK06814, acylglycerophosphoethanolamine 3e-05
PRK07638 487 PRK07638, PRK07638, acyl-CoA synthetase; Validated 3e-05
cd05938 535 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport 4e-05
cd05909 489 cd05909, AAS_C, C-terminal domain of the acyl-acyl 4e-05
PRK04319 570 PRK04319, PRK04319, acetyl-CoA synthetase; Provisi 5e-05
cd12118 520 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt 7e-05
PRK05850 578 PRK05850, PRK05850, acyl-CoA synthetase; Validated 8e-05
PRK13391 511 PRK13391, PRK13391, acyl-CoA synthetase; Provision 1e-04
cd05924 365 cd05924, FACL_like_5, Uncharacterized subfamily of 2e-04
cd05972 430 cd05972, MACS_like, Medium-chain acyl-CoA syntheta 3e-04
cd05958 487 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) 5e-04
PRK06178 567 PRK06178, PRK06178, acyl-CoA synthetase; Validated 6e-04
PLN02574 560 PLN02574, PLN02574, 4-coumarate--CoA ligase-like 7e-04
cd05912 407 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase 7e-04
cd05908 499 cd05908, A_NRPS_MycA_like, The adenylation domain 8e-04
PRK07059 557 PRK07059, PRK07059, Long-chain-fatty-acid--CoA lig 0.001
PRK06188 524 PRK06188, PRK06188, acyl-CoA synthetase; Validated 0.001
PRK13382 537 PRK13382, PRK13382, acyl-CoA synthetase; Provision 0.001
PLN02736 651 PLN02736, PLN02736, long-chain acyl-CoA synthetase 0.001
PRK08633 1146 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanola 0.001
PRK09088 488 PRK09088, PRK09088, acyl-CoA synthetase; Validated 0.001
cd05926 345 cd05926, FACL_fum10p_like, Subfamily of fatty acid 0.001
PLN02430 660 PLN02430, PLN02430, long-chain-fatty-acid-CoA liga 0.001
cd05932 504 cd05932, LC_FACS_bac, Bacterial long-chain fatty a 0.001
PRK07768 545 PRK07768, PRK07768, long-chain-fatty-acid--CoA lig 0.002
PRK05605 573 PRK05605, PRK05605, long-chain-fatty-acid--CoA lig 0.002
PRK12406 509 PRK12406, PRK12406, long-chain-fatty-acid--CoA lig 0.002
PRK05852 534 PRK05852, PRK05852, acyl-CoA synthetase; Validated 0.002
cd05933 594 cd05933, ACSBG_like, Bubblegum-like very long-chai 0.002
cd05969 443 cd05969, MACS_like_4, Uncharacterized subfamily of 0.002
cd05921 559 cd05921, FCS, Feruloyl-CoA synthetase (FCS) 0.002
TIGR02188 625 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase 0.002
PLN02860 563 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase 0.002
cd05944 359 cd05944, FACL_like_4, Uncharacterized subfamily of 0.003
PRK05620 576 PRK05620, PRK05620, long-chain-fatty-acid--CoA lig 0.003
TIGR02275 526 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP 0.004
PRK08974 560 PRK08974, PRK08974, long-chain-fatty-acid--CoA lig 0.004
>gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
 Score =  196 bits (502), Expect = 8e-60
 Identities = 85/271 (31%), Positives = 133/271 (49%), Gaps = 69/271 (25%)

Query: 37  PDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVS 96
           PD  A++F +Q   +L     TY ELN  +N+LA    H+L  + V         +VA+ 
Sbjct: 1   PDAVAVVFGDQ---SL-----TYRELNERANRLA----HYLRARGVGPG-----DLVAIC 43

Query: 97  LAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLAYKG 156
           L  S  ++  +LAV KAGAAY+PLD   P +R+ ++L ++   L++ + +    +LAY  
Sbjct: 44  LERSPEMVVAILAVLKAGAAYVPLDPAYPAERLAYMLEDSGAKLLLTDPD----DLAY-- 97

Query: 157 RTVLSLPQLRLLSASLSHNNIPGESMLHSDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHE 216
                                                    V+YTSGSTG PKGV + H 
Sbjct: 98  -----------------------------------------VIYTSGSTGRPKGVMVEHR 116

Query: 217 VILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIWGPLLSARCGGVLII-PRDVTRN 275
            ++N LAW    +  +  +RV     + +F  +V EI+ PLLS   G  L++ P +V R+
Sbjct: 117 GLVNLLAWLQERYGLTAGDRV-LQFASFSFDASVWEIFPPLLS---GATLVLAPPEVLRD 172

Query: 276 PDQLIGTLEKYKVERLVLVPSLLRSMLMFLK 306
           P+ L   L ++++  L LVPSLLR++L  L+
Sbjct: 173 PEALAELLREHRITVLHLVPSLLRALLDALE 203


The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions. Length = 445

>gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme Back     alignment and domain information
>gnl|CDD|233550 TIGR01733, AA-adenyl-dom, amino acid adenylation domain Back     alignment and domain information
>gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
>gnl|CDD|213325 cd12117, A_NRPS_Srf_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C) Back     alignment and domain information
>gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|213324 cd12116, A_NRPS_Ta1_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including salinosporamide A polyketide synthase Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|236668 PRK10252, entF, enterobactin synthase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|213323 cd12115, A_NRPS_Sfm_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Saframycin A gene cluster from Streptomyces lavendulae Back     alignment and domain information
>gnl|CDD|213322 cd12114, A_NRPS_TlmIV_like, The adenylation domain of nonribosomal peptide synthetases (NRPS), including Streptoalloteichus tallysomycin biosynthesis genes Back     alignment and domain information
>gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|233551 TIGR01734, D-ala-DACP-lig, D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD Back     alignment and domain information
>gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|235313 PRK04813, PRK04813, D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) Back     alignment and domain information
>gnl|CDD|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236100 PRK07798, PRK07798, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I Back     alignment and domain information
>gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) Back     alignment and domain information
>gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|213318 cd05971, MACS_like_3, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|211788 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-forming), exosortase A-associated Back     alignment and domain information
>gnl|CDD|236443 PRK09274, PRK09274, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|213320 cd05973, MACS_like_2, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases Back     alignment and domain information
>gnl|CDD|234212 TIGR03443, alpha_am_amid, L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins Back     alignment and domain information
>gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) Back     alignment and domain information
>gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213312 cd05959, BCL_4HBCL, Benzoate CoA ligase (BCL) and 4-Hydroxybenzoate-Coenzyme A Ligase (4-HBA-CoA ligase) Back     alignment and domain information
>gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213278 cd05910, FACL_like_1, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|180393 PRK06087, PRK06087, short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) Back     alignment and domain information
>gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase Back     alignment and domain information
>gnl|CDD|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated Back     alignment and domain information
>gnl|CDD|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes Back     alignment and domain information
>gnl|CDD|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents Back     alignment and domain information
>gnl|CDD|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235719 PRK06155, PRK06155, crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213282 cd05914, FACL_like_3, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|235564 PRK05691, PRK05691, peptide synthase; Validated Back     alignment and domain information
>gnl|CDD|236096 PRK07787, PRK07787, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|215217 PLN02387, PLN02387, long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>gnl|CDD|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes Back     alignment and domain information
>gnl|CDD|181195 PRK08008, caiC, putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|235865 PRK06814, PRK06814, acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|236071 PRK07638, PRK07638, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213304 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins Back     alignment and domain information
>gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) Back     alignment and domain information
>gnl|CDD|235279 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis Back     alignment and domain information
>gnl|CDD|235624 PRK05850, PRK05850, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213291 cd05924, FACL_like_5, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|213311 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) Back     alignment and domain information
>gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like Back     alignment and domain information
>gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) Back     alignment and domain information
>gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) Back     alignment and domain information
>gnl|CDD|235923 PRK07059, PRK07059, Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|172019 PRK13382, PRK13382, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178337 PLN02736, PLN02736, long-chain acyl-CoA synthetase Back     alignment and domain information
>gnl|CDD|236315 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>gnl|CDD|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis Back     alignment and domain information
>gnl|CDD|178049 PLN02430, PLN02430, long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase Back     alignment and domain information
>gnl|CDD|236091 PRK07768, PRK07768, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|183506 PRK12406, PRK12406, long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213299 cd05933, ACSBG_like, Bubblegum-like very long-chain fatty acid CoA synthetase (VL-FACS) Back     alignment and domain information
>gnl|CDD|213316 cd05969, MACS_like_4, Uncharacterized subfamily of Acetyl-CoA synthetase like family (ACS) Back     alignment and domain information
>gnl|CDD|213288 cd05921, FCS, Feruloyl-CoA synthetase (FCS) Back     alignment and domain information
>gnl|CDD|233770 TIGR02188, Ac_CoA_lig_AcsA, acetate--CoA ligase Back     alignment and domain information
>gnl|CDD|215464 PLN02860, PLN02860, o-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|180167 PRK05620, PRK05620, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|233807 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 311
COG1022 613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 100.0
COG0365 528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 100.0
PLN02614 666 long-chain acyl-CoA synthetase 100.0
COG0318 534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 100.0
KOG1177|consensus 596 100.0
PLN02861 660 long-chain-fatty-acid-CoA ligase 100.0
PTZ00342 746 acyl-CoA synthetase; Provisional 100.0
PLN02736 651 long-chain acyl-CoA synthetase 100.0
PRK06334 539 long chain fatty acid--[acyl-carrier-protein] liga 100.0
PLN02654 666 acetate-CoA ligase 100.0
PLN03052 728 acetate--CoA ligase; Provisional 100.0
KOG1256|consensus 691 100.0
PLN02430 660 long-chain-fatty-acid-CoA ligase 100.0
PLN02387 696 long-chain-fatty-acid-CoA ligase family protein 100.0
PLN02860 563 o-succinylbenzoate-CoA ligase 100.0
KOG1176|consensus 537 100.0
PRK08180 614 feruloyl-CoA synthase; Reviewed 100.0
TIGR02316 628 propion_prpE propionate--CoA ligase. This family c 100.0
PTZ00237 647 acetyl-CoA synthetase; Provisional 100.0
TIGR02188 625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 100.0
PTZ00216 700 acyl-CoA synthetase; Provisional 100.0
PRK13295 547 cyclohexanecarboxylate-CoA ligase; Reviewed 100.0
PRK07788 549 acyl-CoA synthetase; Validated 100.0
PRK00174 637 acetyl-CoA synthetase; Provisional 100.0
COG1021 542 EntE Peptide arylation enzymes [Secondary metaboli 100.0
PRK12582 624 acyl-CoA synthetase; Provisional 100.0
PRK07529 632 AMP-binding domain protein; Validated 100.0
PRK05852 534 acyl-CoA synthetase; Validated 100.0
PRK08279 600 long-chain-acyl-CoA synthetase; Validated 100.0
PRK13382 537 acyl-CoA synthetase; Provisional 100.0
PRK08043 718 bifunctional acyl-[acyl carrier protein] synthetas 100.0
PRK09274 552 peptide synthase; Provisional 100.0
KOG1179|consensus 649 100.0
PRK10524 629 prpE propionyl-CoA synthetase; Provisional 100.0
PRK05857 540 acyl-CoA synthetase; Validated 100.0
PRK07638 487 acyl-CoA synthetase; Validated 100.0
PLN02246 537 4-coumarate--CoA ligase 100.0
PLN03102 579 acyl-activating enzyme; Provisional 100.0
TIGR02275 527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 100.0
PRK12467 3956 peptide synthase; Provisional 100.0
PRK06839 496 acyl-CoA synthetase; Validated 100.0
PTZ00297 1452 pantothenate kinase; Provisional 100.0
PRK08008 517 caiC putative crotonobetaine/carnitine-CoA ligase; 100.0
PRK03584 655 acetoacetyl-CoA synthetase; Provisional 100.0
PRK05677 562 long-chain-fatty-acid--CoA ligase; Validated 100.0
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 100.0
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 100.0
PRK06155 542 crotonobetaine/carnitine-CoA ligase; Provisional 100.0
PRK04319 570 acetyl-CoA synthetase; Provisional 100.0
TIGR03208 538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 100.0
TIGR01217 652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 100.0
PRK06060 705 acyl-CoA synthetase; Validated 100.0
PRK12316 5163 peptide synthase; Provisional 100.0
PRK13388 540 acyl-CoA synthetase; Provisional 100.0
PRK12476 612 putative fatty-acid--CoA ligase; Provisional 100.0
PRK06087 547 short chain acyl-CoA synthetase; Reviewed 100.0
PRK05691 4334 peptide synthase; Validated 100.0
PRK12467 3956 peptide synthase; Provisional 100.0
PRK08314 546 long-chain-fatty-acid--CoA ligase; Validated 99.98
PLN02574 560 4-coumarate--CoA ligase-like 99.98
PRK03640 483 O-succinylbenzoic acid--CoA ligase; Provisional 99.98
PRK05605 573 long-chain-fatty-acid--CoA ligase; Validated 99.98
PRK07867 529 acyl-CoA synthetase; Validated 99.98
PRK12316 5163 peptide synthase; Provisional 99.98
PRK12583 558 acyl-CoA synthetase; Provisional 99.98
PRK06164 540 acyl-CoA synthetase; Validated 99.98
PF00501 417 AMP-binding: AMP-binding enzyme; InterPro: IPR0008 99.98
PRK07656 513 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK07769 631 long-chain-fatty-acid--CoA ligase; Validated 99.97
PLN02330 546 4-coumarate--CoA ligase-like 1 99.97
PRK06145 497 acyl-CoA synthetase; Validated 99.97
PLN02479 567 acetate-CoA ligase 99.97
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.97
PRK08315 559 AMP-binding domain protein; Validated 99.97
PRK07786 542 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK08316 523 acyl-CoA synthetase; Validated 99.97
PRK06178 567 acyl-CoA synthetase; Validated 99.97
PRK06188 524 acyl-CoA synthetase; Validated 99.97
PRK05691 4334 peptide synthase; Validated 99.97
PRK06187 521 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK06018 542 putative acyl-CoA synthetase; Provisional 99.97
PRK05620 576 long-chain-fatty-acid--CoA ligase; Validated 99.97
TIGR03205 541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 99.97
TIGR03098 515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 99.97
PRK07470 528 acyl-CoA synthetase; Validated 99.97
PRK10946 536 entE enterobactin synthase subunit E; Provisional 99.97
PRK07514 504 malonyl-CoA synthase; Validated 99.97
PRK08162 545 acyl-CoA synthetase; Validated 99.97
PRK07008 539 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK12492 562 long-chain-fatty-acid--CoA ligase; Provisional 99.97
PRK05850 578 acyl-CoA synthetase; Validated 99.97
TIGR01734 502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 99.97
PRK05851 525 long-chain-fatty-acid--[acyl-carrier-protein] liga 99.97
PRK13383 516 acyl-CoA synthetase; Provisional 99.97
PRK07059 557 Long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK09088 488 acyl-CoA synthetase; Validated 99.97
PRK06710 563 long-chain-fatty-acid--CoA ligase; Validated 99.97
PRK07868 994 acyl-CoA synthetase; Validated 99.97
PRK07798 533 acyl-CoA synthetase; Validated 99.97
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.97
PRK08751 560 putative long-chain fatty acyl CoA ligase; Provisi 99.97
PRK04813 503 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.96
PRK08308 414 acyl-CoA synthetase; Validated 99.96
PRK13390 501 acyl-CoA synthetase; Provisional 99.96
PRK09192 579 acyl-CoA synthetase; Validated 99.96
PRK08974 560 long-chain-fatty-acid--CoA ligase; Validated 99.96
TIGR02262 508 benz_CoA_lig benzoate-CoA ligase family. Character 99.96
PRK07787 471 acyl-CoA synthetase; Validated 99.96
PRK07768 545 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK09029 458 O-succinylbenzoic acid--CoA ligase; Provisional 99.96
PRK07445 452 O-succinylbenzoic acid--CoA ligase; Reviewed 99.96
PRK13391 511 acyl-CoA synthetase; Provisional 99.95
KOG1175|consensus 626 99.95
TIGR01733 408 AA-adenyl-dom amino acid adenylation domain. This 99.95
TIGR03089227 conserved hypothetical protein TIGR03089. This pro 99.95
PRK12406 509 long-chain-fatty-acid--CoA ligase; Provisional 99.94
TIGR01923 436 menE O-succinylbenzoate-CoA ligase. This model rep 99.94
KOG1180|consensus 678 99.94
PRK08276 502 long-chain-fatty-acid--CoA ligase; Validated 99.94
PLN03051 499 acyl-activating enzyme; Provisional 99.93
COG1020 642 EntF Non-ribosomal peptide synthetase modules and 99.92
KOG3628|consensus 1363 99.65
KOG1178|consensus 1032 99.5
TIGR02372 386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 99.48
PRK07824 358 O-succinylbenzoic acid--CoA ligase; Provisional 99.34
TIGR02155 422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 99.28
TIGR03335 445 F390_ftsA coenzyme F390 synthetase. This enzyme, c 99.08
COG1541 438 PaaK Coenzyme F390 synthetase [Coenzyme metabolism 98.17
KOG3628|consensus 1363 97.9
TIGR02304 430 aden_form_hyp probable adenylate-forming enzyme. M 96.84
PF04443 365 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR 94.97
COG1541438 PaaK Coenzyme F390 synthetase [Coenzyme metabolism 93.66
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
Probab=100.00  E-value=1.5e-37  Score=292.12  Aligned_cols=269  Identities=25%  Similarity=0.336  Sum_probs=196.0

Q ss_pred             hhhhhhhHHHHHHHHHhhCCCceEEEecccCccccccCcccHHHHHHHHHHHHHHHHhhhccCCCCCCCCCCCcEEEEEe
Q psy8308          18 KIYKEKQLHRIFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSL   97 (311)
Q Consensus        18 ~~~~~~~l~~~~~~~a~~~pd~~Ai~~~~~~~~~~~~~~~Ty~el~~~v~~lA~~L~~~~~~~~~~~g~~~gd~~Vai~~   97 (311)
                      ......++..++.+.++.+|+.+|+.+...    +.|..+||+|+.+++.++|++|++.        |+..||+ |+|++
T Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~----~~~~~~ty~e~~~~v~~~a~gL~~l--------g~~~gdr-vai~a   77 (613)
T COG1022          11 DVAEIHTLPKRLAERVKDRPDGVALMYKEL----GGWEAITYRELYERVRALASGLLSL--------GIPAGDR-VAIFA   77 (613)
T ss_pred             hhhhcccHHHHHHHHhhcCCcceeEeeecC----CcceEeeHHHHHHHHHHHHHHHHhc--------CCCCCCE-EEEEe
Confidence            344456889999999999999888886653    3356889999999999999999864        5544786 99999


Q ss_pred             CCChhHHHHHHHHHHhCCeEEeCCCCCcHHHHHHHHHHcCCcEEEecCchhhhhhhhcccc---cccchh----hhhhh-
Q psy8308          98 APSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLAYKGRT---VLSLPQ----LRLLS-  169 (311)
Q Consensus        98 ~n~~e~~~~~la~~~~G~v~vp~~~~~~~~el~~~l~~s~~~~vi~~~~~~~~~~~~~~~~---~~~~~~----~~~~~-  169 (311)
                      .|+++|+++.+|++.+|++.||+++++++++++|++++++++++|+++.............   +..+..    ..... 
T Consensus        78 ~nr~eW~i~d~a~~~~g~v~Vp~y~t~~~~~~~~iL~~se~~~i~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (613)
T COG1022          78 ANRPEWAIADLAILALGAVSVPIYSTSTPEQLAYILNESESKVIFVENQELLDLVLPVLEDCPKVVDLIVIIDLVREAVE  157 (613)
T ss_pred             CCCHHHHHHHHHHHHcCCeEEecCCCCCHHHHHHHHhcCCceEEEecchHHHHHHHhhhccccchhhhhhhhhhhhhccc
Confidence            9999999999999999999999999999999999999999999999876544333221110   100000    00000 


Q ss_pred             -cccCCCCCCCCccc---------CCCCCCCCCCCeEEEEEccCCCCCCcceEecchhHHHHHHHHHhhcC-CCCCCccc
Q psy8308         170 -ASLSHNNIPGESML---------HSDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFP-YSPSERVG  238 (311)
Q Consensus       170 -~~~~~~~~~~~~~~---------~~~~~~~~~~~~a~i~~TSGTTG~PKgV~~th~~~~~~~~~~~~~~~-~~~~~~~~  238 (311)
                       ..............         ........++|+|+|+|||||||.|||||+||+|+..++........ .+++++..
T Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dDlatiiYTSGTTG~PKGVmLth~N~~~~v~~~~~~~~~~~~~d~~L  237 (613)
T COG1022         158 AKALVLEVFPDEGISLFLIDSAGLEGRIAPPKPDDLATIIYTSGTTGTPKGVMLTHRNLLAQVAGIDEVLPPIGPGDRVL  237 (613)
T ss_pred             hhhccccccccccchhhhhcccccccccCCCCccceEEEEEcCCCCCCCceEEEehHHHHHHHHHHHhhCCCCCCCcEEE
Confidence             00000000000000         00112346899999999999999999999999999999988888776 77888754


Q ss_pred             eeecchhhhhhHHHHHHhhHhhcCCcEEEeCCCCCCChhHHHHHHhhcCceEEEeChHHHHHHHHHHh
Q psy8308         239 AFKTALTFVDAVSEIWGPLLSARCGGVLIIPRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLMFLK  306 (311)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~v~~~~~~~~p~~~~~~i~~~~vt~~~~vP~~~~~ll~~~~  306 (311)
                      +   -+|+.|.+..++...+.+..|.+....    .++..+++.++++|+|+++.||.+|.++-+...
T Consensus       238 s---fLPlaHi~Er~~~~~~~~~~g~~~~~~----~~~~~~~~dl~~~rPt~m~~VPRvwE~i~~~I~  298 (613)
T COG1022         238 S---FLPLAHIFERAFEGGLALYGGVTVLFK----EDPRTLLEDLKEVRPTVMIGVPRVWEKVYKGIM  298 (613)
T ss_pred             E---eCcHHHHHHHHHHHHHHhhcceEEEec----CCHHHHHHHHHHhCCeEEeechHHHHHHHHHHH
Confidence            4   477777777766433333333344332    379999999999999999999999998876543



>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1177|consensus Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>KOG1256|consensus Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>KOG1176|consensus Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>KOG1179|consensus Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>KOG1175|consensus Back     alignment and domain information
>TIGR01733 AA-adenyl-dom amino acid adenylation domain Back     alignment and domain information
>TIGR03089 conserved hypothetical protein TIGR03089 Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>KOG1180|consensus Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG3628|consensus Back     alignment and domain information
>KOG1178|consensus Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>TIGR03335 F390_ftsA coenzyme F390 synthetase Back     alignment and domain information
>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] Back     alignment and domain information
>KOG3628|consensus Back     alignment and domain information
>TIGR02304 aden_form_hyp probable adenylate-forming enzyme Back     alignment and domain information
>PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria Back     alignment and domain information
>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
3e7w_A 511 D-alanine--poly(phosphoribitol) ligase subunit 1; 2e-62
3fce_A 512 D-alanine--poly(phosphoribitol) ligase subunit 1; 7e-62
3l8c_A 521 D-alanine--poly(phosphoribitol) ligase subunit 1; 2e-59
3ite_A 562 SIDN siderophore synthetase; ligase, non-ribosomal 2e-59
1amu_A 563 GRSA, gramicidin synthetase 1; peptide synthetase, 1e-58
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 1e-56
4dg8_A 620 PA1221; ANL superfamily, adenylation domain, pepti 3e-56
3ipl_A 501 2-succinylbenzoate--COA ligase; structural genomic 4e-27
3r44_A 517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 3e-26
3ivr_A 509 Putative long-chain-fatty-acid COA ligase; structu 2e-25
3nyq_A 505 Malonyl-COA ligase; A/B topology ababa sandwich be 4e-24
2v7b_A 529 Benzoate-coenzyme A ligase; benzoate oxidation, be 6e-24
1t5h_X 504 4-chlorobenzoyl COA ligase; adenylate-forming coen 6e-24
3g7s_A 549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 2e-23
3t5a_A 480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 3e-22
3kxw_A 590 Saframycin MX1 synthetase B; fatty acid AMP ligase 5e-22
4fuq_A 503 Malonyl COA synthetase; ANL superfamily, methylma 3e-21
3c5e_A 570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 2e-20
3rg2_A 617 Enterobactin synthase component E (ENTE), 2,3-DIH 2e-20
3o83_A 544 Peptide arylation enzyme; ligase, adenylation of 2 1e-19
1mdb_A 539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 6e-19
3etc_A 580 AMP-binding protein; adenylate-forming acyl-COA sy 1e-18
3ni2_A 536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 1e-18
3gqw_A 576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 9e-18
3rix_A 550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 1e-17
2d1s_A 548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 7e-16
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 1e-14
3hgu_A 369 EHPF; phenazine, antibiotic, biosynthetic protein; 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Length = 511 Back     alignment and structure
 Score =  204 bits (522), Expect = 2e-62
 Identities = 60/281 (21%), Positives = 110/281 (39%), Gaps = 33/281 (11%)

Query: 24  QLHRIFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVP 83
           +L    + +A   P   A   + Q   +L     TY EL   S++ A      +  +   
Sbjct: 2   KLLHAIQTHAETYPQTDAFRSQGQ---SL-----TYQELWEQSDRAA----AAIQKRISG 49

Query: 84  NENQDGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIA 143
            +       + V       +I   L   KAG  Y+P+D++ P +R+  I+  +   L+I 
Sbjct: 50  EK----KSPILVYGHMEPHMIVSFLGSVKAGHPYIPVDLSIPSERIAKIIESSGAELLIH 105

Query: 144 ENEQACENLAYKGRTVLSLPQLRLLSASLSHNNIPGESMLHSDNNNEQSNDIAIVLYTSG 203
               + + +  + +  +S  +L          ++  +  +              ++YTSG
Sbjct: 106 AAGLSIDAVGQQIQ-TVSAEELLENEGG----SVSQDQWVKEHE-------TFYIIYTSG 153

Query: 204 STGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIWGPLLSARCG 263
           STG PKGV++    + +   W  A FP S  +     +   +F  +V +++  L S   G
Sbjct: 154 STGNPKGVQISAANLQSFTDWICADFPVSGGKIF-LNQAPFSFDLSVMDLYPCLQS---G 209

Query: 264 GVLII-PRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLM 303
           G L    +D    P  L   L+K  +      PS ++  LM
Sbjct: 210 GTLHCVTKDAVNKPKVLFEELKKSGLNVWTSTPSFVQMCLM 250


>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Length = 512 Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Length = 521 Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Length = 562 Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Length = 563 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Length = 1304 Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Length = 620 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Length = 369 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
1mdb_A 539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 100.0
3r44_A 517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 100.0
3ivr_A 509 Putative long-chain-fatty-acid COA ligase; structu 100.0
3g7s_A 549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 100.0
3o83_A 544 Peptide arylation enzyme; ligase, adenylation of 2 100.0
1t5h_X 504 4-chlorobenzoyl COA ligase; adenylate-forming coen 100.0
4gr5_A 570 Non-ribosomal peptide synthetase; MBTH-like domain 100.0
4dg8_A 620 PA1221; ANL superfamily, adenylation domain, pepti 100.0
3ni2_A 536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 100.0
3fce_A 512 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
3t5a_A 480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 100.0
1v25_A 541 Long-chain-fatty-acid-COA synthetase; ligase, stru 100.0
3kxw_A 590 Saframycin MX1 synthetase B; fatty acid AMP ligase 100.0
3rix_A 550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 100.0
3etc_A 580 AMP-binding protein; adenylate-forming acyl-COA sy 100.0
3e7w_A 511 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
1ry2_A 663 Acetyl-coenzyme A synthetase 1, acyl-activating en 100.0
3ipl_A 501 2-succinylbenzoate--COA ligase; structural genomic 100.0
1amu_A 563 GRSA, gramicidin synthetase 1; peptide synthetase, 100.0
1pg4_A 652 Acetyl-COA synthetase; AMP-forming, adenylate-form 100.0
3l8c_A 521 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
2d1s_A 548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 100.0
3rg2_A 617 Enterobactin synthase component E (ENTE), 2,3-DIH 100.0
2v7b_A 529 Benzoate-coenzyme A ligase; benzoate oxidation, be 100.0
4fuq_A 503 Malonyl COA synthetase; ANL superfamily, methylma 100.0
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 100.0
3c5e_A 570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 100.0
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 100.0
3ite_A 562 SIDN siderophore synthetase; ligase, non-ribosomal 100.0
3gqw_A 576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 100.0
3nyq_A 505 Malonyl-COA ligase; A/B topology ababa sandwich be 100.0
4gs5_A 358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 99.69
3qov_A 436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 99.62
2y27_A 437 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.61
2y4o_A 443 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.6
3hgu_A 369 EHPF; phenazine, antibiotic, biosynthetic protein; 99.54
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 86.52
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 85.35
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
Probab=100.00  E-value=6.6e-39  Score=304.65  Aligned_cols=268  Identities=18%  Similarity=0.184  Sum_probs=192.6

Q ss_pred             hhhhhhHHHHHHHHHhhCCCceEEEecccCccccccCcccHHHHHHHHHHHHHHHHhhhccCCCCCCCCCCCcEEEEEeC
Q psy8308          19 IYKEKQLHRIFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLA   98 (311)
Q Consensus        19 ~~~~~~l~~~~~~~a~~~pd~~Ai~~~~~~~~~~~~~~~Ty~el~~~v~~lA~~L~~~~~~~~~~~g~~~gd~~Vai~~~   98 (311)
                      .++..++.++|.++++++||++|+.+.+.        ++||+||+++++++|++|++.        |+++||+ |+++++
T Consensus        21 ~~~~~tl~~~l~~~a~~~p~~~A~~~~~~--------~~Ty~eL~~~~~~lA~~L~~~--------Gv~~gd~-V~i~~~   83 (539)
T 1mdb_A           21 CWAGETFGDLLRDRAAKYGDRIAITCGNT--------HWSYRELDTRADRLAAGFQKL--------GIQQKDR-VVVQLP   83 (539)
T ss_dssp             SSCSCCHHHHHHHHHHHHTTSEEEEETTE--------EEEHHHHHHHHHHHHHHHHHH--------TCCTTCE-EEECCC
T ss_pred             cccCCCHHHHHHHHHHHCCCCEEEEeCCC--------cccHHHHHHHHHHHHHHHHHc--------CCCCCCE-EEEEcC
Confidence            34557899999999999999999987542        679999999999999999864        6778886 999999


Q ss_pred             CChhHHHHHHHHHHhCCeEEeCCCCCcHHHHHHHHHHcCCcEEEecCchhh----hhhhhcccccccchhhhhhhcccCC
Q psy8308          99 PSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQAC----ENLAYKGRTVLSLPQLRLLSASLSH  174 (311)
Q Consensus        99 n~~e~~~~~la~~~~G~v~vp~~~~~~~~el~~~l~~s~~~~vi~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~  174 (311)
                      |+++|+++++||+++|+++||+||.++.+++.+++++++++++|++.....    ............+..+.........
T Consensus        84 ~~~~~~~~~lA~~~~Ga~~vpl~~~~~~~~l~~~l~~~~~~~vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  163 (539)
T 1mdb_A           84 NIKEFFEVIFALFRLGALPVFALPSHRSSEITYFCEFAEAAAYIIPDAYSGFDYRSLARQVQSKLPTLKNIIVAGEAEEF  163 (539)
T ss_dssp             SSHHHHHHHHHHHHHTCEEEECCTTCCHHHHHHHHHHTTCSEEEEESEETTEEHHHHHHHHHHHCTTCCCEEEESCCTTS
T ss_pred             CcHHHHHHHHHHHHcCeEEecCCCCCCHHHHHHHHHhCCCCEEEeccccccccHHHHHHHHHhcCCCccEEEEcCCccch
Confidence            999999999999999999999999999999999999999999999764211    0000000000000000000000000


Q ss_pred             CCCCCCcccCCCCCCCCCCCeEEEEEccCCCCCCcceEecchhHHHHHHHHHhhcCCCCCCccceeecchhhhhhHHHHH
Q psy8308         175 NNIPGESMLHSDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWATFPYSPSERVGAFKTALTFVDAVSEIW  254 (311)
Q Consensus       175 ~~~~~~~~~~~~~~~~~~~~~a~i~~TSGTTG~PKgV~~th~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  254 (311)
                      .................++|+++|+|||||||.||||++||+++...+......+.+.+.++..   ...++.|.++...
T Consensus       164 ~~~~~~~~~~~~~~~~~~~d~a~i~~TSGTTG~PKgV~~th~~~~~~~~~~~~~~~~~~~d~~l---~~~p~~h~~~~~~  240 (539)
T 1mdb_A          164 LPLEDLHTEPVKLPEVKSSDVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVCWLDHSTVYL---AALPMAHNYPLSS  240 (539)
T ss_dssp             EEGGGCCCCCCCCCCCCTTSEEEEEECCCSSSSCCEEEEEHHHHHHHHHHHHHHHTCCTTCEEE---ECSCTTSHHHHHS
T ss_pred             hhhhhccccccccCCCCcCceEEEEeCCCcCCCCcEEEEehHHHHHHHHHHHHhhCCCCCCEEE---EeecccccchhhH
Confidence            0000000000011234678999999999999999999999999988877666667777777643   3344444433221


Q ss_pred             -HhhHhhcCCcEEEeCCCCCCChhHHHHHHhhcCceEEEeChHHHHHHHHHHhhh
Q psy8308         255 -GPLLSARCGGVLIIPRDVTRNPDQLIGTLEKYKVERLVLVPSLLRSMLMFLKMT  308 (311)
Q Consensus       255 -~~~~~~~~g~~~v~~~~~~~~p~~~~~~i~~~~vt~~~~vP~~~~~ll~~~~~~  308 (311)
                       ..+..+..|+++++.+.  +++..+++.|+++++|++.++|+++..|+++.+..
T Consensus       241 ~~~~~~l~~G~~~v~~~~--~~~~~~~~~i~~~~~t~~~~~P~~~~~l~~~~~~~  293 (539)
T 1mdb_A          241 PGVLGVLYAGGRVVLSPS--PSPDDAFPLIEREKVTITALVPPLAMVWMDAASSR  293 (539)
T ss_dssp             SHHHHHHHTTCEEEECSS--SSHHHHHHHHHHHTCSEEEECHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHhCCEEEECCC--CCHHHHHHHHHHcCCeEEEccHHHHHHHHhCcccc
Confidence             22333345778887764  47999999999999999999999999999887644



>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 311
d1pg4a_ 643 e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en 4e-38
d1ry2a_ 640 e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast 3e-33
d1v25a_ 534 e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 2e-27
d1amua_ 514 e.23.1.1 (A:) Phenylalanine activating domain of g 1e-26
d1mdba_ 536 e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B 3e-24
d3cw9a1 503 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc 2e-23
d1lcia_ 541 e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali 3e-22
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Salmonella enterica [TaxId: 28901]
 Score =  140 bits (354), Expect = 4e-38
 Identities = 66/300 (22%), Positives = 116/300 (38%), Gaps = 40/300 (13%)

Query: 28  IFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQ 87
             +++   + D TA+I+E  D       + +Y EL+    + A  LL     K       
Sbjct: 77  CLDRHLQENGDRTAIIWEGDDTSQ--SKHISYRELHRDVCRFANTLLDLGIKK------- 127

Query: 88  DGDHIVAVSLAPSSGLIQVLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQ 147
            GD  VA+ +         +LA  + GA +  +      + V   + ++   LVI  +E 
Sbjct: 128 -GDV-VAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITADEG 185

Query: 148 A----------CENLAYKGRTVLSLPQLRLLSASLSHNNIPGESMLHSDNNNEQ------ 191
                        + A K   V S+  + +L  + S  +      L   +  E+      
Sbjct: 186 VRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDLIEKASPEHQ 245

Query: 192 -----SNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAWQWA-TFPYSPSERVGAFKTALT 245
                + D   +LYTSGSTG PKGV       L   A  +   F Y P +        + 
Sbjct: 246 PEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCT-ADVG 304

Query: 246 FVDAVS-EIWGPLLSARCGGVLIIPRDVTR--NPDQLIGTLEKYKVERLVLVPSLLRSML 302
           +V   S  ++GPL    CG   ++   V     P ++   ++K++V  L   P+ +R+++
Sbjct: 305 WVTGHSYLLYGPLA---CGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALM 361


>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
d1pg4a_ 643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 100.0
d1ry2a_ 640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 100.0
d1mdba_ 536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 100.0
d1v25a_ 534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 100.0
d3cw9a1 503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 100.0
d1amua_ 514 Phenylalanine activating domain of gramicidin synt 100.0
d1lcia_ 541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 100.0
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Salmonella enterica [TaxId: 28901]
Probab=100.00  E-value=1.1e-37  Score=299.61  Aligned_cols=267  Identities=21%  Similarity=0.233  Sum_probs=183.3

Q ss_pred             HHHHHHHHhhCCCceEEEecccCccccccCcccHHHHHHHHHHHHHHHHhhhccCCCCCCCCCCCcEEEEEeCCChhHHH
Q psy8308          26 HRIFEKNAALSPDNTALIFEEQDKDTLVITNETYSELNSASNQLARGLLHFLHTKAVPNENQDGDHIVAVSLAPSSGLIQ  105 (311)
Q Consensus        26 ~~~~~~~a~~~pd~~Ai~~~~~~~~~~~~~~~Ty~el~~~v~~lA~~L~~~~~~~~~~~g~~~gd~~Vai~~~n~~e~~~  105 (311)
                      .++++++++.+||++|+++.+++..  ..+++||+||.++|+++|++|++.        |+++||+ |+++++|++++++
T Consensus        75 ~n~ldrh~~~~~d~~Ali~~~~~~~--~~~~~TY~eL~~~v~~~A~~L~~~--------Gv~~Gd~-V~i~~~n~~e~iv  143 (643)
T d1pg4a_          75 ANCLDRHLQENGDRTAIIWEGDDTS--QSKHISYRELHRDVCRFANTLLDL--------GIKKGDV-VAIYMPMVPEAAV  143 (643)
T ss_dssp             HHHTGGGHHHHTTSEEEEEECSSTT--CEEEEEHHHHHHHHHHHHHHHHHH--------TCCTTCE-EEEECCSSHHHHH
T ss_pred             HHHHHHHHHhCCCCEEEEEEecCCC--CceEEeHHHHHHHHHHHHHHHHHc--------CCCCCCE-EEEecccchHHHH
Confidence            5677888899999999997654321  124789999999999999999865        7888996 9999999999999


Q ss_pred             HHHHHHHhCCeEEeCCCCCcHHHHHHHHHHcCCcEEEecCchhhhhhh----------hcccccccchhhhhhhcccCCC
Q psy8308         106 VLLAVWKAGAAYLPLDVTAPEQRVKHILNEARPLLVIAENEQACENLA----------YKGRTVLSLPQLRLLSASLSHN  175 (311)
Q Consensus       106 ~~la~~~~G~v~vp~~~~~~~~el~~~l~~s~~~~vi~~~~~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~  175 (311)
                      ++|||+++|++++|+++.++++++.+++++++++++|+++........          ........+.............
T Consensus       144 ~~lA~~~~Gav~v~l~~~~~~~~l~~~l~~~~~~~li~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~i~~~~~~~~~  223 (643)
T d1pg4a_         144 AMLACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDI  223 (643)
T ss_dssp             HHHHHHHHTCEEEECCTTSCHHHHHHHHHHHTCSEEEEESEEEETTEEEESHHHHHHHHTSTTCCSCCEEEEECSSCCCC
T ss_pred             HHHHHHHhCeEEEecCCCCCHHHHHHHHHhcCCCEEEEcchhhhhccccchhhhHHHHHhccccccceEEEEeccCCccc
Confidence            999999999999999999999999999999999999997642211000          0000000011110000000000


Q ss_pred             CCC-----------CCcccCCCCCCCCCCCeEEEEEccCCCCCCcceEecchhHHHHHHH-HHhhcCCCCCCccceeecc
Q psy8308         176 NIP-----------GESMLHSDNNNEQSNDIAIVLYTSGSTGIPKGVRLPHEVILNRLAW-QWATFPYSPSERVGAFKTA  243 (311)
Q Consensus       176 ~~~-----------~~~~~~~~~~~~~~~~~a~i~~TSGTTG~PKgV~~th~~~~~~~~~-~~~~~~~~~~~~~~~~~~~  243 (311)
                      ...           ............+++|+++|+|||||||.||||++||++++..... ....+.+.+.++....   
T Consensus       224 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~dd~a~IlyTSGTTG~PKgV~~sh~~~l~~~~~~~~~~~~~~~~d~~~~~---  300 (643)
T d1pg4a_         224 DWQEGRDLWWRDLIEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDIYWCT---  300 (643)
T ss_dssp             CCCBTTEEEHHHHHTTSCSCCCCCCEETTSEEEEEEECCSSSSCEEEEEESHHHHHHHHHHHHHHTTCCTTCEEEEC---
T ss_pred             ccccccchhhhhhhcccCcccCCCCCCCCCeEEEEeCCCcccCCCEEEEccHHHHHHHHHHHHHhhCCCCCCEEEEe---
Confidence            000           0000011122346789999999999999999999999997755433 3344577777765332   


Q ss_pred             hhhhhhHHHHHHhhHhhcCCcEEEeCCCC--CCChhHHHHHHhhcCceEEEeChHHHHHHHHHHh
Q psy8308         244 LTFVDAVSEIWGPLLSARCGGVLIIPRDV--TRNPDQLIGTLEKYKVERLVLVPSLLRSMLMFLK  306 (311)
Q Consensus       244 ~~~~~~~~~~~~~~~~~~~g~~~v~~~~~--~~~p~~~~~~i~~~~vt~~~~vP~~~~~ll~~~~  306 (311)
                      .++.|..+..+..+..+..|+++++....  .++|..+++.|++++||+++++|+++++|+++.+
T Consensus       301 ~p~~~~~g~~~~l~~~L~~G~t~vl~~~~~~~~~~~~~~~~i~~~~vt~~~~~P~~l~~l~~~~~  365 (643)
T d1pg4a_         301 ADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGD  365 (643)
T ss_dssp             SCTTSHHHHHHTTHHHHHTTCEEEEECSCTTSSSTTHHHHHHHHHTCSEEEECHHHHHHHHTTGG
T ss_pred             CChHHHHHHHHHHHHHHHhCCEEEEecCCCCCCCHHHHHHHHHHHCCcEEEehHHHHHHHHhCcc
Confidence            33332222222222223347777765432  3589999999999999999999999999998764



>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure