Psyllid ID: psy8342

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----

ARSKVKGFLELYHAYLRLSDHETNLEVSRHRESADPDSWIIVDASTESIVETPAQPLFIGGVEQQGALPPGWEERTDANGRTYYVNHIARCTQWERPTVHHTMSSNNSAPEEPTEQIRLRIIAGHSLAKKDIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYILRPRR

cccEEEEEEEEEEEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccEEEcccccEEEEEccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccEEEEccccccccccccEEEEEEcccccEEEEEEEEcccccccccEEEEEEEcccccccccccEEEcEEEEccccc

ccccEcEEEEEEEEEccccccccccccHHcHHHccccccEEEEcccccccccccccccccccccccccccccEEEEcccccEEEEEccccEEEccccccccccccccccccccccEEEEEEEEcccccHHcccccccEccccEccEcccEEEccccccccccEEEEEEEEcccHHHcEEEEEEEccccccccccccEEEEEccccccccccccccccccEccccc

ARSKVKGFLELYHAYLRLSdhetnlevsrhresadpdswiivdastesivetpaqplfiggveqqgalppgweertdangrtYYVNHIARctqwerptvhhtmssnnsapeepteQIRLRIIAGHSLAKKDIfgaridlntvngdqtIDSALTKTRKktlnpvwneefifrvkpsehklVFQVFdmnrltrddFLGMVELSLlnlpresdgcvihnkkyilrprr

ARSKVKGFLELYHAYLRLSDHETNLEVSrhresadpdswIIVDASTESIVETPAQPLFIGGVEQQGALPPGWEERTDANGRTYYVNHIARCTQWERPTVHHtmssnnsapeepTEQIRLRIIAGHSLAKKDIFgaridlntvngdqtidsaltktrkktlnpvwneefifrvkpsehkLVFQVFDMNRLTRDDFLGMVELSLlnlpresdgcvihnkkyilrprr

*****KGFLELYHAYLRLSD*****************SWIIVDASTESIVETPAQPLFIGGVEQQGALPPGWEERTDANGRTYYVNHIARCTQWERPT******************IRLRIIAGHSLAKKDIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYIL****

*RSKVKGFLELYHA*****************************************************************GRTYYVNHIA******************************************IFGARIDLNTVNGDQT*******TRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYILRP**

ARSKVKGFLELYHAYLRLSDHETN**********DPDSWIIVDASTESIVETPAQPLFIGGVEQQGALPPGWEERTDANGRTYYVNHIARCTQWERPT****************EQIRLRIIAGHSLAKKDIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYILRPRR

**SKVKGFLELYHAYLRL**********************************************QGALPPGWEERTDANGRTYYVNHIARCTQWERPTVHHTM********EPTEQIRLRIIAGHSLAKKDIFGARIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYIL****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		225
FB\|FBgn0259174		1007	Nedd4 "Nedd4" [Drosophila mela	0.484	0.108	0.728	3e-38
MGI\|MGI:1933754		1004	Nedd4l "neural precursor cell	0.555	0.124	0.477	8.6e-24
UNIPROTKB\|Q6DIR6		970	nedd4l "Uncharacterized protei	0.52	0.120	0.5	3.6e-23
UNIPROTKB\|Q96PU5		975	NEDD4L "E3 ubiquitin-protein l	0.52	0.12	0.5	5.9e-23
UNIPROTKB\|F1PV82		961	NEDD4L "Uncharacterized protei	0.48	0.112	0.521	7.3e-23
UNIPROTKB\|F1LP70		859	Nedd4l "E3 ubiquitin-protein l	0.48	0.125	0.521	1.6e-22
UNIPROTKB\|F1LS12		943	Nedd4l "E3 ubiquitin-protein l	0.48	0.114	0.521	1.9e-22
UNIPROTKB\|F1LRN8		963	Nedd4l "Protein Nedd4l" [Rattu	0.48	0.112	0.521	2e-22
UNIPROTKB\|E1BWY8		902	NEDD4 "E3 ubiquitin-protein li	0.497	0.124	0.475	1.3e-21
UNIPROTKB\|E1BR64		965	NEDD4 "Uncharacterized protein	0.497	0.116	0.475	1.4e-21

FB\|FBgn0259174 Nedd4 "Nedd4" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 420 (152.9 bits), Expect = 3.0e-38, P = 3.0e-38
 Identities = 83/114 (72%), Positives = 93/114 (81%)

Query:   117 IRLRIIAGHSLAKKDIFGA-----RIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFR 171
             +R+ ++ G SLAKKDIFGA     RIDLNT+NGD  IDS LTKT+KKTLNP WNEEFIFR
Sbjct:    72 LRIVVLTGQSLAKKDIFGASDPYVRIDLNTINGDINIDSVLTKTKKKTLNPTWNEEFIFR 131

Query:   172 VKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYILRPRR 225
             VKPSEHKLVFQVFD NRLTRDDFLGMVEL+L+NLP E +G  I  + Y LRPRR
Sbjct:   132 VKPSEHKLVFQVFDENRLTRDDFLGMVELTLVNLPTEQEGRTIGEQSYTLRPRR 185

GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS;IBA

GO:0007411 "axon guidance" evidence=IMP

GO:0045807 "positive regulation of endocytosis" evidence=IMP

GO:0016199 "axon midline choice point recognition" evidence=IMP

GO:0005515 "protein binding" evidence=IPI

GO:0031623 "receptor internalization" evidence=IMP;IPI

GO:0016567 "protein ubiquitination" evidence=IMP;IDA

GO:0005112 "Notch binding" evidence=IPI

GO:0005737 "cytoplasm" evidence=IBA;IDA

GO:0045746 "negative regulation of Notch signaling pathway" evidence=IGI;IMP

GO:0002092 "positive regulation of receptor internalization" evidence=IMP

GO:0019904 "protein domain specific binding" evidence=IDA;IPI

GO:0051965 "positive regulation of synapse assembly" evidence=IMP

GO:0007528 "neuromuscular junction development" evidence=IMP

GO:0005886 "plasma membrane" evidence=IDA

GO:0042787 "protein ubiquitination involved in ubiquitin-dependent protein catabolic process" evidence=IBA

GO:0005634 "nucleus" evidence=IBA

MGI\|MGI:1933754 Nedd4l "neural precursor cell expressed, developmentally down-regulated gene 4-like" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6DIR6 nedd4l "Uncharacterized protein" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

UNIPROTKB\|Q96PU5 NEDD4L "E3 ubiquitin-protein ligase NEDD4-like" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PV82 NEDD4L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LP70 Nedd4l "E3 ubiquitin-protein ligase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LS12 Nedd4l "E3 ubiquitin-protein ligase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LRN8 Nedd4l "Protein Nedd4l" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BWY8 NEDD4 "E3 ubiquitin-protein ligase" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BR64 NEDD4 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		225
cd04033		133	cd04033, C2_NEDD4_NEDD4L, C2 domain present in the	1e-50
pfam00168		85	pfam00168, C2, C2 domain	6e-20
smart00239		101	smart00239, C2, Protein kinase C conserved region	7e-18
cd00030		102	cd00030, C2, C2 domain	3e-16
cd04026		131	cd04026, C2_PKC_alpha_gamma, C2 domain in Protein	6e-13
cd08382		123	cd08382, C2_Smurf-like, C2 domain present in Smad	7e-13
cd08385		124	cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain	1e-12
smart00456		33	smart00456, WW, Domain with 2 conserved Trp (W) re	8e-12
cd00201		31	cd00201, WW, Two conserved tryptophans domain; als	2e-11
cd04038		145	cd04038, C2_ArfGAP, C2 domain present in Arf GTPas	2e-11
cd08405		136	cd08405, C2B_Synaptotagmin-7, C2 domain second rep	2e-11
pfam00397		30	pfam00397, WW, WW domain	3e-11
cd04040		115	cd04040, C2D_Tricalbin-like, C2 domain fourth repe	1e-10
cd04054		121	cd04054, C2A_Rasal1_RasA4, C2 domain first repeat	3e-10
cd04009		133	cd04009, C2B_Munc13-like, C2 domain second repeat	5e-10
cd04042		121	cd04042, C2A_MCTP_PRT, C2 domain first repeat foun	6e-10
cd08386		125	cd08386, C2A_Synaptotagmin-7, C2A domain first rep	7e-10
cd08675		137	cd08675, C2B_RasGAP, C2 domain second repeat of Ra	1e-09
cd00276		134	cd00276, C2B_Synaptotagmin, C2 domain second repea	7e-09
cd08383		117	cd08383, C2A_RasGAP, C2 domain (first repeat) of R	7e-09
cd08391		121	cd08391, C2A_C2C_Synaptotagmin_like, C2 domain fir	9e-09
cd04037		124	cd04037, C2E_Ferlin, C2 domain fifth repeat in Fer	1e-08
cd04046		126	cd04046, C2_Calpain, C2 domain present in Calpain	1e-08
cd08384		133	cd08384, C2B_Rabphilin_Doc2, C2 domain second repe	1e-08
cd08410		135	cd08410, C2B_Synaptotagmin-17, C2 domain second re	3e-08
cd08376		116	cd08376, C2B_MCTP_PRT, C2 domain second repeat fou	3e-08
cd04021		125	cd04021, C2_E3_ubiquitin_ligase, C2 domain present	4e-08
cd04039		108	cd04039, C2_PSD, C2 domain present in Phosphatidyl	7e-08
cd08401		121	cd08401, C2A_RasA2_RasA3, C2 domain first repeat p	1e-07
cd04020		162	cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat	1e-07
cd04041		111	cd04041, C2A_fungal, C2 domain first repeat; funga	1e-07
cd08676		153	cd08676, C2A_Munc13-like, C2 domain first repeat i	1e-07
cd08521		123	cd08521, C2A_SLP, C2 domain first repeat present i	1e-07
cd08387		124	cd08387, C2A_Synaptotagmin-8, C2A domain first rep	1e-07
cd04022		127	cd04022, C2A_MCTP_PRT_plant, C2 domain first repea	2e-07
cd08678		126	cd08678, C2_C21orf25-like, C2 domain found in the	2e-07
cd04011		111	cd04011, C2B_Ferlin, C2 domain second repeat in Fe	3e-07
cd04044		124	cd04044, C2A_Tricalbin-like, C2 domain first repea	3e-07
cd08682		126	cd08682, C2_Rab11-FIP_classI, C2 domain found in R	3e-07
COG5038		1227	COG5038, COG5038, Ca2+-dependent lipid-binding pro	4e-07
cd08377		119	cd08377, C2C_MCTP_PRT, C2 domain third repeat foun	5e-07
cd04025		123	cd04025, C2B_RasA1_RasA4, C2 domain second repeat	5e-07
cd04035		123	cd04035, C2A_Rabphilin_Doc2, C2 domain first repea	8e-07
cd08393		125	cd08393, C2A_SLP-1_2, C2 domain first repeat prese	1e-06
cd04036		119	cd04036, C2_cPLA2, C2 domain present in cytosolic	1e-06
cd08404		136	cd08404, C2B_Synaptotagmin-4, C2 domain second rep	1e-06
cd08402		136	cd08402, C2B_Synaptotagmin-1, C2 domain second rep	3e-06
cd04031		125	cd04031, C2A_RIM1alpha, C2 domain first repeat con	3e-06
cd08390		123	cd08390, C2A_Synaptotagmin-15-17, C2A domain first	6e-06
cd00275		128	cd00275, C2_PLC_like, C2 domain present in Phospho	1e-05
cd04027		127	cd04027, C2B_Munc13, C2 domain second repeat in Mu	1e-05
cd04049		124	cd04049, C2_putative_Elicitor-responsive_gene, C2	2e-05
cd04028		146	cd04028, C2B_RIM1alpha, C2 domain second repeat co	2e-05
cd04024		128	cd04024, C2A_Synaptotagmin-like, C2 domain first r	2e-05
cd04018		151	cd04018, C2C_Ferlin, C2 domain third repeat in Fer	4e-05
cd04048		120	cd04048, C2A_Copine, C2 domain first repeat in Cop	4e-05
cd04010		148	cd04010, C2B_RasA3, C2 domain second repeat presen	6e-05
COG5038		1227	COG5038, COG5038, Ca2+-dependent lipid-binding pro	2e-04
cd04014		132	cd04014, C2_PKC_epsilon, C2 domain in Protein Kina	2e-04
cd08375		136	cd08375, C2_Intersectin, C2 domain present in Inte	2e-04
cd08388		128	cd08388, C2A_Synaptotagmin-4-11, C2A domain first	3e-04
cd08373		127	cd08373, C2A_Ferlin, C2 domain first repeat in Fer	3e-04
cd04045		120	cd04045, C2C_Tricalbin-like, C2 domain third repea	3e-04
cd08374		133	cd08374, C2F_Ferlin, C2 domain sixth repeat in Fer	4e-04
cd04019		150	cd04019, C2C_MCTP_PRT_plant, C2 domain third repea	5e-04
cd04043		126	cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma	5e-04
cd08688		110	cd08688, C2_KIAA0528-like, C2 domain found in the	6e-04
cd08403		134	cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s	0.001
PLN02964		644	PLN02964, PLN02964, phosphatidylserine decarboxyla	0.001
cd04050		105	cd04050, C2B_Synaptotagmin-like, C2 domain second	0.002
cd04030		127	cd04030, C2C_KIAA1228, C2 domain third repeat pres	0.004
COG5021		872	COG5021, HUL4, Ubiquitin-protein ligase [Posttrans	0.004
cd04047		110	cd04047, C2B_Copine, C2 domain second repeat in Co	0.004

>gnl\|CDD\|175999 cd04033, C2_NEDD4_NEDD4L, C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42)	Back alignment and domain information

 Score =  160 bits (407), Expect = 1e-50
 Identities = 67/115 (58%), Positives = 81/115 (70%), Gaps = 7/115 (6%)

Query: 117 IRLRIIAGHSLAKKDIFGA-----RIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFR 171
           +R++++AG  LAKKDIFGA     +I L   +G+  IDS  TKT KKTLNP WNEEF FR
Sbjct: 2   LRVKVLAGIDLAKKDIFGASDPYVKISLYDPDGNGEIDSVQTKTIKKTLNPKWNEEFFFR 61

Query: 172 VKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRESDG--CVIHNKKYILRPR 224
           V P EH+L+F+VFD NRLTRDDFLG VE+ L NLP E+ G       K Y+LRPR
Sbjct: 62  VNPREHRLLFEVFDENRLTRDDFLGQVEVPLNNLPTETPGNERRYTFKDYLLRPR 116

Nedd4 and Nedd4-2 are two of the nine members of the Human Nedd4 family. All vertebrates appear to have both Nedd4 and Nedd4-2 genes. They are thought to participate in the regulation of epithelial Na+ channel (ENaC) activity. They also have identical specificity for ubiquitin conjugating enzymes (E2). Nedd4 and Nedd4-2 are composed of a C2 domain, 2-4 WW domains, and a ubiquitin ligase Hect domain. Their WW domains can bind PPxY (PY) or LPSY motifs, and in vitro studies suggest that WW3 and WW4 of both proteins bind PY motifs in the key substrates, with WW3 generally exhibiting higher affinity. Most Nedd4 family members, especially Nedd4-2, also have multiple splice variants, which might play different roles in regulating their substrates. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. Length = 133

>gnl\|CDD\|215765 pfam00168, C2, C2 domain	Back alignment and domain information

>gnl\|CDD\|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB)	Back alignment and domain information

>gnl\|CDD\|175973 cd00030, C2, C2 domain	Back alignment and domain information

>gnl\|CDD\|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma	Back alignment and domain information

>gnl\|CDD\|176028 cd08382, C2_Smurf-like, C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins	Back alignment and domain information

>gnl\|CDD\|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10	Back alignment and domain information

>gnl\|CDD\|197736 smart00456, WW, Domain with 2 conserved Trp (W) residues	Back alignment and domain information

>gnl|CDD|238122 cd00201, WW, Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs

Back alignment and domain information

>gnl\|CDD\|176003 cd04038, C2_ArfGAP, C2 domain present in Arf GTPase Activating Proteins (GAP)	Back alignment and domain information

>gnl\|CDD\|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7	Back alignment and domain information

>gnl\|CDD\|215899 pfam00397, WW, WW domain	Back alignment and domain information

>gnl\|CDD\|176005 cd04040, C2D_Tricalbin-like, C2 domain fourth repeat present in Tricalbin-like proteins	Back alignment and domain information

>gnl\|CDD\|176018 cd04054, C2A_Rasal1_RasA4, C2 domain first repeat present in RasA1 and RasA4	Back alignment and domain information

>gnl\|CDD\|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins	Back alignment and domain information

>gnl\|CDD\|176007 cd04042, C2A_MCTP_PRT, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>gnl\|CDD\|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7	Back alignment and domain information

>gnl\|CDD\|176057 cd08675, C2B_RasGAP, C2 domain second repeat of Ras GTPase activating proteins (GAPs)	Back alignment and domain information

>gnl\|CDD\|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin	Back alignment and domain information

>gnl\|CDD\|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs)	Back alignment and domain information

>gnl\|CDD\|176037 cd08391, C2A_C2C_Synaptotagmin_like, C2 domain first and third repeat in Synaptotagmin-like proteins	Back alignment and domain information

>gnl\|CDD\|176002 cd04037, C2E_Ferlin, C2 domain fifth repeat in Ferlin	Back alignment and domain information

>gnl\|CDD\|176011 cd04046, C2_Calpain, C2 domain present in Calpain proteins	Back alignment and domain information

>gnl\|CDD\|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain	Back alignment and domain information

>gnl\|CDD\|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17	Back alignment and domain information

>gnl\|CDD\|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>gnl\|CDD\|175988 cd04021, C2_E3_ubiquitin_ligase, C2 domain present in E3 ubiquitin ligase	Back alignment and domain information

>gnl\|CDD\|176004 cd04039, C2_PSD, C2 domain present in Phosphatidylserine decarboxylase (PSD)	Back alignment and domain information

>gnl\|CDD\|176046 cd08401, C2A_RasA2_RasA3, C2 domain first repeat present in RasA2 and RasA3	Back alignment and domain information

>gnl\|CDD\|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4	Back alignment and domain information

>gnl\|CDD\|176006 cd04041, C2A_fungal, C2 domain first repeat; fungal group	Back alignment and domain information

>gnl\|CDD\|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins	Back alignment and domain information

>gnl\|CDD\|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>gnl\|CDD\|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8	Back alignment and domain information

>gnl\|CDD\|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>gnl\|CDD\|176060 cd08678, C2_C21orf25-like, C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein	Back alignment and domain information

>gnl\|CDD\|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin	Back alignment and domain information

>gnl\|CDD\|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins	Back alignment and domain information

>gnl\|CDD\|176064 cd08682, C2_Rab11-FIP_classI, C2 domain found in Rab11-family interacting proteins (FIP) class I	Back alignment and domain information

>gnl\|CDD\|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|176023 cd08377, C2C_MCTP_PRT, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>gnl\|CDD\|175991 cd04025, C2B_RasA1_RasA4, C2 domain second repeat present in RasA1 and RasA4	Back alignment and domain information

>gnl\|CDD\|176000 cd04035, C2A_Rabphilin_Doc2, C2 domain first repeat present in Rabphilin and Double C2 domain	Back alignment and domain information

>gnl\|CDD\|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2	Back alignment and domain information

>gnl\|CDD\|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2)	Back alignment and domain information

>gnl\|CDD\|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4	Back alignment and domain information

>gnl\|CDD\|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1	Back alignment and domain information

>gnl\|CDD\|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins	Back alignment and domain information

>gnl\|CDD\|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17	Back alignment and domain information

>gnl\|CDD\|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC)	Back alignment and domain information

>gnl\|CDD\|175993 cd04027, C2B_Munc13, C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins	Back alignment and domain information

>gnl\|CDD\|176014 cd04049, C2_putative_Elicitor-responsive_gene, C2 domain present in the putative elicitor-responsive gene	Back alignment and domain information

>gnl\|CDD\|175994 cd04028, C2B_RIM1alpha, C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins	Back alignment and domain information

>gnl\|CDD\|175990 cd04024, C2A_Synaptotagmin-like, C2 domain first repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>gnl\|CDD\|175985 cd04018, C2C_Ferlin, C2 domain third repeat in Ferlin	Back alignment and domain information

>gnl\|CDD\|176013 cd04048, C2A_Copine, C2 domain first repeat in Copine	Back alignment and domain information

>gnl\|CDD\|175977 cd04010, C2B_RasA3, C2 domain second repeat present in RAS p21 protein activator 3 (RasA3)	Back alignment and domain information

>gnl\|CDD\|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|175981 cd04014, C2_PKC_epsilon, C2 domain in Protein Kinase C (PKC) epsilon	Back alignment and domain information

>gnl\|CDD\|176021 cd08375, C2_Intersectin, C2 domain present in Intersectin	Back alignment and domain information

>gnl\|CDD\|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11	Back alignment and domain information

>gnl\|CDD\|176019 cd08373, C2A_Ferlin, C2 domain first repeat in Ferlin	Back alignment and domain information

>gnl\|CDD\|176010 cd04045, C2C_Tricalbin-like, C2 domain third repeat present in Tricalbin-like proteins	Back alignment and domain information

>gnl\|CDD\|176020 cd08374, C2F_Ferlin, C2 domain sixth repeat in Ferlin	Back alignment and domain information

>gnl\|CDD\|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>gnl\|CDD\|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group	Back alignment and domain information

>gnl\|CDD\|176070 cd08688, C2_KIAA0528-like, C2 domain found in the Human KIAA0528 cDNA clone	Back alignment and domain information

>gnl\|CDD\|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10	Back alignment and domain information

>gnl\|CDD\|215520 PLN02964, PLN02964, phosphatidylserine decarboxylase	Back alignment and domain information

>gnl\|CDD\|176015 cd04050, C2B_Synaptotagmin-like, C2 domain second repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>gnl\|CDD\|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins	Back alignment and domain information

>gnl\|CDD\|227354 COG5021, HUL4, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|176012 cd04047, C2B_Copine, C2 domain second repeat in Copine	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		225
cd08395		120	C2C_Munc13 C2 domain third repeat in Munc13 (mamma	99.85
cd04028		146	C2B_RIM1alpha C2 domain second repeat contained in	99.85
cd04016		121	C2_Tollip C2 domain present in Toll-interacting pr	99.85
cd08682		126	C2_Rab11-FIP_classI C2 domain found in Rab11-famil	99.84
cd08381		122	C2B_PI3K_class_II C2 domain second repeat present	99.84
cd08677		118	C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a	99.84
cd08393		125	C2A_SLP-1_2 C2 domain first repeat present in Syna	99.83
cd08379		126	C2D_MCTP_PRT_plant C2 domain fourth repeat found i	99.83
cd08389		124	C2A_Synaptotagmin-14_16 C2A domain first repeat pr	99.83
cd04029		125	C2A_SLP-4_5 C2 domain first repeat present in Syna	99.82
cd08387		124	C2A_Synaptotagmin-8 C2A domain first repeat presen	99.81
cd08385		124	C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe	99.81
cd04010		148	C2B_RasA3 C2 domain second repeat present in RAS p	99.81
cd08401		121	C2A_RasA2_RasA3 C2 domain first repeat present in	99.81
cd08394		127	C2A_Munc13 C2 domain first repeat in Munc13 (mamma	99.81
cd08392		128	C2A_SLP-3 C2 domain first repeat present in Synapt	99.81
cd08386		125	C2A_Synaptotagmin-7 C2A domain first repeat presen	99.81
cd08680		124	C2_Kibra C2 domain found in Human protein Kibra. K	99.81
KOG1030\|consensus		168		99.81
cd04042		121	C2A_MCTP_PRT C2 domain first repeat found in Multi	99.8
cd04022		127	C2A_MCTP_PRT_plant C2 domain first repeat found in	99.8
cd04041		111	C2A_fungal C2 domain first repeat; fungal group. C	99.8
cd04036		119	C2_cPLA2 C2 domain present in cytosolic PhosphoLip	99.8
cd08376		116	C2B_MCTP_PRT C2 domain second repeat found in Mult	99.8
cd04025		123	C2B_RasA1_RasA4 C2 domain second repeat present in	99.8
cd08388		128	C2A_Synaptotagmin-4-11 C2A domain first repeat pre	99.79
cd04033		133	C2_NEDD4_NEDD4L C2 domain present in the Human neu	99.79
cd08678		126	C2_C21orf25-like C2 domain found in the Human chro	99.79
cd04019		150	C2C_MCTP_PRT_plant C2 domain third repeat found in	99.78
cd08685		119	C2_RGS-like C2 domain of the Regulator Of G-Protei	99.78
cd04031		125	C2A_RIM1alpha C2 domain first repeat contained in	99.78
cd08390		123	C2A_Synaptotagmin-15-17 C2A domain first repeat pr	99.78
cd04030		127	C2C_KIAA1228 C2 domain third repeat present in unc	99.78
cd08521		123	C2A_SLP C2 domain first repeat present in Synaptot	99.78
cd08688		110	C2_KIAA0528-like C2 domain found in the Human KIAA	99.77
cd08681		118	C2_fungal_Inn1p-like C2 domain found in fungal Ing	99.77
cd04024		128	C2A_Synaptotagmin-like C2 domain first repeat pres	99.77
cd04054		121	C2A_Rasal1_RasA4 C2 domain first repeat present in	99.77
cd08377		119	C2C_MCTP_PRT C2 domain third repeat found in Multi	99.76
cd04049		124	C2_putative_Elicitor-responsive_gene C2 domain pre	99.76
cd04027		127	C2B_Munc13 C2 domain second repeat in Munc13 (mamm	99.76
cd04050		105	C2B_Synaptotagmin-like C2 domain second repeat pre	99.76
cd08378		121	C2B_MCTP_PRT_plant C2 domain second repeat found i	99.76
cd08400		126	C2_Ras_p21A1 C2 domain present in RAS p21 protein	99.75
cd08375		136	C2_Intersectin C2 domain present in Intersectin. A	99.75
cd08382		123	C2_Smurf-like C2 domain present in Smad ubiquitina	99.75
cd08675		137	C2B_RasGAP C2 domain second repeat of Ras GTPase a	99.74
cd04015		158	C2_plant_PLD C2 domain present in plant phospholip	99.74
cd04039		108	C2_PSD C2 domain present in Phosphatidylserine dec	99.74
cd04043		126	C2_Munc13_fungal C2 domain in Munc13 (mammalian un	99.74
cd04020		162	C2B_SLP_1-2-3-4 C2 domain second repeat present in	99.73
cd04045		120	C2C_Tricalbin-like C2 domain third repeat present	99.73
cd08391		121	C2A_C2C_Synaptotagmin_like C2 domain first and thi	99.72
KOG0696\|consensus		683		99.72
cd08407		138	C2B_Synaptotagmin-13 C2 domain second repeat prese	99.72
cd04014		132	C2_PKC_epsilon C2 domain in Protein Kinase C (PKC)	99.72
cd04046		126	C2_Calpain C2 domain present in Calpain proteins.	99.72
cd04018		151	C2C_Ferlin C2 domain third repeat in Ferlin. Ferli	99.71
cd04011		111	C2B_Ferlin C2 domain second repeat in Ferlin. Ferl	99.71
cd08406		136	C2B_Synaptotagmin-12 C2 domain second repeat prese	99.71
KOG2059\|consensus		800		99.7
cd08676		153	C2A_Munc13-like C2 domain first repeat in Munc13 (	99.7
cd08404		136	C2B_Synaptotagmin-4 C2 domain second repeat presen	99.7
cd04040		115	C2D_Tricalbin-like C2 domain fourth repeat present	99.7
cd04017		135	C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl	99.7
cd04051		125	C2_SRC2_like C2 domain present in Soybean genes Re	99.7
cd04009		133	C2B_Munc13-like C2 domain second repeat in Munc13	99.7
cd08692		135	C2B_Tac2-N C2 domain second repeat found in Tac2-N	99.69
cd08384		133	C2B_Rabphilin_Doc2 C2 domain second repeat present	99.69
cd04038		145	C2_ArfGAP C2 domain present in Arf GTPase Activati	99.69
cd04032		127	C2_Perforin C2 domain of Perforin. Perforin contai	99.69
cd08405		136	C2B_Synaptotagmin-7 C2 domain second repeat presen	99.68
cd08402		136	C2B_Synaptotagmin-1 C2 domain second repeat presen	99.68
cd08408		138	C2B_Synaptotagmin-14_16 C2 domain second repeat pr	99.67
cd08410		135	C2B_Synaptotagmin-17 C2 domain second repeat prese	99.67
cd08691		137	C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li	99.66
cd04048		120	C2A_Copine C2 domain first repeat in Copine. There	99.66
cd04026		131	C2_PKC_alpha_gamma C2 domain in Protein Kinase C (	99.66
cd08403		134	C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe	99.66
cd08373		127	C2A_Ferlin C2 domain first repeat in Ferlin. Ferli	99.65
cd04037		124	C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli	99.65
cd04044		124	C2A_Tricalbin-like C2 domain first repeat present	99.64
KOG1028\|consensus		421		99.64
cd08409		137	C2B_Synaptotagmin-15 C2 domain second repeat prese	99.63
cd04013		146	C2_SynGAP_like C2 domain present in Ras GTPase act	99.63
cd08690		155	C2_Freud-1 C2 domain found in 5' repressor element	99.63
cd00276		134	C2B_Synaptotagmin C2 domain second repeat present	99.63
cd04035		123	C2A_Rabphilin_Doc2 C2 domain first repeat present	99.6
cd04021		125	C2_E3_ubiquitin_ligase C2 domain present in E3 ubi	99.57
cd08383		117	C2A_RasGAP C2 domain (first repeat) of Ras GTPase	99.57
cd08686		118	C2_ABR C2 domain in the Active BCR (Breakpoint clu	99.57
cd00275		128	C2_PLC_like C2 domain present in Phosphoinositide-	99.56
cd04047		110	C2B_Copine C2 domain second repeat in Copine. Ther	99.55
PLN03008		868	Phospholipase D delta	99.51
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	99.48
PF00168		85	C2: C2 domain; InterPro: IPR000008 The C2 domain i	99.45
KOG1011\|consensus		1283		99.45
cd04052		111	C2B_Tricalbin-like C2 domain second repeat present	99.44
cd08374		133	C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli	99.38
cd00030		102	C2 C2 domain. The C2 domain was first identified i	99.34
smart00239		101	C2 Protein kinase C conserved region 2 (CalB). Ca2	99.33
PLN02223		537	phosphoinositide phospholipase C	99.28
KOG1028\|consensus		421		99.26
PLN02952		599	phosphoinositide phospholipase C	99.23
KOG2059\|consensus		800		99.2
KOG1264\|consensus		1267		99.16
KOG0169\|consensus		746		99.13
PLN02230		598	phosphoinositide phospholipase C 4	99.11
PLN02222		581	phosphoinositide phospholipase C 2	99.11
COG5038		1227	Ca2+-dependent lipid-binding protein, contains C2	99.09
KOG1328\|consensus		1103		98.97
PLN02228		567	Phosphoinositide phospholipase C	98.97
KOG1328\|consensus		1103		98.92
PLN02270		808	phospholipase D alpha	98.89
COG5038		1227	Ca2+-dependent lipid-binding protein, contains C2	98.87
KOG1031\|consensus		1169		98.78
KOG0905\|consensus		1639		98.71
cd08689		109	C2_fungal_Pkc1p C2 domain found in protein kinase	98.59
KOG2060\|consensus		405		98.56
PF00397		31	WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp	98.54
cd08684		103	C2A_Tac2-N C2 domain first repeat found in Tac2-N	98.43
KOG1011\|consensus		1283		98.39
smart00456		32	WW Domain with 2 conserved Trp (W) residues. Also	98.34
KOG1326\|consensus		1105		98.3
PLN02352		758	phospholipase D epsilon	98.18
KOG1013\|consensus		362		98.08
cd00201		31	WW Two conserved tryptophans domain; also known as	98.05
cd08683		143	C2_C2cd3 C2 domain found in C2 calcium-dependent d	98.04
KOG1013\|consensus		362		98.0
PLN02964		644	phosphatidylserine decarboxylase	97.77
KOG3259\|consensus		163		97.6
KOG1265\|consensus		1189		97.52
KOG1891\|consensus		271		97.49
KOG1326\|consensus		1105		97.34
KOG1891\|consensus		271		97.29
KOG1327\|consensus		529		97.18
cd08398		158	C2_PI3K_class_I_alpha C2 domain present in class I	96.97
PF12416		340	DUF3668: Cep120 protein; InterPro: IPR022136 This	96.89
cd08693		173	C2_PI3K_class_I_beta_delta C2 domain present in cl	96.72
KOG3837\|consensus		523		96.67
cd08380		156	C2_PI3K_like C2 domain present in phosphatidylinos	96.66
cd08399		178	C2_PI3K_class_I_gamma C2 domain present in class I	96.0
PF00792		142	PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I	95.85
cd08397		159	C2_PI3K_class_III C2 domain present in class III p	95.77
cd04012		171	C2A_PI3K_class_II C2 domain first repeat present i	95.19
PF15627		156	CEP76-C2: CEP76 C2 domain	94.82
KOG3209\|consensus		984		94.8
KOG1452\|consensus		442		94.76
cd08695		189	C2_Dock-B C2 domains found in Dedicator Of CytoKin	94.51
PF10358		143	NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins;	94.22
PF14429		184	DOCK-C2: C2 domain in Dock180 and Zizimin proteins	94.03
PF15625		168	CC2D2AN-C2: CC2D2A N-terminal C2 domain	93.28
cd08694		196	C2_Dock-A C2 domains found in Dedicator Of CytoKin	93.21
cd08679		178	C2_DOCK180_related C2 domains found in Dedicator O	87.54
KOG1327\|consensus		529		87.35
KOG3209\|consensus		984		87.02
smart00142		100	PI3K_C2 Phosphoinositide 3-kinase, region postulat	86.42
COG5104		590	PRP40 Splicing factor [RNA processing and modifica	86.17
cd08696		179	C2_Dock-C C2 domains found in Dedicator Of CytoKin	84.6
KOG0940\|consensus		358		83.53
cd08687		98	C2_PKN-like C2 domain in Protein kinase C-like (PK	82.8
cd08697		185	C2_Dock-D C2 domains found in Dedicator Of CytoKin	81.69

>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins	Back alignment and domain information

Probab=99.85  E-value=6.8e-21  Score=138.78  Aligned_cols=104  Identities=20%  Similarity=0.281  Sum_probs=86.7

Q ss_pred             ceeEeeeeeecCCcCCCCCC-eeEEEEeC-C---CCccCcccCceecCCCCCeeccEEEEEecCCC----cEEEEEEEEc
Q psy8342         116 QIRLRIIAGHSLAKKDIFGA-RIDLNTVN-G---DQTIDSALTKTRKKTLNPVWNEEFIFRVKPSE----HKLVFQVFDM  186 (225)
Q Consensus       116 ~l~v~vi~a~~L~~~d~~g~-~~~~~~~~-~---~~~~~~~kT~v~~~~~~P~Wne~f~f~v~~~~----~~L~v~V~d~  186 (225)
                      +|.|.|++|++|+..+. |. ++|+.+.. |   ....++++|+++++++||+|||+|.|.+...+    ..|.|.|||+
T Consensus         1 kL~V~Vi~A~~L~~~d~-g~~DPYVkV~l~g~~~~~k~~k~kTkv~~~tlnPvwNE~f~F~v~~~~~~~~~~L~~~V~D~   79 (120)
T cd08395           1 KVTVKVVAANDLKWQTT-GMFRPFVEVNLIGPHLSDKKRKFATKSKNNNWSPKYNETFQFILGNEDDPESYELHICVKDY   79 (120)
T ss_pred             CEEEEEEECcCCCcccC-CCCCCEEEEEEecCCCcccccEeeeEEecCCCCCccCcEEEEEeeCcCCCceeEEEEEEEEe
Confidence            48899999999998874 66 77776653 3   23334678999999999999999999997532    5689999999


Q ss_pred             cCCCCCceeEEEEEECcccCCCCCCccccCeeEEcccC
Q psy8342         187 NRLTRDDFLGMVELSLLNLPRESDGCVIHNKKYILRPR  224 (225)
Q Consensus       187 d~~~~d~~lG~~~i~l~~l~~~~~~~~~~~~w~~L~pr  224 (225)
                      |.++++++||++.++|.++..+...    ..|++|+++
T Consensus        80 d~~~~dd~IG~~~l~l~~~~~~~~~----~~w~~L~~~  113 (120)
T cd08395          80 CFARDDRLVGVTVLQLRDIAQAGSC----ACWLPLGRR  113 (120)
T ss_pred             cccCCCCEEEEEEEEHHHCcCCCcE----EEEEECcCc
Confidence            9888899999999999999977654    899999986

C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner. Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode. Munc13 is the mammalian homolog which are expressed in the brain. There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters. Unc13 and Munc13 contain both C1 and C2 domains. There are two C2 related domains present, one central and one at the carboxyl end. Munc13-1 contains a third C2-like domain. Munc13 interacts with syntaxin, synaptobrevi

>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins	Back alignment and domain information

>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip)	Back alignment and domain information

>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I	Back alignment and domain information

>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>cd08677 C2A_Synaptotagmin-13 C2 domain	Back alignment and domain information

>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2	Back alignment and domain information

>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16	Back alignment and domain information

>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5	Back alignment and domain information

>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8	Back alignment and domain information

>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10	Back alignment and domain information

>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3)	Back alignment and domain information

>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3	Back alignment and domain information

>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins	Back alignment and domain information

>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3	Back alignment and domain information

>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7	Back alignment and domain information

>cd08680 C2_Kibra C2 domain found in Human protein Kibra	Back alignment and domain information

>KOG1030\|consensus	Back alignment and domain information

>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>cd04041 C2A_fungal C2 domain first repeat; fungal group	Back alignment and domain information

>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2)	Back alignment and domain information

>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4	Back alignment and domain information

>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11	Back alignment and domain information

>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42)	Back alignment and domain information

>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein	Back alignment and domain information

>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family	Back alignment and domain information

>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins	Back alignment and domain information

>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17	Back alignment and domain information

>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins	Back alignment and domain information

>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone	Back alignment and domain information

>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins	Back alignment and domain information

>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4	Back alignment and domain information

>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP)	Back alignment and domain information

>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene	Back alignment and domain information

>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins	Back alignment and domain information

>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins	Back alignment and domain information

>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset	Back alignment and domain information

>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1)	Back alignment and domain information

>cd08375 C2_Intersectin C2 domain present in Intersectin	Back alignment and domain information

>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins	Back alignment and domain information

>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs)	Back alignment and domain information

>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD)	Back alignment and domain information

>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD)	Back alignment and domain information

>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group	Back alignment and domain information

>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4	Back alignment and domain information

>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins	Back alignment and domain information

>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins	Back alignment and domain information

>KOG0696\|consensus	Back alignment and domain information

>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13	Back alignment and domain information

>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon	Back alignment and domain information

>cd04046 C2_Calpain C2 domain present in Calpain proteins	Back alignment and domain information

>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin	Back alignment and domain information

>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin	Back alignment and domain information

>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12	Back alignment and domain information

>KOG2059\|consensus	Back alignment and domain information

>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins	Back alignment and domain information

>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4	Back alignment and domain information

>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins	Back alignment and domain information

>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin	Back alignment and domain information

>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins	Back alignment and domain information

>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins	Back alignment and domain information

>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus)	Back alignment and domain information

>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain	Back alignment and domain information

>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP)	Back alignment and domain information

>cd04032 C2_Perforin C2 domain of Perforin	Back alignment and domain information

>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7	Back alignment and domain information

>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1	Back alignment and domain information

>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16	Back alignment and domain information

>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17	Back alignment and domain information

>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1)	Back alignment and domain information

>cd04048 C2A_Copine C2 domain first repeat in Copine	Back alignment and domain information

>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma	Back alignment and domain information

>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10	Back alignment and domain information

>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin	Back alignment and domain information

>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin	Back alignment and domain information

>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins	Back alignment and domain information

>KOG1028\|consensus	Back alignment and domain information

>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15	Back alignment and domain information

>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family	Back alignment and domain information

>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1)	Back alignment and domain information

>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin	Back alignment and domain information

>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain	Back alignment and domain information

>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase	Back alignment and domain information

>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs)	Back alignment and domain information

>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein	Back alignment and domain information

>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC)	Back alignment and domain information

>cd04047 C2B_Copine C2 domain second repeat in Copine	Back alignment and domain information

>PLN03008 Phospholipase D delta	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking	Back alignment and domain information

>KOG1011\|consensus	Back alignment and domain information

>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins	Back alignment and domain information

>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin	Back alignment and domain information

>cd00030 C2 C2 domain	Back alignment and domain information

>smart00239 C2 Protein kinase C conserved region 2 (CalB)	Back alignment and domain information

>PLN02223 phosphoinositide phospholipase C	Back alignment and domain information

>KOG1028\|consensus	Back alignment and domain information

>PLN02952 phosphoinositide phospholipase C	Back alignment and domain information

>KOG2059\|consensus	Back alignment and domain information

>KOG1264\|consensus	Back alignment and domain information

>KOG0169\|consensus	Back alignment and domain information

>PLN02230 phosphoinositide phospholipase C 4	Back alignment and domain information

>PLN02222 phosphoinositide phospholipase C 2	Back alignment and domain information

>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only]	Back alignment and domain information

>KOG1328\|consensus	Back alignment and domain information

>PLN02228 Phosphoinositide phospholipase C	Back alignment and domain information

>KOG1328\|consensus	Back alignment and domain information

>PLN02270 phospholipase D alpha	Back alignment and domain information

>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only]	Back alignment and domain information

>KOG1031\|consensus	Back alignment and domain information

>KOG0905\|consensus	Back alignment and domain information

>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae	Back alignment and domain information

>KOG2060\|consensus	Back alignment and domain information

>PF00397 WW: WW domain; InterPro: IPR001202 Synonym(s): Rsp5 or WWP domain The WW domain is a short conserved region in a number of unrelated proteins, which folds as a stable, triple stranded beta-sheet	Back alignment and domain information

>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus)	Back alignment and domain information

>KOG1011\|consensus	Back alignment and domain information

>smart00456 WW Domain with 2 conserved Trp (W) residues	Back alignment and domain information

>KOG1326\|consensus	Back alignment and domain information

>PLN02352 phospholipase D epsilon	Back alignment and domain information

>KOG1013\|consensus	Back alignment and domain information

>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs

Back alignment and domain information

>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins	Back alignment and domain information

>KOG1013\|consensus	Back alignment and domain information

>PLN02964 phosphatidylserine decarboxylase	Back alignment and domain information

>KOG3259\|consensus	Back alignment and domain information

>KOG1265\|consensus	Back alignment and domain information

>KOG1891\|consensus	Back alignment and domain information

>KOG1326\|consensus	Back alignment and domain information

>KOG1891\|consensus	Back alignment and domain information

>KOG1327\|consensus	Back alignment and domain information

>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length	Back alignment and domain information

>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>KOG3837\|consensus	Back alignment and domain information

>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2	Back alignment and domain information

>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks)	Back alignment and domain information

>PF15627 CEP76-C2: CEP76 C2 domain	Back alignment and domain information

>KOG3209\|consensus	Back alignment and domain information

>KOG1452\|consensus	Back alignment and domain information

>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins	Back alignment and domain information

>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen []	Back alignment and domain information

>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A	Back alignment and domain information

>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain	Back alignment and domain information

>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins	Back alignment and domain information

>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins	Back alignment and domain information

>KOG1327\|consensus	Back alignment and domain information

>KOG3209\|consensus	Back alignment and domain information

>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain	Back alignment and domain information

>COG5104 PRP40 Splicing factor [RNA processing and modification]	Back alignment and domain information

>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins	Back alignment and domain information

>KOG0940\|consensus	Back alignment and domain information

>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins	Back alignment and domain information

>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		225
3b7y_A		153	E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-	1e-33
3m7f_B		176	E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1	1e-30
2ep6_A		133	MCTP2 protein; beta sandwich, Ca2+ binding, membra	2e-28
1wfj_A		136	Putative elicitor-responsive gene; C2 domain, rike	3e-26
3pyc_A		132	E3 ubiquitin-protein ligase smurf1; phospholipid b	1e-25
2nq3_A		173	Itchy homolog E3 ubiquitin protein ligase; C2 doma	4e-25
3kwu_A		148	MUNC13-1; calcium binding protein, phospholipid bi	6e-24
3rdl_A		137	Protein kinase C alpha type; protein kinase PKC, t	6e-23
2fk9_A		157	Protein kinase C, ETA type; ATP-binding, metal-bin	3e-20
2dmh_A		140	Myoferlin; beta-sandwich, FER-1-like protein 3, mu	2e-19
1gmi_A		136	Protein kinase C, epsilon type; PKC, C2 domain, X-	5e-19
1wfm_A		138	Synaptotagmin XIII; C2 domain, exocytosis, neurotr	7e-19
1wr4_A		36	Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M	3e-18
2ysh_A		40	GAS-7, growth-arrest-specific protein 7; WW domain	3e-18
1a25_A		149	CALB, protein kinase C (beta); calcium++/phospholi	4e-18
1ugk_A		138	Synaptotagmin IV, KIAA1342; beta sandwich, structu	5e-18
1ymz_A		43	CC45; artificial protein, computational design, un	5e-18
2dmv_A		43	Itchy homolog E3 ubiquitin protein ligase; WW doma	5e-18
3f04_A		143	Synaptotagmin-1; C2A, calcium, cell junction, cyto	1e-17
2kyk_A		39	E3 ubiquitin-protein ligase itchy homolog; LMP2A,	2e-17
1wr3_A		36	Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M	2e-17
1rsy_A		152	Synaptotagmin I; calcium/phospholipid binding prot	3e-17
2d8k_A		141	Synaptotagmin VII; exocytosis, calcium binding, ly	3e-17
2enp_A		147	B/K protein; C2 type 1,beta sandwich, structural g	6e-17
3n5a_A		138	Synaptotagmin-7; calcium/phospholipid binding prot	6e-17
1rlw_A		126	Phospholipase A2, CALB domain; hydrolase, C2 domai	1e-16
1i5h_W		50	Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains,	2e-16
2zaj_A		49	Membrane-associated guanylate kinase, WW and PDZ d	2e-16
3fdw_A		148	Synaptotagmin-like protein 4; structural genomics,	3e-16
1rh8_A		142	Piccolo protein; beta-sandwich, metal binding prot	4e-16
2r83_A		284	Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel	7e-16
2r83_A		284	Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel	3e-15
2kpz_A		49	E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV	8e-16
2ysb_A		49	Salvador homolog 1 protein; WW domain, structural	9e-16
2ysd_A		57	Membrane-associated guanylate kinase, WW and PDZ d	1e-15
1wr7_A		41	NEDD4-2; all-beta, ligase; NMR {Mus musculus} Leng	1e-15
2yse_A		60	Membrane-associated guanylate kinase, WW and PDZ d	1e-15
1e0m_A		37	Wwprototype; SH3 prototype, protein design, de nov	2e-15
2ysg_A		40	Syntaxin-binding protein 4; synip, STXBP4, WW doma	2e-15
2chd_A		142	Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium	2e-15
2ez5_W		46	Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma	2e-15
2djy_A		42	SMAD ubiquitination regulatory factor 2; beta shee	2e-15
1dqv_A		296	Synaptotagmin III; beta sandwich, calcium ION, C2	2e-15
1dqv_A		296	Synaptotagmin III; beta sandwich, calcium ION, C2	9e-15
2dwv_A		49	Salvador homolog 1 protein; WW domain, dimer, stru	2e-15
2b3r_A		134	Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA	2e-15
1tjx_A		159	Similar to synaptotagmini/P65; C2B domain, calcium	2e-15
2law_A		38	Yorkie homolog; YAP, SMAD1, CDK, signal transducti	3e-15
2z0u_A		155	WW domain-containing protein 1; C2 domain, alterna	3e-15
2jmf_A		53	E3 ubiquitin-protein ligase suppressor of deltex;	3e-15
1tk7_A		88	CG4244-PB; WW domain, notch, signaling protein; NM	4e-15
1tk7_A		88	CG4244-PB; WW domain, notch, signaling protein; NM	8e-14
2l4j_A		46	YES-associated protein 2 (YAP2); WW domain, medaka	5e-15
1w15_A		153	Synaptotagmin IV; metal binding protein, endocytos	6e-15
2q3x_A		171	Regulating synaptic membrane exocytosis protein 1;	8e-15
1jmq_A		46	YAP65, 65 kDa YES-associated protein; polyproline	1e-14
3nsj_A		540	Perforin-1; pore forming protein, immune system; H	1e-14
2dmg_A		142	KIAA1228 protein; beta-sandwich, structural genomi	1e-14
2cm5_A		166	Rabphilin-3A; protein transport, zinc-finger, Ca2+	1e-14
2ysf_A		40	E3 ubiquitin-protein ligase itchy homolog; AIP4, N	2e-14
3fbk_A		153	RGS3, RGP3, regulator of G-protein signaling 3; al	4e-14
1wmv_A		54	WWOX, WW domain containing oxidoreductase; all-bet	1e-13
2kxq_A		90	E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG	2e-13
2kxq_A		90	E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG	7e-13
1v27_A		141	Regulating synaptic membrane exocytosis protein 2;	4e-13
2bwq_A		129	Regulating synaptic membrane exocytosis protein 2;	4e-13
3l4h_A		109	E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d	5e-13
2l5f_A		92	PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA	2e-11
2l5f_A		92	PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA	4e-07
1o6w_A		75	PRP40, PRE-mRNA processing protein PRP40; WW domai	3e-10
1o6w_A		75	PRP40, PRE-mRNA processing protein PRP40; WW domai	2e-09
1cjy_A		749	CPLA2, protein (cytosolic phospholipase A2); lipid	1e-09
2jxw_A		75	WW domain-binding protein 4; WW domain containing	2e-09
2jxw_A		75	WW domain-binding protein 4; WW domain containing	1e-05
2cjt_A		131	UNC-13 homolog A, MUNC13-1; phorbol-ester binding,	4e-08
3bxj_A		483	RAS GTPase-activating protein syngap; GTPase activ	4e-08
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	7e-08
2cjs_A		167	UNC-13 homolog A, MUNC13-1; neurotransmitter trans	9e-08
2ysc_A		39	Amyloid beta A4 precursor protein-binding family B	1e-07
2e45_A		55	Fe65 protein, amyloid beta A4 precursor protein-bi	2e-07
2jv4_A		54	Peptidyl-prolyl CIS/trans isomerase; ppiase domain	4e-07
1ywi_A		41	Formin-binding protein 3; WW domain, class II, pro	6e-07
2ysi_A		40	Transcription elongation regulator 1; Ca150, FBP28	2e-06
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	6e-06
3tc5_A		166	Peptidyl-prolyl CIS-trans isomerase NIMA-interact;	7e-06
3olm_A		429	E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S	8e-06
2ho2_A		38	Fe65 protein, amyloid beta A4 protein-binding fami	2e-05
1e0l_A		37	Formin binding protein; SH3 domain, WW domain, FBP	2e-05
1yw5_A		177	Peptidyl prolyl CIS/trans isomerase; WW-domain, pp	1e-04
2dk1_A		50	WW domain-binding protein 4; WBP-4, formin- bindin	1e-04
3l9b_A		144	Otoferlin; C2-domain, beta-sheets, cell membrane,	2e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-04

>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153	Back alignment and structure

 Score =  117 bits (294), Expect = 1e-33
 Identities = 59/122 (48%), Positives = 76/122 (62%), Gaps = 8/122 (6%)

Query: 111 EEPTEQIRLRIIAGHSLAKKDIFGA-----RIDLNTVNGDQTIDSALTKTRKKTLNPVWN 165
           EE +  +R+R+IAG  LAKKDI GA     R+ L     +  + S  TKT KK+LNP WN
Sbjct: 16  EENSRIVRVRVIAGIGLAKKDILGASDPYVRVTLYD-PMNGVLTSVQTKTIKKSLNPKWN 74

Query: 166 EEFIFRVKPSEHKLVFQVFDMNRLTRDDFLGMVELSLLNLPRE--SDGCVIHNKKYILRP 223
           EE +FRV P +H+L+F+VFD NRLTRDDFLG V++ L  LP E          K ++L P
Sbjct: 75  EEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHP 134

Query: 224 RR 225
           R 
Sbjct: 135 RS 136

PyMOL of 3b7y

>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176	Back alignment and structure

>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133	Back alignment and structure

>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136	Back alignment and structure

>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132	Back alignment and structure

>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173	Back alignment and structure

>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148	Back alignment and structure

>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157	Back alignment and structure

>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140	Back alignment and structure

>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136	Back alignment and structure

>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138	Back alignment and structure

>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A* Length = 36	Back alignment and structure

>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40	Back alignment and structure

>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149	Back alignment and structure

>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138	Back alignment and structure

>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1 Length = 43	Back alignment and structure

>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 43	Back alignment and structure

>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143	Back alignment and structure

>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens} Length = 39	Back alignment and structure

>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} Length = 36	Back alignment and structure

>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152	Back alignment and structure

>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141	Back alignment and structure

>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147	Back alignment and structure

>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138	Back alignment and structure

>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126	Back alignment and structure

>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A* Length = 50	Back alignment and structure

>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens} Length = 49	Back alignment and structure

>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148	Back alignment and structure

>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142	Back alignment and structure

>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284	Back alignment and structure

>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284	Back alignment and structure

>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A* Length = 49	Back alignment and structure

>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1 Length = 49	Back alignment and structure

>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 57	Back alignment and structure

>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus} Length = 41	Back alignment and structure

>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 60	Back alignment and structure

>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1 Length = 37	Back alignment and structure

>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40	Back alignment and structure

>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142	Back alignment and structure

>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster} Length = 46	Back alignment and structure

>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A Length = 42	Back alignment and structure

>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296	Back alignment and structure

>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296	Back alignment and structure

>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 49	Back alignment and structure

>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134	Back alignment and structure

>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159	Back alignment and structure

>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens} Length = 38	Back alignment and structure

>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155	Back alignment and structure

>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A Length = 53	Back alignment and structure

>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88	Back alignment and structure

>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1 Length = 88	Back alignment and structure

>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes} Length = 46	Back alignment and structure

>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153	Back alignment and structure

>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171	Back alignment and structure

>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A* Length = 46	Back alignment and structure

>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Length = 540	Back alignment and structure

>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142	Back alignment and structure

>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166	Back alignment and structure

>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1 Length = 40	Back alignment and structure

>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153	Back alignment and structure

>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens} Length = 54	Back alignment and structure

>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90	Back alignment and structure

>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A* Length = 90	Back alignment and structure

>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141	Back alignment and structure

>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129	Back alignment and structure

>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens} Length = 109	Back alignment and structure

>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92	Back alignment and structure

>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens} Length = 92	Back alignment and structure

>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75	Back alignment and structure

>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1 Length = 75	Back alignment and structure

>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749	Back alignment and structure

>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75	Back alignment and structure

>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens} Length = 75	Back alignment and structure

>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131	Back alignment and structure

>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Length = 483	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Length = 261	Back alignment and structure

>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167	Back alignment and structure

>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 39	Back alignment and structure

>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 55	Back alignment and structure

>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans} Length = 54	Back alignment and structure

>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A Length = 41	Back alignment and structure

>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1 Length = 40	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624	Back alignment and structure

>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Length = 166	Back alignment and structure

>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae} Length = 429	Back alignment and structure

>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A Length = 38	Back alignment and structure

>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A Length = 37	Back alignment and structure

>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Length = 177	Back alignment and structure

>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1 Length = 50	Back alignment and structure

>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Length = 144	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		225
2z0u_A		155	WW domain-containing protein 1; C2 domain, alterna	99.85
2b3r_A		134	Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA	99.84
2d8k_A		141	Synaptotagmin VII; exocytosis, calcium binding, ly	99.84
3f04_A		143	Synaptotagmin-1; C2A, calcium, cell junction, cyto	99.84
3b7y_A		153	E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-	99.84
1rsy_A		152	Synaptotagmin I; calcium/phospholipid binding prot	99.83
2ep6_A		133	MCTP2 protein; beta sandwich, Ca2+ binding, membra	99.83
3m7f_B		176	E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1	99.83
1rh8_A		142	Piccolo protein; beta-sandwich, metal binding prot	99.83
3fdw_A		148	Synaptotagmin-like protein 4; structural genomics,	99.83
2q3x_A		171	Regulating synaptic membrane exocytosis protein 1;	99.82
1rlw_A		126	Phospholipase A2, CALB domain; hydrolase, C2 domai	99.82
2fk9_A		157	Protein kinase C, ETA type; ATP-binding, metal-bin	99.82
3kwu_A		148	MUNC13-1; calcium binding protein, phospholipid bi	99.82
1ugk_A		138	Synaptotagmin IV, KIAA1342; beta sandwich, structu	99.81
2enp_A		147	B/K protein; C2 type 1,beta sandwich, structural g	99.81
2dmh_A		140	Myoferlin; beta-sandwich, FER-1-like protein 3, mu	99.81
1wfm_A		138	Synaptotagmin XIII; C2 domain, exocytosis, neurotr	99.81
3fbk_A		153	RGS3, RGP3, regulator of G-protein signaling 3; al	99.8
1a25_A		149	CALB, protein kinase C (beta); calcium++/phospholi	99.8
1v27_A		141	Regulating synaptic membrane exocytosis protein 2;	99.8
2dmg_A		142	KIAA1228 protein; beta-sandwich, structural genomi	99.8
3rdl_A		137	Protein kinase C alpha type; protein kinase PKC, t	99.8
2bwq_A		129	Regulating synaptic membrane exocytosis protein 2;	99.8
1wfj_A		136	Putative elicitor-responsive gene; C2 domain, rike	99.79
1gmi_A		136	Protein kinase C, epsilon type; PKC, C2 domain, X-	99.79
1tjx_A		159	Similar to synaptotagmini/P65; C2B domain, calcium	99.79
3n5a_A		138	Synaptotagmin-7; calcium/phospholipid binding prot	99.78
3pyc_A		132	E3 ubiquitin-protein ligase smurf1; phospholipid b	99.78
2cm5_A		166	Rabphilin-3A; protein transport, zinc-finger, Ca2+	99.77
2chd_A		142	Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium	99.77
1w15_A		153	Synaptotagmin IV; metal binding protein, endocytos	99.75
2r83_A		284	Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel	99.75
2nq3_A		173	Itchy homolog E3 ubiquitin protein ligase; C2 doma	99.75
2cjt_A		131	UNC-13 homolog A, MUNC13-1; phorbol-ester binding,	99.7
1dqv_A		296	Synaptotagmin III; beta sandwich, calcium ION, C2	99.67
2r83_A		284	Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel	99.67
1cjy_A		749	CPLA2, protein (cytosolic phospholipase A2); lipid	99.66
2cjs_A		167	UNC-13 homolog A, MUNC13-1; neurotransmitter trans	99.64
3jzy_A		510	Intersectin 2; C2 domain, structural genomics cons	99.62
1dqv_A		296	Synaptotagmin III; beta sandwich, calcium ION, C2	99.59
3nsj_A		540	Perforin-1; pore forming protein, immune system; H	99.57
1djx_A		624	PLC-D1, phosphoinositide-specific phospholipase C,	99.54
3bxj_A		483	RAS GTPase-activating protein syngap; GTPase activ	99.46
3l9b_A		144	Otoferlin; C2-domain, beta-sheets, cell membrane,	99.45
3pfq_A		674	PKC-B, PKC-beta, protein kinase C beta type; phosp	99.39
1tk7_A		88	CG4244-PB; WW domain, notch, signaling protein; NM	99.38
2kxq_A		90	E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG	99.36
3ohm_B		885	1-phosphatidylinositol-4,5-bisphosphate phosphodi	99.22
2zkm_X		799	1-phosphatidylinositol-4,5-bisphosphate phosphodie	99.17
2ysg_A		40	Syntaxin-binding protein 4; synip, STXBP4, WW doma	99.16
3qr0_A		816	Phospholipase C-beta (PLC-beta); PH domain, EF han	99.16
2dwv_A		49	Salvador homolog 1 protein; WW domain, dimer, stru	99.15
2djy_A		42	SMAD ubiquitination regulatory factor 2; beta shee	99.14
2law_A		38	Yorkie homolog; YAP, SMAD1, CDK, signal transducti	99.13
2ysf_A		40	E3 ubiquitin-protein ligase itchy homolog; AIP4, N	99.13
2ez5_W		46	Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma	99.11
1wr7_A		41	NEDD4-2; all-beta, ligase; NMR {Mus musculus}	99.1
1wr3_A		36	Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M	99.1
2zaj_A		49	Membrane-associated guanylate kinase, WW and PDZ d	99.09
2kyk_A		39	E3 ubiquitin-protein ligase itchy homolog; LMP2A,	99.09
1wr4_A		36	Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M	99.06
2jmf_A		53	E3 ubiquitin-protein ligase suppressor of deltex;	99.05
2l4j_A		46	YES-associated protein 2 (YAP2); WW domain, medaka	99.05
1i5h_W		50	Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains,	99.05
2ysb_A		49	Salvador homolog 1 protein; WW domain, structural	99.04
1wmv_A		54	WWOX, WW domain containing oxidoreductase; all-bet	99.04
2dmv_A		43	Itchy homolog E3 ubiquitin protein ligase; WW doma	99.03
2yse_A		60	Membrane-associated guanylate kinase, WW and PDZ d	99.02
2kpz_A		49	E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV	99.01
2ysd_A		57	Membrane-associated guanylate kinase, WW and PDZ d	98.98
2ho2_A		38	Fe65 protein, amyloid beta A4 protein-binding fami	98.98
1e0m_A		37	Wwprototype; SH3 prototype, protein design, de nov	98.93
2ysh_A		40	GAS-7, growth-arrest-specific protein 7; WW domain	98.9
2e45_A		55	Fe65 protein, amyloid beta A4 precursor protein-bi	98.89
2ysc_A		39	Amyloid beta A4 precursor protein-binding family B	98.88
1ymz_A		43	CC45; artificial protein, computational design, un	98.85
1jmq_A		46	YAP65, 65 kDa YES-associated protein; polyproline	98.76
2enj_A		138	NPKC-theta, protein kinase C theta type; beta-sand	98.75
3l4h_A		109	E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d	98.74
2jv4_A		54	Peptidyl-prolyl CIS/trans isomerase; ppiase domain	98.73
1yrk_A		126	NPKC-delta, protein kinase C, delta type; C2 domai	98.72
1o6w_A		75	PRP40, PRE-mRNA processing protein PRP40; WW domai	98.67
2l5f_A		92	PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA	98.57
1tk7_A		88	CG4244-PB; WW domain, notch, signaling protein; NM	98.54
2kxq_A		90	E3 ubiquitin-protein ligase smurf2; WW, smurf2, TG	98.48
2jxw_A		75	WW domain-binding protein 4; WW domain containing	98.47
3tc5_A		166	Peptidyl-prolyl CIS-trans isomerase NIMA-interact;	98.3
1eg3_A		261	Dystrophin; EF-hand like domain, WW domain, struct	98.24
3olm_A		429	E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {S	98.18
2jx8_A		52	Hpcif1, phosphorylated CTD-interacting factor 1; p	98.16
2l5f_A		92	PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA	97.93
2ysi_A		40	Transcription elongation regulator 1; Ca150, FBP28	97.89
1ywi_A		41	Formin-binding protein 3; WW domain, class II, pro	97.69
1e0l_A		37	Formin binding protein; SH3 domain, WW domain, FBP	97.45
1e0n_A		27	Hypothetical protein; YJQ8WW domain, WW domain, sa	97.44
1o6w_A		75	PRP40, PRE-mRNA processing protein PRP40; WW domai	97.43
2jxw_A		75	WW domain-binding protein 4; WW domain containing	96.95
2ysd_A		57	Membrane-associated guanylate kinase, WW and PDZ d	96.46
2zaj_A		49	Membrane-associated guanylate kinase, WW and PDZ d	95.52
1yw5_A		177	Peptidyl prolyl CIS/trans isomerase; WW-domain, pp	95.45
2dk1_A		50	WW domain-binding protein 4; WBP-4, formin- bindin	95.09
3l4c_A		220	Dedicator of cytokinesis protein 1; DOCK180, DOCK1	94.64
2yse_A		60	Membrane-associated guanylate kinase, WW and PDZ d	94.3
2ysg_A		40	Syntaxin-binding protein 4; synip, STXBP4, WW doma	94.3
3hhm_A		1091	Phosphatidylinositol-4,5-bisphosphate 3-kinase cat	94.09
2dk7_A		73	Transcription elongation regulator 1; structural g	94.06
2ez5_W		46	Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW doma	93.7
2wxf_A		940	Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca	93.53
2ysf_A		40	E3 ubiquitin-protein ligase itchy homolog; AIP4, N	93.1
3le4_A		79	Microprocessor complex subunit DGCR8; WW motif, di	92.35
2dmv_A		43	Itchy homolog E3 ubiquitin protein ligase; WW doma	92.31
2ysb_A		49	Salvador homolog 1 protein; WW domain, structural	91.99
2law_A		38	Yorkie homolog; YAP, SMAD1, CDK, signal transducti	91.92
2kpz_A		49	E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV	91.67
1e7u_A		961	Phosphatidylinositol 3-kinase catalytic subunit; p	91.65
1i5h_W		50	Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains,	91.48
1wr4_A		36	Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M	91.41
1wr3_A		36	Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {M	90.86
2ysh_A		40	GAS-7, growth-arrest-specific protein 7; WW domain	90.83
2l4j_A		46	YES-associated protein 2 (YAP2); WW domain, medaka	90.54
2ho2_A		38	Fe65 protein, amyloid beta A4 protein-binding fami	90.51
2djy_A		42	SMAD ubiquitination regulatory factor 2; beta shee	90.4
2kyk_A		39	E3 ubiquitin-protein ligase itchy homolog; LMP2A,	90.22
1wr7_A		41	NEDD4-2; all-beta, ligase; NMR {Mus musculus}	89.38
2dwv_A		49	Salvador homolog 1 protein; WW domain, dimer, stru	89.34
2jmf_A		53	E3 ubiquitin-protein ligase suppressor of deltex;	89.32
1wmv_A		54	WWOX, WW domain containing oxidoreductase; all-bet	89.16
2y3a_A		1092	Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca	88.96
3l4h_A		109	E3 ubiquitin-protein ligase HECW1; E3 ligase, WW d	87.46
1jmq_A		46	YAP65, 65 kDa YES-associated protein; polyproline	87.19
2jv4_A		54	Peptidyl-prolyl CIS/trans isomerase; ppiase domain	82.18

>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens}	Back alignment and structure

Probab=99.85  E-value=1.5e-21  Score=147.91  Aligned_cols=107  Identities=19%  Similarity=0.174  Sum_probs=90.4

Q ss_pred             CccceeEeeeeeecCCcCCCCCC-eeEEEEeCCC---CccCcccCceecCCCCCeeccEEEEEecCC---CcEEEEEEEE
Q psy8342         113 PTEQIRLRIIAGHSLAKKDIFGA-RIDLNTVNGD---QTIDSALTKTRKKTLNPVWNEEFIFRVKPS---EHKLVFQVFD  185 (225)
Q Consensus       113 ~~~~l~v~vi~a~~L~~~d~~g~-~~~~~~~~~~---~~~~~~kT~v~~~~~~P~Wne~f~f~v~~~---~~~L~v~V~d  185 (225)
                      ..+.|.|.|++|++|+.+|.+|. ++|+.+....   ....++||+++++++||+|||+|.|.+...   ...|.|+|||
T Consensus        41 ~~~~L~V~Vi~a~~L~~~d~~g~sDPyVkv~l~~~~~~~~~~~kT~v~~~tlnP~wnE~F~f~v~~~~l~~~~L~~~V~d  120 (155)
T 2z0u_A           41 KNKQFAILIIQLSNLSALLQQQDQKVNIRVAVLPCSESTTCLFRTRPLDASDTLVFNEVFWVSMSYPALHQKTLRVDVCT  120 (155)
T ss_dssp             TTTEEEEEEEEEECGGGTCCSCCSEEEEEEEEESCSCHHHHEEECCCEECCSSEEEEEEEEEECCHHHHHHCEEEEEEEE
T ss_pred             CCCEEEEEEEEccCcCCcccCCCCCEEEEEEEecCCCCCccceeCCcCCCCCCCccccEEEEEcCHHHhCcCEEEEEEEE
Confidence            45899999999999999998888 8888766543   222368999999999999999999998753   3689999999


Q ss_pred             ccCCCCCceeEEEEEECcccCC-CCCCccccCeeEEccc
Q psy8342         186 MNRLTRDDFLGMVELSLLNLPR-ESDGCVIHNKKYILRP  223 (225)
Q Consensus       186 ~d~~~~d~~lG~~~i~l~~l~~-~~~~~~~~~~w~~L~p  223 (225)
                      +|.+++++|||++.|+|.++.. +...    ..||.|+|
T Consensus       121 ~d~~~~~d~iG~~~i~l~~l~~~~~~~----~~W~~L~~  155 (155)
T 2z0u_A          121 TDRSHLEECLGGAQISLAEVCRSGERS----TRWYNLLS  155 (155)
T ss_dssp             ECTTSCEEEEEEEEEECTTSCTTCCCE----EEEEEEBC
T ss_pred             CCCCCCCcEEEEEEEEHHHccCCCCcc----ccceEccC
Confidence            9999999999999999999963 3333    79999986

PyMOL of 2z0u

>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus}	Back alignment and structure

>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A*	Back alignment and structure

>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A	Back alignment and structure

>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1	Back alignment and structure

>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus}	Back alignment and structure

>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens}	Back alignment and structure

>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus}	Back alignment and structure

>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1	Back alignment and structure

>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens}	Back alignment and structure

>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A*	Back alignment and structure

>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0	Back alignment and structure

>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2	Back alignment and structure

>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2	Back alignment and structure

>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1	Back alignment and structure

>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A*	Back alignment and structure

>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus}	Back alignment and structure

>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A	Back alignment and structure

>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A	Back alignment and structure

>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A	Back alignment and structure

>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A	Back alignment and structure

>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1	Back alignment and structure

>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1	Back alignment and structure

>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A	Back alignment and structure

>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2	Back alignment and structure

>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A	Back alignment and structure

>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1	Back alignment and structure

>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B	Back alignment and structure

>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A	Back alignment and structure

>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus}	Back alignment and structure

>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A	Back alignment and structure

>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus}	Back alignment and structure

>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus}	Back alignment and structure

>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A	Back alignment and structure

>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1	Back alignment and structure

>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A*	Back alignment and structure

>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens}	Back alignment and structure

>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B	Back alignment and structure

>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1	Back alignment and structure

>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A	Back alignment and structure

>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A	Back alignment and structure

>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens}	Back alignment and structure

>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1	Back alignment and structure

>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster}	Back alignment and structure

>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus}	Back alignment and structure

>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus}	Back alignment and structure

>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens}	Back alignment and structure

>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens}	Back alignment and structure

>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A*	Back alignment and structure

>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A	Back alignment and structure

>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes}	Back alignment and structure

>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A*	Back alignment and structure

>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1	Back alignment and structure

>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens}	Back alignment and structure

>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A*	Back alignment and structure

>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1	Back alignment and structure

>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A	Back alignment and structure

>1e0m_A Wwprototype; SH3 prototype, protein design, de novo protein; NMR {} SCOP: k.22.1.1	Back alignment and structure

>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1	Back alignment and structure

>2e45_A Fe65 protein, amyloid beta A4 precursor protein-binding family B member 1; triple-stranded beta-sheet; NMR {Homo sapiens} SCOP: b.72.1.1	Back alignment and structure

>2ysc_A Amyloid beta A4 precursor protein-binding family B member 3; Fe65-like protein 2, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1	Back alignment and structure

>1ymz_A CC45; artificial protein, computational design, unknown function; NMR {Synthetic} SCOP: k.22.1.1	Back alignment and structure

>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A*	Back alignment and structure

>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens}	Back alignment and structure

>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens}	Back alignment and structure

>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans}	Back alignment and structure

>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A	Back alignment and structure

>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1	Back alignment and structure

>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens}	Back alignment and structure

>1tk7_A CG4244-PB; WW domain, notch, signaling protein; NMR {Drosophila melanogaster} SCOP: b.72.1.1 b.72.1.1	Back alignment and structure

>2kxq_A E3 ubiquitin-protein ligase smurf2; WW, smurf2, TGF-beta, modular binding, protein BIN; NMR {Homo sapiens} PDB: 2lb0_A* 2laz_A*	Back alignment and structure

>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens}	Back alignment and structure

>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ...	Back alignment and structure

>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A	Back alignment and structure

>3olm_A E3 ubiquitin-protein ligase RSP5; ligase; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>2jx8_A Hpcif1, phosphorylated CTD-interacting factor 1; protein fragment, WW domain, triple-standed beta-sheet, alpha-helix, nucleus, phosphorylation; NMR {Homo sapiens}	Back alignment and structure

>2l5f_A PRE-mRNA-processing factor 40 homolog A; 2WW, HYPA, FBP11, protein binding; NMR {Homo sapiens}	Back alignment and structure

>2ysi_A Transcription elongation regulator 1; Ca150, FBP28, WW domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.22.1.1	Back alignment and structure

>1ywi_A Formin-binding protein 3; WW domain, class II, proline-rich peptides, protein-protein interactions, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1ywj_A 1zr7_A 2dyf_A	Back alignment and structure

>1e0l_A Formin binding protein; SH3 domain, WW domain, FBP28, signal transduction; NMR {Mus musculus} SCOP: b.72.1.1 PDB: 2jup_W 2rly_W 2rm0_W 2nnt_A	Back alignment and structure

>1e0n_A Hypothetical protein; YJQ8WW domain, WW domain, saccharomyces cerevisae, YJQ8 protein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1	Back alignment and structure

>1o6w_A PRP40, PRE-mRNA processing protein PRP40; WW domain PAIR, nuclear protein, mRNA splicing, ribonucleoprotein; NMR {Saccharomyces cerevisiae} SCOP: b.72.1.1 b.72.1.1	Back alignment and structure

>2jxw_A WW domain-binding protein 4; WW domain containing protein, FBP21, WBP4, metal- binding, mRNA processing, mRNA splicing, nucleus, polymorphism; NMR {Homo sapiens}	Back alignment and structure

>2ysd_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1	Back alignment and structure

>2zaj_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; BAI1-associated protein 1 (BAP-1); NMR {Homo sapiens}	Back alignment and structure

>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans}	Back alignment and structure

>2dk1_A WW domain-binding protein 4; WBP-4, formin- binding protein 21, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.72.1.1	Back alignment and structure

>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens}	Back alignment and structure

>2yse_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; MAGI-1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysg_A Syntaxin-binding protein 4; synip, STXBP4, WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1	Back alignment and structure

>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A	Back alignment and structure

>2dk7_A Transcription elongation regulator 1; structural genomics, WW domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ez5_W Dnedd4, E3 ubiquitin-protein ligase NEDD4; WW domain, PY motif, binding affinity, signalling protein,ligase; NMR {Drosophila melanogaster}	Back alignment and structure

>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A*	Back alignment and structure

>2ysf_A E3 ubiquitin-protein ligase itchy homolog; AIP4, NAPP1, WW domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.22.1.1	Back alignment and structure

>3le4_A Microprocessor complex subunit DGCR8; WW motif, dimerization, 3D domain swapping, heme binding, MI processing, heme, iron, metal-binding, nucleus; 1.70A {Homo sapiens}	Back alignment and structure

>2dmv_A Itchy homolog E3 ubiquitin protein ligase; WW domain, three stranded antiparallel beta sheet, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysb_A Salvador homolog 1 protein; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: k.22.1.1	Back alignment and structure

>2law_A Yorkie homolog; YAP, SMAD1, CDK, signal transduction, signaling protein-TRAN complex; NMR {Homo sapiens}	Back alignment and structure

>2kpz_A E3 ubiquitin-protein ligase NEDD4; WW domain, HTLV1, NEDD4, human modular domain, complex, HOST interaction, ligase; NMR {Homo sapiens} PDB: 2kq0_A 2laj_A*	Back alignment and structure

>1i5h_W Rnedd4, ubiquitin ligase NEDD4; NEDD4, WW domains, ENAC, PY motif, liddle syndrome, proline-rich, ligase; NMR {Rattus norvegicus} SCOP: b.72.1.1 PDB: 1yiu_A 2jo9_A 2joc_A*	Back alignment and structure

>1wr4_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus} PDB: 2lb2_A*	Back alignment and structure

>1wr3_A Ubiquitin-protein ligase NEDD4-2; all-beta; NMR {Mus musculus}	Back alignment and structure

>2ysh_A GAS-7, growth-arrest-specific protein 7; WW domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.22.1.1	Back alignment and structure

>2l4j_A YES-associated protein 2 (YAP2); WW domain, medaka, transcription; NMR {Oryzias latipes}	Back alignment and structure

>2ho2_A Fe65 protein, amyloid beta A4 protein-binding family B member 1; WW domain, beta sheet, Fe65, protein binding; 1.33A {Homo sapiens} SCOP: b.72.1.1 PDB: 2idh_A* 2oei_A	Back alignment and structure

>2djy_A SMAD ubiquitination regulatory factor 2; beta sheet, polyproline type II helix, PPII, ligase/signaling protein complex; NMR {Homo sapiens} PDB: 2lb1_A	Back alignment and structure

>2kyk_A E3 ubiquitin-protein ligase itchy homolog; LMP2A, PY motif, WW domain; NMR {Homo sapiens}	Back alignment and structure

>1wr7_A NEDD4-2; all-beta, ligase; NMR {Mus musculus}	Back alignment and structure

>2dwv_A Salvador homolog 1 protein; WW domain, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2jmf_A E3 ubiquitin-protein ligase suppressor of deltex; WW domain, solution, complex, ligase/signaling protein complex; NMR {Drosophila melanogaster} SCOP: b.72.1.1 PDB: 2op7_A	Back alignment and structure

>1wmv_A WWOX, WW domain containing oxidoreductase; all-beta, apoptosis; NMR {Homo sapiens}	Back alignment and structure

>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus}	Back alignment and structure

>3l4h_A E3 ubiquitin-protein ligase HECW1; E3 ligase, WW domain, UBL-conjugation pathway, structural GE structural genomics consortium, SGC, coiled coil; HET: MSE; 1.80A {Homo sapiens}	Back alignment and structure

>1jmq_A YAP65, 65 kDa YES-associated protein; polyproline ligand, YAP65 mutant, structural protein; NMR {Homo sapiens} SCOP: b.72.1.1 PDB: 1k9q_A* 1k9r_A 1k5r_A* 2lax_A* 2lay_A*	Back alignment and structure

>2jv4_A Peptidyl-prolyl CIS/trans isomerase; ppiase domain, WW domain group IV, rotamase; NMR {Emericella nidulans}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		225
d1i5hw_		50	b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain	5e-17
d1tk7a1		45	b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb)	2e-16
d2jmfa1		33	b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII	7e-16
d1w15a_		138	b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi	3e-15
d1jmqa_		46	b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens	8e-15
d1wfja_		136	b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr	1e-14
d1pina1		34	b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Ho	3e-14
d1ugka_		138	b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens	6e-14
d2bwqa1		125	b.7.1.2 (A:729-853) Regulating synaptic membrane e	5e-13
d1a25a_		132	b.7.1.2 (A:) C2 domain from protein kinase c (beta	8e-13
d2cm5a1		137	b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (	1e-12
d1uowa_		157	b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu	4e-12
d2rm0w1		37	b.72.1.1 (W:1-37) Formin binding protein FBP28 dom	2e-10
d1dqva2		145	b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus	2e-10
d1o6wa2		46	b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's	5e-10
d1rsya_		143	b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu	7e-10
d2zkmx2		122	b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human	2e-09
d1dqva1		130	b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus	3e-09
d2ep6a1		126	b.7.1.1 (A:92-217) Multiple C2 and transmembrane d	3e-09
d1rh8a_		142	b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax	5e-09
d1qasa2		131	b.7.1.1 (A:626-756) PI-specific phospholipase C is	9e-09
d1ywia1		28	b.72.1.1 (A:15-42) Huntingtin-interacting protein	2e-07
d2nq3a1		133	b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc	2e-07
d1o6wa1		29	b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's y	3e-07
d1gmia_		136	b.7.1.1 (A:) Domain from protein kinase C epsilon	9e-07
d1rlwa_		126	b.7.1.1 (A:) Domain from cytosolic phospholipase A	1e-06
d2dk1a1		38	b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP	5e-06
d1bdya_		123	b.7.1.1 (A:) Domain from protein kinase C delta {R	5e-05
d2cjta1		128	b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus no	5e-05
d1wfma_		138	b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie	1e-04
d2ho2a1		33	b.72.1.1 (A:253-285) Amyloid beta A4 precursor pro	2e-04

>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 50	Back information, alignment and structure


class: All beta proteins
fold: WW domain-like
superfamily: WW domain
family: WW domain
domain: Ubiquitin ligase NEDD4 WWIII domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 70.2 bits (172), Expect = 5e-17
 Identities = 19/39 (48%), Positives = 26/39 (66%)

Query: 63  EQQGALPPGWEERTDANGRTYYVNHIARCTQWERPTVHH 101
              G LPPGWEERT  +GR +++NH  + TQWE P + +
Sbjct: 7   NDLGPLPPGWEERTHTDGRVFFINHNIKKTQWEDPRMQN 45

PyMOL of d1i5hw_

>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 45	Back information, alignment and structure

>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 33	Back information, alignment and structure

>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138	Back information, alignment and structure

>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46	Back information, alignment and structure

>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136	Back information, alignment and structure

>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]} Length = 34	Back information, alignment and structure

>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138	Back information, alignment and structure

>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125	Back information, alignment and structure

>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132	Back information, alignment and structure

>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137	Back information, alignment and structure

>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157	Back information, alignment and structure

>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]} Length = 37	Back information, alignment and structure

>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145	Back information, alignment and structure

>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 46	Back information, alignment and structure

>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143	Back information, alignment and structure

>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122	Back information, alignment and structure

>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130	Back information, alignment and structure

>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126	Back information, alignment and structure

>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142	Back information, alignment and structure

>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131	Back information, alignment and structure

>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]} Length = 28	Back information, alignment and structure

>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133	Back information, alignment and structure

>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 29	Back information, alignment and structure

>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Length = 136	Back information, alignment and structure

>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126	Back information, alignment and structure

>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 38	Back information, alignment and structure

>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 123	Back information, alignment and structure

>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128	Back information, alignment and structure

>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138	Back information, alignment and structure

>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 33	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		225
d2ep6a1		126	Multiple C2 and transmembrane domain-containing pr	99.84
d1rh8a_		142	Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]}	99.82
d1a25a_		132	C2 domain from protein kinase c (beta) {Rat (Rattu	99.82
d1rsya_		143	Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10	99.81
d1dqva1		130	Synaptotagmin III {Rat (Rattus norvegicus) [TaxId:	99.81
d1rlwa_		126	Domain from cytosolic phospholipase A2 {Human (Hom	99.81
d1wfja_		136	C2 domain protein At1g63220 {Thale cress (Arabidop	99.78
d1gmia_		136	Domain from protein kinase C epsilon {Rat (Rattus	99.77
d2cjta1		128	Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId:	99.77
d2bwqa1		125	Regulating synaptic membrane exocytosis protein, r	99.76
d1wfma_		138	Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9	99.76
d1qasa2		131	PI-specific phospholipase C isozyme D1 (PLC-D1), C	99.73
d1ugka_		138	Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960	99.72
d1uowa_		157	Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10	99.72
d2nq3a1		133	E3 ubiquitin-protein ligase Itchy {Human (Homo sap	99.71
d1w15a_		138	Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId:	99.71
d2cm5a1		137	C2b-domain of rabphilin {Rat (Rattus norvegicus) [	99.69
d1dqva2		145	Synaptotagmin III {Rat (Rattus norvegicus) [TaxId:	99.67
d1bdya_		123	Domain from protein kinase C delta {Rat (Rattus no	99.47
d2zkmx2		122	Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI	99.41
d2jmfa1		33	Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr	99.39
d1tk7a1		45	Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso	99.21
d1i5hw_		50	Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n	99.13
d1jmqa_		46	Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606	99.12
d1pina1		34	Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId	98.96
d2ho2a1		33	Amyloid beta A4 precursor protein-binding family B	98.3
d2rm0w1		37	Formin binding protein FBP28 domain {Domestic mous	97.91
d1o6wa2		46	Splicing factor prp40 {Baker's yeast (Saccharomyce	97.63
d1o6wa1		29	Splicing factor prp40 {Baker's yeast (Saccharomyce	97.6
d1ywia1		28	Huntingtin-interacting protein HYPA/FBP11 {Human (	97.54
d2dk1a1		38	WW domain-binding protein 4, WBP4 {Human (Homo sap	96.68
d1e7ua2		174	Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa)	96.24
d2ysca1		26	Amyloid beta A4 precursor protein-binding family B	96.21
d1eg3a3		38	Dystrophin {Human (Homo sapiens) [TaxId: 9606]}	94.92
d2jmfa1		33	Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Dr	94.79
d1jmqa_		46	Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606	94.59
d1i5hw_		50	Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus n	93.47
d1tk7a1		45	Suppressor of deltex (Cg4244-pb) {Fruit fly (Droso	92.89

>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.84  E-value=2.1e-21  Score=140.41  Aligned_cols=104  Identities=27%  Similarity=0.412  Sum_probs=92.5

Q ss_pred             CCccceeEeeeeeecCCcCCCCCC-eeEEEEeCCCCccCcccCceecCCCCCeeccEEEEEecCCCcEEEEEEEEccCCC
Q psy8342         112 EPTEQIRLRIIAGHSLAKKDIFGA-RIDLNTVNGDQTIDSALTKTRKKTLNPVWNEEFIFRVKPSEHKLVFQVFDMNRLT  190 (225)
Q Consensus       112 ~~~~~l~v~vi~a~~L~~~d~~g~-~~~~~~~~~~~~~~~~kT~v~~~~~~P~Wne~f~f~v~~~~~~L~v~V~d~d~~~  190 (225)
                      ...|.|.|+|++|++|+.++..|. ++|+.+..+..   +++|++++++.||.|||+|.|.+......|.|+|||++.++
T Consensus         3 ~~~G~L~V~v~~A~~L~~~d~~g~~Dpyv~v~~~~~---~~~T~~~~~t~nP~wne~f~f~v~~~~~~L~i~V~d~~~~~   79 (126)
T d2ep6a1           3 KDVGILQVKVLKAADLLAADFSGKSDPFCLLELGND---RLQTHTVYKNLNPEWNKVFTFPIKDIHDVLEVTVFDEDGDK   79 (126)
T ss_dssp             CCSEEEEEEEEEEESCCCSSSSSCCCEEEEEEETTE---EEECCCCSSCSSCCCCEEEEEEESCTTCEEEEEEEEEETTE
T ss_pred             CccEEEEEEEEEeECCCCCCCCCCcCeEEEEEcCCe---EEEEEeeCCceeEEEEEEEEEEEeccCceeEEEEEEccCCc
Confidence            456899999999999999998888 88998888754   68999999999999999999999987789999999999999


Q ss_pred             CCceeEEEEEECcccCCCCCCccccCeeEEcccC
Q psy8342         191 RDDFLGMVELSLLNLPRESDGCVIHNKKYILRPR  224 (225)
Q Consensus       191 ~d~~lG~~~i~l~~l~~~~~~~~~~~~w~~L~pr  224 (225)
                      ++++||++.|+|.++..+.      ..||.|+.+
T Consensus        80 ~d~~lG~~~i~l~~l~~~~------~~~~~l~~~  107 (126)
T d2ep6a1          80 PPDFLGKVAIPLLSIRDGQ------PNCYVLKNK  107 (126)
T ss_dssp             EEEECCBCEEEGGGCCSSC------CEECCCBCS
T ss_pred             CcceEEEEEEEHHHCCCCC------ceEEEcccc
Confidence            9999999999999997653      578888754

PyMOL of d2ep6a1

>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pina1 b.72.1.1 (A:6-39) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ho2a1 b.72.1.1 (A:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2rm0w1 b.72.1.1 (W:1-37) Formin binding protein FBP28 domain {Domestic mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1o6wa2 b.72.1.1 (A:30-75) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1o6wa1 b.72.1.1 (A:1-29) Splicing factor prp40 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ywia1 b.72.1.1 (A:15-42) Huntingtin-interacting protein HYPA/FBP11 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dk1a1 b.72.1.1 (A:7-44) WW domain-binding protein 4, WBP4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ysca1 b.72.1.1 (A:8-33) Amyloid beta A4 precursor protein-binding family B member 3, APBB3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1eg3a3 b.72.1.1 (A:47-84) Dystrophin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2jmfa1 b.72.1.1 (A:521-553) Ubiquitin ligase NEDD4 WWIII domain {fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1jmqa_ b.72.1.1 (A:) Yap65 ww domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i5hw_ b.72.1.1 (W:) Ubiquitin ligase NEDD4 WWIII domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1tk7a1 b.72.1.1 (A:1-45) Suppressor of deltex (Cg4244-pb) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure