Psyllid ID: psy834


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920------
MREVQTLESQLFPVIRLERVTMERRPSPEIHIPTVDSTSSVSSEEIRRHESNLNLLRRKTQQRRTIQHTESSTSSSNSEQNLRELTKATTYIQNIESLLSQASDLIERRQLEAHRILYVLLKFRTELEGTHQSYDSGSDQAGFISPMETQDENPPSEHSSEFPGVERCLRRIESSLLNVRDLLENRPSDTLSPAQSEVQAEFLSGESREELTFANESSETNSQGVPRAERIMQRIESSLLQVRNLLELRPLTPPPQSDPESGTQGELSPPTPGPNPNSRANPNPNPNSRANPNLSRRAQANNSAQNPLFSKGEHLCGTLNFQDCTPHPLIIKIQQVFLYKKSCISFSPRRESLDSIGSSPSKQHSVGHTTSCNIPLRWQDRGGVCRQHDVKMQLQLNKEQQRLAPLLDRLRRYEADLKALYKRRWILQKKFDKVKHTRRQKFENMYDFVNDNIDATYKVHLKSSACQVYLIVSGWPKKKENLVIVVQSNLFSPQALTQSFGHAFLDITGAEQEPYLAGMNFSCTPQGRSYVGIQHLSGGERTLAALAMIFTIWKLVVRVQQLRPLTPPPQSDPESGTQGELSPPTPGPNPHSRVNPNPNSRANPNPNPNSRANPNLSRRAQANNSAQNPLPEVSSSPNTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSPISRTRFTKYTLQSTKSNLSRRAQANNSAQNPLPEVSSSPNTRSRVQSSPTTRSRVQSSPTTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSPSIRSAVQRSPNTRSRVQSSLTTHSAEQGSPTTRSTVQGAPRIHSREQSSPNTHSAEQRSPNTRSRVQSSATTRSTEQRSRSRSPLTRSTEQGSPNIRSTEQRASRTRSADQASQSVVTRSRSKLPSKKKD
cccHHHHccccccEEEEEEEccccccccccccccccccccccHHHHHHHccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHcccccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccEEEEEEEEEEEcccccccccccccccccccccccccccccccccccccEEccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccEEEEEEEccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccHHHHccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mrevqtlesqlfpvirlervtmerrpspeihiptvdstssvsseEIRRHESNLNLLRRKTQQRRTIqhtesstsssnseQNLRELTKATTYIQNIESLLSQASDLIERRQLEAHRILYVLLKFRTelegthqsydsgsdqagfispmetqdenppsehssefpgveRCLRRIESSLLNVRDLlenrpsdtlspaqSEVQAEflsgesreeltfanessetnsqgvprAERIMQRIESSLLQVRNLlelrpltpppqsdpesgtqgelspptpgpnpnsranpnpnpnsranpnlsrraqannsaqnplfskgehlcgtlnfqdctphpliIKIQQVFLYKkscisfsprresldsigsspskqhsvghttscniplrwqdrggvcrqhDVKMQLQLNKEQQRLAPLLDRLRRYEADLKALYKRRWILQKKFDKVKHTRRQKFENMYDFVNDNIDATYKVHLKSSACQVYLIVsgwpkkkeNLVIVVQSnlfspqaltQSFGHAflditgaeqepylagmnfsctpqgrsyvgiqhlsgGERTLAALAMIFTIWKLVVRVQqlrpltpppqsdpesgtqgelspptpgpnphsrvnpnpnsranpnpnpnsranpnlsrraqannsaqnplpevssspntrsrvqsspttrsrvQSSLTIQsaeqgspntrsrvqssanirsaeqgspisrtrftKYTLQSTKSNLSRRAQAnnsaqnplpevssspntrsrvqsspttrsrvqsspttrsrvqsspttrsrvQSSLTIQsaeqgspntrsrvqssanirsaeqgspsirsavqrspntrsrVQSSLtthsaeqgspttrstvqgaprihsreqsspnthsaeqrspntrsrvqssattrsteqrsrsrspltrsteqgspnirsteqrasrtrsadqasqsvvtrsrsklpskkkd
mrevqtlesqlfpvirlervtmerrpspeihiptvdstssvsseeirrhesnlnllrrktqqrrtiqhtesstsssnseqNLRELTKATTYIQNIESLLSQASDLIERRQLEAHRILYVLLKFRTELEGTHQSYDSGSDQAGFISPMETQDENPPSEHSSEFPGVERCLRRIESSLLNVRDLLenrpsdtlspaqSEVQAEFLSGESREELtfanessetnsqgvpraERIMQRIESSLLQVRNLLELRPLTPPPQSDPESGTQGELSPPTPGPNPNSRANPNPNPNSRANPNLSRRAQANNSAQNPLFSKGEHLCGTLNFQDCTPHPLIIKIQQVFLYKKSCISFSPRRESLDsigsspskqhsvgHTTSCNIPLRWQDRGGVCRQHDVKMQLQLNKEQQRLAPLLDRLRRYEADLKALYKrrwilqkkfdkvkhtrrqKFENMYDFVNDNIDATYKVHLKSSACQVYLIVSGWPKKKENLVIVVQSNLFSPQALTQSFGHAFLDITGAEQEPYLAGMNFSCTPQGRSYVGIQHLSGGERTLAALAMIFTIWKLVVRVQQLRPLTpppqsdpesgtQGELSPPTPGPNPHSRVNPNPNSRANPNPNPNSRANPNLSRRAQANNSaqnplpevssspntrsrvqsspttrsrvqssltiqsaeqgspntrsrvqssanirsaeqgspisrtrftKYTLQSTKSNLSRRAQannsaqnplpevssspntrsrvqsspttrsrvqsspttrsrvqsspttrsrvqssltiqsaeqgspntrsrvqssanirsaeqgspsirsavqrspntrSRVQSsltthsaeqgspttrstvqgaprihsreqsspnthsaeqrspntrsrvqssattrsteqrsrsrspltrsteqgspnirsteqrasrtrsadqasqsvvtrsrsklpskkkd
MREVQTLESQLFPVIRLERVTMERRPSPEIHIPtvdstssvsseeIRRHESNLNLLRRKTQQRRTIQHtesstsssnseQNLRELTKATTYIQNIESLLSQASDLIERRQLEAHRILYVLLKFRTELEGTHQSYDSGSDQAGFISPMETQDENPPSEHSSEFPGVERCLRRIESSLLNVRDLLENRPSDTLSPAQSEVQAEFLSGESREELTFANESSETNSQGVPRAERIMQRIESSLLQVRNLLELRPLTPPPQSDPESGTQGELSPPTPGpnpnsranpnpnpnsranpnlsrraQANNSAQNPLFSKGEHLCGTLNFQDCTPHPLIIKIQQVFLYKKSCISFSPRRESLDSIGSSPSKQHSVGHTTSCNIPLRWQDRGGVCRQHDVKMQLQLNKEQQRLAPLLDRLRRYEADLKALYKRRWILQKKFDKVKHTRRQKFENMYDFVNDNIDATYKVHLKSSACQVYLIVSGWPKKKENLVIVVQSNLFSPQALTQSFGHAFLDITGAEQEPYLAGMNFSCTPQGRSYVGIQHLSGGERTLAALAMIFTIWKLVVRVQQLRPLTPPPQSDPESGTQGELSPPTPGPNPHSRVnpnpnsranpnpnpnsranpnLSRRAQANNSAQNPLPEVSSSPNTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSPISRTRFTKYTLQSTKSNLSRRAQANNSAQNPLPEVSSSPNTRSRVQSSPTTRSRVQSSPTTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSPSIRSAVQRSPNTRSRVQSSLTTHSAEQGSPTTRSTVQGAPRIHSREQSSPNTHSAEQRSPNTRSRVQssattrsteqrsrsrspltrstEQGSPNIRSTEQRASRTRSADQASQSVVTRSRSKLPSKKKD
***********FPVIRL**********************************************************************ATTYIQNIESLLSQASDLIERRQLEAHRILYVLLKFRTEL****************************************************************************************************************************************************************************************GEHLCGTLNFQDCTPHPLIIKIQQVFLYKKSCISF***********************TSCNIPLRWQDRGGVCRQHDVKMQLQLNKEQQRLAPLLDRLRRYEADLKALYKRRWILQKKFDKVKHTRRQKFENMYDFVNDNIDATYKVHLKSSACQVYLIVSGWPKKKENLVIVVQSNLFSPQALTQSFGHAFLDITGAEQEPYLAGMNFSCTPQGRSYVGIQHLSGGERTLAALAMIFTIWKLVVRVQQL****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
*****T*ESQLFPVIRLERVTMERRPSPEIHIPTV***************************************************KATTYIQNIESLLSQASDLIERRQLEAHRILYVLLKFRTELE************************************VERCLRRIESSLLNVRDLLENR********************************************IMQRIESSLLQVRNLLELR************************************************************SKGEHLCGTLNFQDCTPHPLIIKIQQVFLYKKSCISFS**********************TSCNIPLRWQDRGGVCRQHDVKMQLQL*K**QRLAPLLDRLRRYEADLKALYKRRWILQKKFDKVKHTRRQKFENMYDFVNDNIDATYKVHLKSSACQVYLIVSGWPKKKENLVIVVQSNLFSPQALTQSFGH****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
MREVQTLESQLFPVIRLERVTMERRPSPEIHIPT**************HESNLNLLRRK**********************LRELTKATTYIQNIESLLSQASDLIERRQLEAHRILYVLLKFRTELEGTHQSYDSGSDQAGFISPM****************GVERCLRRIESSLLNVRDLLENR****************************************RAERIMQRIESSLLQVRNLLELRPLT**************************RANPNPNPNSRANPNLSRRAQANNSAQNPLFSKGEHLCGTLNFQDCTPHPLIIKIQQVFLYKKSCISFSP*********************TSCNIPLRWQDRGGVCRQHDVKMQLQLNKEQQRLAPLLDRLRRYEADLKALYKRRWILQKKFDKVKHTRRQKFENMYDFVNDNIDATYKVHLKSSACQVYLIVSGWPKKKENLVIVVQSNLFSPQALTQSFGHAFLDITGAEQEPYLAGMNFSCTPQGRSYVGIQHLSGGERTLAALAMIFTIWKLVVRVQQLRPLT***************************VNPNPNSRANPNPNPNSRANPNLSRR******************************************************************SPISRTRFTKYTLQS**********************************************************************************************************************************************************************************************************************************
**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MREVQTLESQLFPVIRLERVTMERRPSPEIHIPTVDSTSSVSSEEIRRHESNLNLLRRKTQQRRTIQHTESSTSSSNSEQNLRELTKATTYIQNIESLLSQASDLIERRQLEAHRILYVLLKFRTELEGTHQSYDSGSDQAGFISPMETQDENPPSEHSSEFPGVERCLRRIESSLLNVRDLLENRPSDTLSPAQSEVQAEFLSGESREELTFANESSETNSQGVPRAERIMQRIESSLLQVRNLLELRPLTPPPQSDPESGTQGELSPPTPGPNPNSRANPNPNPNSRANPNLSRRAQANNSAQNPLFSKGEHLCGTLNFQDCTPHPLIIKIQQVFLYKKSCISFSPRRESLDSIGSSPSKQHSVGHTTSCNIPLRWQDRGGVCRQHDVKMQLQxxxxxxxxxxxxxxxxxxxxxLKALYKRRWILQKKFDKVKHTRRQKFENMYDFVNDNIDATYKVHLKSSACQVYLIVSGWPKKKENLVIVVQSNLFSPQALTQSFGHAFLDITGAEQEPYLAGMNFSCTPQGRSYVGIQHLSGGERTLAALAMIFTIWKLVVRVQQLRPLTPPPQSDPESGTQGELSPPTPGPNPHSRVNPNPNSRANPNPNPNSRANPNLSRRAQANNSAQNPLPEVSSSPNTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSPISRTRFTKYTLQSTKSNLSRRAQANNSAQNPLPEVSSSPNTRSRVQSSPTTRSRVQSSPTTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSPSIRSAVQRSPNTRSRVQSSLTTHSAEQGSPTTRSTVQGAPRIHSREQSSPNTHSAEQRSPNTRSRVQSSATTRSTEQRSRSRSPLTRSTEQGSPNIRSTEQRASRTRSADQASQSVVTRSRSKLPSKKKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query926 2.2.26 [Sep-21-2011]
Q28298 1534 Ribosome-binding protein yes N/A 0.301 0.181 0.168 8e-08
>sp|Q28298|RRBP1_CANFA Ribosome-binding protein 1 OS=Canis familiaris GN=RRBP1 PE=2 SV=1 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 50/297 (16%), Positives = 118/297 (39%), Gaps = 18/297 (6%)

Query: 578 QGELSPPTPGPNPHSRVNPNPNSRAN--PNPNPNSRANPNLSRRAQANNSAQNPLPEVSS 635
           QG+ +  TP     +   PN   + +  PN    S   PN  ++ +    AQN   +V  
Sbjct: 348 QGKKAEGTPNQGKKAEGAPNQGKKTDGAPNQGKKSEGAPNQGKKVEG---AQNQGKKVEG 404

Query: 636 SPNTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSPISRTRFTK 695
             N   + + +     + + + +    E+G+PN   + + S N     QG  +   +   
Sbjct: 405 VQNQGKKAEGAQNQGKKAEGTSSQGRKEEGTPNLGKKAEGSPN-----QGKKVEVVQNQS 459

Query: 696 YTLQSTKSNLSRRAQAN-------NSAQNPLPEVSSSPNTRSRVQSSPTTRSRVQSSPTT 748
             ++    N  ++A+ +         A N   +V  + N   + + +P    +V+ +   
Sbjct: 460 KKVEGA-PNQGKKAEGSQNQGKKTEGASNQGKKVDGAQNQGKKAEGAPNQGKKVEGAQNQ 518

Query: 749 RSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSPSIRSAVQRSPNT 808
             + + +P    + + +       +G+PN   + + + N     +G+P+     + +PN 
Sbjct: 519 GKKAEGTPNQGKKAEGAQNQGKKAEGAPNQGKKAEGAPNQGKKAEGAPNQGKKAEGAPNQ 578

Query: 809 RSRVQSSLTTHSAEQGSPTTRSTVQGAPRIHSREQSSPNTHSAEQRSPNTRSRVQSS 865
             + +++       +G+P      +GAP    + +++PN     + +PN   + + +
Sbjct: 579 GKKAEAAPNQGKKAEGAPNQGKKAEGAPNQGKKAEAAPNQGKKAEGAPNQGKKAEGA 635




Acts as a ribosome receptor and mediates interaction between the ribosome and the endoplasmic reticulum membrane.
Canis familiaris (taxid: 9615)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query926
47125144 1196 LOC431817 protein, partial [Xenopus laev 0.281 0.218 0.302 6e-13
260783880131 hypothetical protein BRAFLDRAFT_161092 [ 0.141 1.0 0.396 7e-11
111307761 2080 Mki67 protein [Xenopus laevis] 0.264 0.117 0.307 2e-09
428164376 1241 sister chromatid cohesin complex subunit 0.103 0.077 0.314 4e-08
401886605 1202 cohesin complex subunit and chromosome s 0.052 0.040 0.54 4e-07
406698558 1162 hypothetical protein A1Q2_03856 [Trichos 0.052 0.042 0.54 4e-07
50978924 1534 ribosome-binding protein 1 [Canis lupus 0.301 0.181 0.168 5e-06
428214389346 hypothetical protein Oscil6304_4084 [Osc 0.232 0.621 0.259 1e-05
260782639115 hypothetical protein BRAFLDRAFT_252785 [ 0.120 0.973 0.359 3e-05
123437833642 hypothetical protein [Trichomonas vagina 0.117 0.169 0.229 4e-05
>gi|47125144|gb|AAH70605.1| LOC431817 protein, partial [Xenopus laevis] Back     alignment and taxonomy information
 Score = 83.2 bits (204), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 136/281 (48%), Gaps = 20/281 (7%)

Query: 635 SSPNTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSPISRTRFT 694
           +SP  RS V++SP  RS  ++S   +S  + SP  RS  ++S   RS  + SP  R+   
Sbjct: 479 ASPAKRSPVKASPAKRSPAKASPAKRSPAKVSPAKRSPAKASPAKRSPAKASPAKRS--- 535

Query: 695 KYTLQSTKSNLSRRAQANNSAQNPLPEVSSSPNTRSRVQSSPTTRSRVQSSPTTRSRVQS 754
                  K++ ++R+ A            +SP  RS  ++SP  RS  ++SP  RS  ++
Sbjct: 536 -----PAKASPAKRSPAK-----------ASPAKRSPAKASPAKRSPAKASPAKRSPAKA 579

Query: 755 SPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSPSIRSAVQRSPNTRSRVQS 814
           SP  RS  ++S   +S  + SP  RS  ++S   RS  + SP+ RS  + SP  RS  ++
Sbjct: 580 SPAKRSPAKASPAKRSPAKASPAKRSPAKASPAKRSPAKASPAKRSPAKASPAKRSPAKA 639

Query: 815 SLTTHSAEQGSPTTRSTVQGAPRIHSREQSSPNTHSAEQRSPNTRSRVQSSATTRSTEQR 874
           S    S  + SP  +S  +G+P   +  + SP   S  +RSP   S  + +   RS  + 
Sbjct: 640 SPAKRSPAKASPAKKSPAKGSPAKVTPSKRSPAKASPAKRSPAKVSPAKVTPAKRSPAKG 699

Query: 875 SRSR-SPLTRSTEQGSPNIRSTEQRASRTRSADQASQSVVT 914
             ++ +P  RS  + SP  RS  +     RS  + S + VT
Sbjct: 700 FSAKVTPAKRSPAKASPAKRSPAKVTPAKRSPAKGSPAKVT 740




Source: Xenopus laevis

Species: Xenopus laevis

Genus: Xenopus

Family: Pipidae

Order: Anura

Class: Amphibia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|260783880|ref|XP_002586999.1| hypothetical protein BRAFLDRAFT_161092 [Branchiostoma floridae] gi|229272132|gb|EEN43010.1| hypothetical protein BRAFLDRAFT_161092 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|111307761|gb|AAI21193.1| Mki67 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|428164376|gb|EKX33404.1| sister chromatid cohesin complex subunit, structural maintenance of chromosome 1, SMC1 [Guillardia theta CCMP2712] Back     alignment and taxonomy information
>gi|401886605|gb|EJT50632.1| cohesin complex subunit and chromosome segregation protein [Trichosporon asahii var. asahii CBS 2479] Back     alignment and taxonomy information
>gi|406698558|gb|EKD01793.1| hypothetical protein A1Q2_03856 [Trichosporon asahii var. asahii CBS 8904] Back     alignment and taxonomy information
>gi|50978924|ref|NP_001003179.1| ribosome-binding protein 1 [Canis lupus familiaris] gi|23822071|sp|Q28298.1|RRBP1_CANFA RecName: Full=Ribosome-binding protein 1; AltName: Full=180 kDa ribosome receptor; Short=RRp gi|984114|emb|CAA60676.1| ribosome receptor [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|428214389|ref|YP_007087533.1| hypothetical protein Oscil6304_4084 [Oscillatoria acuminata PCC 6304] gi|428002770|gb|AFY83613.1| hypothetical protein Oscil6304_4084 [Oscillatoria acuminata PCC 6304] Back     alignment and taxonomy information
>gi|260782639|ref|XP_002586392.1| hypothetical protein BRAFLDRAFT_252785 [Branchiostoma floridae] gi|229271498|gb|EEN42403.1| hypothetical protein BRAFLDRAFT_252785 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|123437833|ref|XP_001309708.1| hypothetical protein [Trichomonas vaginalis G3] gi|121891446|gb|EAX96778.1| conserved hypothetical protein [Trichomonas vaginalis G3] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query926
DICTYBASE|DDB_G0271670374 DDB_G0271670 [Dictyostelium di 0.330 0.818 0.225 7.8e-14
FB|FBgn0036203 1514 Muc68D "Mucin 68D" [Drosophila 0.314 0.192 0.241 1.9e-12
POMBASE|SPBC215.13534 SPBC215.13 "sequence orphan" [ 0.311 0.539 0.244 7.1e-11
CGD|CAL0006203 768 orf19.4906 [Candida albicans ( 0.314 0.378 0.241 7.9e-11
UNIPROTKB|Q5APQ2 768 CaO19.4906 "Putative uncharact 0.314 0.378 0.241 7.9e-11
UNIPROTKB|F1MI03 2724 SRRM2 "Uncharacterized protein 0.321 0.109 0.249 9.3e-11
ZFIN|ZDB-GENE-070112-902 669 zgc:158863 "zgc:158863" [Danio 0.226 0.313 0.263 3.6e-10
POMBASE|SPAPB15E9.01c 1036 SPAPB15E9.01c "sequence orphan 0.330 0.295 0.231 1.1e-09
MGI|MGI:1923206 2703 Srrm2 "serine/arginine repetit 0.388 0.133 0.236 6.3e-09
WB|WBGene00019435 2232 K06A9.1 [Caenorhabditis elegan 0.365 0.151 0.247 3.3e-09
DICTYBASE|DDB_G0271670 DDB_G0271670 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
 Score = 209 (78.6 bits), Expect = 7.8e-14, P = 7.8e-14
 Identities = 69/306 (22%), Positives = 134/306 (43%)

Query:   617 SRRAQANNSAQNPLPEVSSSPNTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSS 676
             S  + +++S+ +     SSS ++ S   SS ++ S   SS +  S+   S ++ S   SS
Sbjct:    66 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 125

Query:   677 ANIRSAEQGSPISRTRFTKYTLQSTKSNLSRRAQANNSAQNPLPEVSSSPNTRSRVQSSP 736
             ++  S+   S  S +  +  +  S+ S+ S  + +++S+ +     SSS ++ S   SS 
Sbjct:   126 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 185

Query:   737 TTRSRVQSSPTTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAEQGSP 796
             ++ S   SS ++ S   SS ++ S   SS +  S+   S ++ S   SS++  S+   S 
Sbjct:   186 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 245

Query:   797 SIRSAVQRSPNTRSRVQSSLTTHSAEQGSPTTRSTVQGAPRIHSREQSSPNTHSAEQRSP 856
             S  S+   S ++ S   SS ++ S+   S ++ S+   +    S   SS ++ S+   S 
Sbjct:   246 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 305

Query:   857 NTRSRVQXXXXXXXXXXXXXXXXXXXXXXEQGSPNIRSTEQRASRTRSADQASQSVVTRS 916
             ++ S                            S +  S+   +S + S+  +S S  + S
Sbjct:   306 SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 365

Query:   917 RSKLPS 922
              S   S
Sbjct:   366 SSSSSS 371


GO:0005576 "extracellular region" evidence=IEA
FB|FBgn0036203 Muc68D "Mucin 68D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPBC215.13 SPBC215.13 "sequence orphan" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0006203 orf19.4906 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5APQ2 CaO19.4906 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|F1MI03 SRRM2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-902 zgc:158863 "zgc:158863" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPAPB15E9.01c SPAPB15E9.01c "sequence orphan" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
MGI|MGI:1923206 Srrm2 "serine/arginine repetitive matrix 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00019435 K06A9.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query926
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-08
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 4e-08
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-08
COG5422 1175 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange 1e-06
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 8e-06
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 7e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 9e-05
COG5422 1175 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange 2e-04
pfam05616502 pfam05616, Neisseria_TspB, Neisseria meningitidis 2e-04
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
 Score = 58.6 bits (142), Expect = 1e-08
 Identities = 58/372 (15%), Positives = 101/372 (27%), Gaps = 41/372 (11%)

Query: 564 PLTPPPQSDPESGTQGELSPPTPGPNPHSRVN-----------PNPNSRANPNPNPNSRA 612
           P T  P ++  S     LS   P                    P     A+P P+P    
Sbjct: 75  PGTEAPANESRSTPTWSLSTLAPASPAREGSPTPPGPSSPDPPPPTPPPASPPPSPAPDL 134

Query: 613 NPNLSRRAQANNSAQNPLPEVSSSPNTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSR 672
           +  L            P     ++  + + V S   +    Q++L + S E+ +    S 
Sbjct: 135 SEMLRPVGS---PGPPPAASPPAAGASPAAVASDAASSR--QAALPLSSPEETARAPSSP 189

Query: 673 VQSSANIRSAEQGSPISRTRFTKYTLQSTKSNLSRRAQANNSAQNPLPEVSSSPNTRSRV 732
                        SP    R                   ++         + +P   +  
Sbjct: 190 PAEPPPSTPPAAASPRPPRR-------------------SSPISASASSPAPAPGRSAAD 230

Query: 733 QSSPTTRSRVQSSPTTRSRVQSSPTTRSRVQSSLTIQSAEQGSPNTRSRVQSSANIRSAE 792
            +  ++     S  +       +     R           + S       +      ++ 
Sbjct: 231 DAGASSSDSSSSESSGCGWGPENECPLPRPAPITLPTRIWEASGWNGPSSRPG---PASS 287

Query: 793 QGSPSIRSAVQRSPNTRSRVQSSLTTHSAEQGSPTTRSTVQGAPRIHSREQSSPNTHSAE 852
             SP  RS      +  S    S    S+   S    S+   +    S   ++ +   + 
Sbjct: 288 SSSPRERSPSPSPSSPGSGPAPSSPRASSSSSSSRESSSSSTSSSSESSRGAAVSPGPSP 347

Query: 853 QRSPNTRSRVQSSATTRSTEQRSRS-RSPLTRSTEQGSPNIRSTE-QRASRTRSADQASQ 910
            RSP + SR    A   S  +R R  R+P + +   G P  R      A R R  D   +
Sbjct: 348 SRSP-SPSRPPPPADPSSPRKRPRPSRAPSSPAASAGRPTRRRARAAVAGRARRRDATGR 406

Query: 911 SVVTRSRSKLPS 922
               R R     
Sbjct: 407 FPAGRPRPSPLD 418


Length = 1352

>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227709 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|227709 COG5422, ROM1, RhoGEF, Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|218658 pfam05616, Neisseria_TspB, Neisseria meningitidis TspB protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 926
COG11961163 Smc Chromosome segregation ATPases [Cell division 100.0
KOG0964|consensus1200 100.0
TIGR021691164 SMC_prok_A chromosome segregation protein SMC, pri 99.96
KOG0018|consensus1141 99.96
KOG0996|consensus1293 99.93
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 99.9
KOG0933|consensus1174 99.82
PF02463220 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: 99.41
PRK02224880 chromosome segregation protein; Provisional 99.11
PRK03918880 chromosome segregation protein; Provisional 98.89
KOG0979|consensus1072 98.74
PRK10869553 recombination and repair protein; Provisional 98.73
TIGR00634563 recN DNA repair protein RecN. All proteins in this 98.7
PHA02562562 46 endonuclease subunit; Provisional 98.52
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 98.28
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 98.05
PRK01156895 chromosome segregation protein; Provisional 97.93
TIGR021681179 SMC_prok_B chromosome segregation protein SMC, com 97.84
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 97.84
KOG0250|consensus1074 97.65
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 97.48
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 97.22
TIGR006181042 sbcc exonuclease SbcC. This family is based on the 97.21
PRK102461047 exonuclease subunit SbcC; Provisional 97.1
cd03239178 ABC_SMC_head The structural maintenance of chromos 96.99
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 96.86
cd03241276 ABC_RecN RecN ATPase involved in DNA repair; ABC ( 96.78
PF135141111 AAA_27: AAA domain 96.57
COG0497557 RecN ATPase involved in DNA repair [DNA replicatio 96.48
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 96.39
PF13166712 AAA_13: AAA domain 95.89
cd03227162 ABC_Class2 ABC-type Class 2 contains systems invol 95.73
COG1136226 SalX ABC-type antimicrobial peptide transport syst 95.61
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 95.48
TIGR006061311 rad50 rad50. This family is based on the phylogeno 95.46
PRK00064361 recF recombination protein F; Reviewed 95.39
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 95.21
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 95.16
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 95.13
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 94.89
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 94.76
PRK04778569 septation ring formation regulator EzrA; Provision 94.71
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 94.58
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 94.48
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 94.47
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 94.41
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 94.41
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 94.39
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 94.39
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 94.35
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 94.25
cd03269210 ABC_putative_ATPase This subfamily is involved in 94.24
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 94.22
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 94.19
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 94.18
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 94.16
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 94.14
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 94.11
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 94.11
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 94.1
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 94.05
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 94.01
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 94.01
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 93.93
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 93.92
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 93.9
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 93.86
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 93.8
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 93.76
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 93.74
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 93.73
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 93.72
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 93.72
PRK10619257 histidine/lysine/arginine/ornithine transporter su 93.72
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 93.72
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 93.68
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 93.67
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 93.66
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 93.65
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 93.63
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 93.63
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 93.59
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 93.58
PRK09580248 sufC cysteine desulfurase ATPase component; Review 93.57
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 93.57
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 93.56
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 93.55
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 93.54
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 93.51
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 93.49
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 93.46
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 93.43
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 93.41
PRK10908222 cell division protein FtsE; Provisional 93.38
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 93.37
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 93.36
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 93.36
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 93.36
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 93.35
PRK10790592 putative multidrug transporter membrane\ATP-bindin 93.31
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 93.3
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 93.29
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 93.25
cd03234226 ABCG_White The White subfamily represents ABC tran 93.24
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 93.23
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 93.18
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 93.18
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 93.18
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 93.15
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 93.14
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 93.11
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 93.11
PRK10789569 putative multidrug transporter membrane\ATP-bindin 93.09
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 93.07
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 93.06
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 93.05
PRK10938490 putative molybdenum transport ATP-binding protein 93.05
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 93.05
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 93.03
COG4181228 Predicted ABC-type transport system involved in ly 92.98
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 92.97
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 92.95
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 92.93
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 92.92
TIGR00611365 recf recF protein. All proteins in this family for 92.92
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 92.9
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 92.87
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 92.87
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 92.85
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 92.84
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 92.83
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 92.8
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 92.8
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 92.75
PRK14242253 phosphate transporter ATP-binding protein; Provisi 92.74
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 92.72
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 92.69
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 92.69
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 92.68
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 92.68
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 92.67
PRK14241258 phosphate transporter ATP-binding protein; Provisi 92.61
cd03215182 ABC_Carb_Monos_II This family represents domain II 92.6
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 92.58
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 92.57
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 92.55
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 92.48
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 92.47
PRK14079349 recF recombination protein F; Provisional 92.46
PF1355890 SbcCD_C: Putative exonuclease SbcCD, C subunit; PD 92.42
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 92.36
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 92.32
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 92.32
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 92.3
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 92.29
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 92.28
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 92.26
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 92.22
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 92.2
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 92.19
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 92.18
PRK14239252 phosphate transporter ATP-binding protein; Provisi 92.15
PRK14235267 phosphate transporter ATP-binding protein; Provisi 92.15
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 92.14
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 92.11
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 92.01
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 91.98
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 91.95
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 91.95
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 91.94
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 91.93
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 91.93
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 91.89
cd03277213 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein 91.89
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 91.89
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 91.88
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 91.86
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 91.84
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 91.77
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 91.75
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 91.75
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 91.73
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 91.72
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 91.68
PRK11153343 metN DL-methionine transporter ATP-binding subunit 91.67
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 91.66
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 91.62
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 91.6
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 91.59
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 91.56
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 91.56
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 91.54
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 91.51
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 91.5
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 91.5
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 91.49
PRK09700510 D-allose transporter ATP-binding protein; Provisio 91.48
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 91.48
PRK14240250 phosphate transporter ATP-binding protein; Provisi 91.45
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 91.42
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 91.42
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 91.41
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 91.4
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 91.39
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 91.38
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 91.36
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 91.33
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 91.28
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 91.27
PRK09700510 D-allose transporter ATP-binding protein; Provisio 91.24
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 91.22
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 91.22
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 91.17
cd03299235 ABC_ModC_like Archeal protein closely related to M 91.17
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 91.16
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 91.16
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 91.15
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 91.14
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 91.14
PRK10253265 iron-enterobactin transporter ATP-binding protein; 91.11
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 91.09
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 91.09
PRK11288501 araG L-arabinose transporter ATP-binding protein; 91.08
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 91.08
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 91.04
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 90.97
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 90.92
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 90.89
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 90.89
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 90.83
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 90.82
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 90.78
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 90.75
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 90.75
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 90.74
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 90.74
cd03246173 ABCC_Protease_Secretion This family represents the 90.65
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 90.64
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 90.59
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 90.56
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 90.55
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 90.54
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 90.53
PRK13409590 putative ATPase RIL; Provisional 90.46
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 90.46
PRK14243264 phosphate transporter ATP-binding protein; Provisi 90.44
PRK10762501 D-ribose transporter ATP binding protein; Provisio 90.41
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 90.37
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 90.36
PRK11288501 araG L-arabinose transporter ATP-binding protein; 90.32
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 90.29
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 90.24
PRK09984262 phosphonate/organophosphate ester transporter subu 90.2
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 90.15
PRK03695248 vitamin B12-transporter ATPase; Provisional 90.15
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 90.14
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 90.13
cd03216163 ABC_Carb_Monos_I This family represents the domain 90.03
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 89.95
PF13304303 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T 89.93
PRK10762501 D-ribose transporter ATP binding protein; Provisio 89.87
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 89.86
PRK10522547 multidrug transporter membrane component/ATP-bindi 89.81
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 89.81
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 89.81
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 89.76
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 89.72
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 89.65
COG1126240 GlnQ ABC-type polar amino acid transport system, A 89.55
PRK13545549 tagH teichoic acids export protein ATP-binding sub 89.51
PRK10938490 putative molybdenum transport ATP-binding protein 89.45
PRK13409590 putative ATPase RIL; Provisional 89.43
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 89.2
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 89.19
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 89.12
PRK13546264 teichoic acids export protein ATP-binding subunit; 89.12
PRK14238271 phosphate transporter ATP-binding protein; Provisi 89.08
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 89.01
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 88.95
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 88.88
COG4694758 Uncharacterized protein conserved in bacteria [Fun 88.79
COG4717984 Uncharacterized conserved protein [Function unknow 88.79
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 88.78
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 88.75
PRK14236272 phosphate transporter ATP-binding protein; Provisi 88.72
PRK10261 623 glutathione transporter ATP-binding protein; Provi 88.69
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 88.57
PTZ002651466 multidrug resistance protein (mdr1); Provisional 88.52
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 88.46
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 88.43
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 88.32
PRK10261623 glutathione transporter ATP-binding protein; Provi 88.29
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 88.27
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 88.25
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 88.24
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 88.17
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 87.98
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 87.98
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 87.83
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 87.67
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 87.6
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 87.6
PRK10636638 putative ABC transporter ATP-binding protein; Prov 87.45
PRK11147635 ABC transporter ATPase component; Reviewed 87.43
PRK10070400 glycine betaine transporter ATP-binding subunit; P 87.42
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 87.38
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 87.28
PRK09473330 oppD oligopeptide transporter ATP-binding componen 87.24
PRK15064530 ABC transporter ATP-binding protein; Provisional 87.17
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 87.03
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 86.95
PLN03130 1622 ABC transporter C family member; Provisional 86.87
PRK14237267 phosphate transporter ATP-binding protein; Provisi 86.35
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 86.23
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 85.77
PRK11819556 putative ABC transporter ATP-binding protein; Revi 85.48
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 85.3
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 85.3
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 85.24
PRK13536340 nodulation factor exporter subunit NodI; Provision 84.92
PF00005137 ABC_tran: ABC transporter This structure is on hol 84.89
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 84.72
PRK13537306 nodulation ABC transporter NodI; Provisional 84.65
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 84.65
PF13175415 AAA_15: AAA ATPase domain 84.52
PLN03211 659 ABC transporter G-25; Provisional 84.49
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 84.48
PLN03232 1495 ABC transporter C family member; Provisional 83.93
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 83.87
PRK11819556 putative ABC transporter ATP-binding protein; Revi 83.68
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 82.73
PTZ002431560 ABC transporter; Provisional 82.65
KOG2391|consensus365 82.07
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 82.04
PRK11607377 potG putrescine transporter ATP-binding subunit; P 81.9
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 81.34
PF1004699 BLOC1_2: Biogenesis of lysosome-related organelles 81.3
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 81.24
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 81.11
PRK15064530 ABC transporter ATP-binding protein; Provisional 80.98
PRK10535 648 macrolide transporter ATP-binding /permease protei 80.97
PLN03073718 ABC transporter F family; Provisional 80.74
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 80.65
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 80.53
PRK11147635 ABC transporter ATPase component; Reviewed 80.51
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 80.29
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
Probab=100.00  E-value=4.5e-42  Score=398.84  Aligned_cols=202  Identities=21%  Similarity=0.340  Sum_probs=190.6

Q ss_pred             cChhHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy834          379 QDRGGVCRQHDVKMQLQLNKEQQRLAPLLDRLRRYEADLKALYKRRWILQKKFDKVKHTRRQKFENMYDFVNDNIDATYK  458 (926)
Q Consensus       379 KdleeL~~eL~~KLk~vnkKAIEQYEEfeEQyEELeaRrEELdKekeSIrELIEeLDKEKrEAFmkTFKQVNenFsEIFK  458 (926)
                      ..++.+..++. .|..+|++|+++|+++.++|++|..+++++.++++.|.+.|+++|++++++|+.||+.||++|+.||+
T Consensus       949 ~~i~~le~~i~-~lg~VN~~Aiee~e~~~~r~~~l~~~~~dl~~a~~~l~~~i~~~d~~~~~~f~~~f~~In~~F~~if~ 1027 (1163)
T COG1196         949 REIERLEEEIE-ALGPVNLRAIEEYEEVEERYEELKSQREDLEEAKEKLLEVIEELDKEKRERFKETFDKINENFSEIFK 1027 (1163)
T ss_pred             HHHHHHHHHHH-hccCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35566666666 77777899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhcccccchhhhhcCCCCcccchhhhhhccccCcccccCCCceeeeeccCCCCCccccceEEEEeCCCCcccccccCch
Q psy834          459 VHLKSSACQVYLIVSGWPKKKENLVIVVQSNLFSPQALTQSFGHAFLDITGAEQEPYLAGMNFSCTPQGRSYVGIQHLSG  538 (926)
Q Consensus       459 eLV~NsssPi~L~lSgwP~GkGNLvIv~qSnLFspsal~qgGGsAeLdLtEDeEDPFeSGVeISVSPPGKr~QsIQQLSG  538 (926)
                      .|+                                     +||+|+|.+ .+++|||++||.|.|+||||+++.|++|||
T Consensus      1028 ~L~-------------------------------------~GG~a~L~l-~~~dd~l~~Giei~a~ppgK~~~~l~~LSG 1069 (1163)
T COG1196        1028 ELF-------------------------------------GGGTAELEL-TEPDDPLTAGIEISARPPGKKLQSLSLLSG 1069 (1163)
T ss_pred             HhC-------------------------------------CCCeeEEEe-CCCCchhhcCcEEEEECCCCCccchhhcCC
Confidence            974                                     699999999 677889999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHhccccCCCCCCceecCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCchhh
Q psy834          539 GERTLAALAMIFTIWKLVVRVQQLRPLTPPPQSDPESGTQGELSPPTPGPNPHSRVNPNPNSRANPNPNPNSRANPNLSR  618 (926)
Q Consensus       539 GEKSLVALALIFAIQKcDP~V~q~aPi~~~~~~~~~~~~~~Ev~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~N~~R  618 (926)
                      |||||+|||||||||+|+|     +|||++          |||||||                        |++  ||.|
T Consensus      1070 GEKsLtAlAllFAi~~~~P-----aPf~vL----------DEVDAaL------------------------D~~--Nv~r 1108 (1163)
T COG1196        1070 GEKSLTALALLFAIQKYRP-----APFYVL----------DEVDAAL------------------------DDA--NVER 1108 (1163)
T ss_pred             cHHHHHHHHHHHHHHhhCC-----CCeeee----------ccchhhc------------------------cHH--HHHH
Confidence            9999999999999999999     999999          9999999                        999  9999


Q ss_pred             hhhcccCCCCChhhhccCCCceeEe-ecChhhHHhhhhhcceeeecCCCCCc
Q psy834          619 RAQANNSAQNPLPEVSSSPNTRSRV-QSSPTTRSRVQSSLTIQSAEQGSPNT  669 (926)
Q Consensus       619 ~~~~~~~~~~~l~e~~~~~~tr~~v-~~~~~t~sr~~~~~~v~~aE~G~~~~  669 (926)
                      +       |++|.+|+  .+|.|+| ||.+.||..+|++|||||.+.||...
T Consensus      1109 ~-------~~~i~e~s--~~sQFIvIThr~~~m~~ad~l~GVtm~~~GvS~v 1151 (1163)
T COG1196        1109 V-------ARLIKEMS--KETQFIVITHRKGTMEAADRLVGVTMQEKGVSKV 1151 (1163)
T ss_pred             H-------HHHHHHhC--cCCeEEEEEcChHHHHHHHHHeeeEeecCCceEE
Confidence            9       99999999  5888999 99999999999999999999998643



>KOG0964|consensus Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG0018|consensus Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0979|consensus Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>TIGR00618 sbcc exonuclease SbcC Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK00064 recF recombination protein F; Reviewed Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00611 recf recF protein Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14079 recF recombination protein F; Provisional Back     alignment and domain information
>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4694 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4717 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PF13175 AAA_15: AAA ATPase domain Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG2391|consensus Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query926
1w1w_A430 Sc Smc1hd:scc1-c Complex, Atpgs Length = 430 2e-09
>pdb|1W1W|A Chain A, Sc Smc1hd:scc1-c Complex, Atpgs Length = 430 Back     alignment and structure

Iteration: 1

Score = 61.2 bits (147), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 38/123 (30%), Positives = 63/123 (51%), Gaps = 29/123 (23%) Query: 430 KFDKVKHTRRQKFENMYDFVNDNIDATYKVHLKSSACQVYLIVSGWPKKKENLVIVVQSN 489 +F K+K R++ FE +D+V+D++DA Y+ K+ V L Sbjct: 257 QFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVEL------------------- 297 Query: 490 LFSPQALTQSFGHAFLDITGAEQEPYLAGMNFSCTPQGRSYVGIQHLSGGERTLAALAMI 549 + G+A L I E EP+ AG+ + TP + + +++LSGGE+T+AALA++ Sbjct: 298 ---------AGGNASLTIED-EDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALL 347 Query: 550 FTI 552 F I Sbjct: 348 FAI 350

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query926
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3kta_B173 Chromosome segregation protein SMC; structural mai 3e-05
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 1e-04
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 3e-04
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure
 Score = 81.7 bits (202), Expect = 2e-16
 Identities = 38/154 (24%), Positives = 65/154 (42%), Gaps = 33/154 (21%)

Query: 401 QRLAPLLDRLRRYEADLKALYKRRWILQKKFDKVKHTRRQKFENMYDFVNDNIDATYKVH 460
            R      R      + + L      +  +F K+K  R++ FE  +D+V+D++DA Y+  
Sbjct: 228 SRYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYR-- 285

Query: 461 LKSSACQVYLIVSGWPKKKENLVIVVQSNLFSPQALTQSF--GHAFLDITGAEQEPYLAG 518
                                        L            G+A L I   + EP+ AG
Sbjct: 286 ----------------------------ELTKNPNSNVELAGGNASLTIEDED-EPFNAG 316

Query: 519 MNFSCTPQGRSYVGIQHLSGGERTLAALAMIFTI 552
           + +  TP  + +  +++LSGGE+T+AALA++F I
Sbjct: 317 IKYHATPPLKRFKDMEYLSGGEKTVAALALLFAI 350


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Length = 173 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query926
3kta_B173 Chromosome segregation protein SMC; structural mai 99.9
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.85
1e69_A322 Chromosome segregation SMC protein; structural mai 98.63
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 98.43
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 97.94
4aby_A415 DNA repair protein RECN; hydrolase, double strand 97.79
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 97.72
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 97.5
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 97.26
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 95.63
2ghi_A260 Transport protein; multidrug resistance protein, M 95.28
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 95.24
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 95.1
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 94.89
1ji0_A240 ABC transporter; ATP binding protein, structural g 94.8
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 94.75
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 94.7
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 94.63
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 94.5
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 94.42
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 94.31
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 94.29
1b0u_A262 Histidine permease; ABC transporter, transport pro 94.26
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 94.24
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 94.23
1sgw_A214 Putative ABC transporter; structural genomics, P p 94.22
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 94.17
1g6h_A257 High-affinity branched-chain amino acid transport 94.05
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 94.04
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 93.73
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 93.58
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 93.57
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 93.52
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 93.46
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 93.46
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 93.42
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 93.41
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 93.37
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 93.35
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 93.03
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 92.87
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 92.74
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 92.28
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 92.21
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 91.94
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 91.81
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 91.79
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 91.07
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 90.9
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 90.89
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 90.55
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 90.2
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 89.48
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 89.45
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 89.29
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 89.26
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 88.43
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 88.29
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 87.53
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 87.45
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 87.08
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 86.9
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 86.84
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 85.86
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 85.63
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 85.21
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 85.04
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 84.97
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 84.63
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 84.13
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 83.85
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 83.39
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 82.55
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
Probab=99.90  E-value=3.8e-24  Score=202.07  Aligned_cols=144  Identities=21%  Similarity=0.368  Sum_probs=130.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccchhhhhcCCCCcccchhhhhhccccCcccccCCCceeeeeccCCCCC
Q psy834          434 VKHTRRQKFENMYDFVNDNIDATYKVHLKSSACQVYLIVSGWPKKKENLVIVVQSNLFSPQALTQSFGHAFLDITGAEQE  513 (926)
Q Consensus       434 LDKEKrEAFmkTFKQVNenFsEIFKeLV~NsssPi~L~lSgwP~GkGNLvIv~qSnLFspsal~qgGGsAeLdLtEDeED  513 (926)
                      +|++|+++|++||++|+.+|.++|+.|+                                     .||++.|.+ ++++|
T Consensus         1 ~~~~~~~~f~~~f~~i~~~f~~~f~~L~-------------------------------------~~g~~~l~l-~~~~~   42 (173)
T 3kta_B            1 MEKEKKNVFMRTFEAISRNFSEIFAKLS-------------------------------------PGGSARLIL-ENPED   42 (173)
T ss_dssp             --CHHHHHHHHHHHHHHHHHHHHHHHHS-------------------------------------TTCEEEEEE-SCSSS
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHhC-------------------------------------CCCEEEEEe-eCCCC
Confidence            5789999999999999999999999985                                     488999999 77899


Q ss_pred             ccccceEEEEeCCCCcccccccCchhHHHHHHHHHHHHHhccccCCCCCCceecCCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy834          514 PYLAGMNFSCTPQGRSYVGIQHLSGGERTLAALAMIFTIWKLVVRVQQLRPLTPPPQSDPESGTQGELSPPTPGPNPHSR  593 (926)
Q Consensus       514 PFeSGVeISVSPPGKr~QsIQQLSGGEKSLVALALIFAIQKcDP~V~q~aPi~~~~~~~~~~~~~~Ev~~p~~~~~~~~~  593 (926)
                      ||..||.|.|.|+|+..+.+..||||||+++|||++||++.++|     +||+.+          ||.++.|        
T Consensus        43 ~~~~gl~i~~~~~~~~~~~~~~LSgGekqr~ala~~la~~~~~~-----~~~llL----------DEp~a~L--------   99 (173)
T 3kta_B           43 PFSGGLEIEAKPAGKDVKRIEAMSGGEKALTALAFVFAIQKFKP-----APFYLF----------DEIDAHL--------   99 (173)
T ss_dssp             GGGSCEEEEEETTSSSCCCGGGCCHHHHHHHHHHHHHHHHHHSC-----CSEEEE----------ESTTTTC--------
T ss_pred             ccccCceEEecCCCccccccccCCHHHHHHHHHHHHHHhcccCC-----CCEEEE----------CCCccCC--------
Confidence            99999999999999999999999999999999999999999999     999999          9999999        


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCchhhhhhcccCCCCChhhhccCCCceeEe-ecChhhHHhhhhhcceeeecCCC
Q psy834          594 VNPNPNSRANPNPNPNSRANPNLSRRAQANNSAQNPLPEVSSSPNTRSRV-QSSPTTRSRVQSSLTIQSAEQGS  666 (926)
Q Consensus       594 ~~~~~~~~~~~~~~~~~~a~~N~~R~~~~~~~~~~~l~e~~~~~~tr~~v-~~~~~t~sr~~~~~~v~~aE~G~  666 (926)
                                      |..  |..++       +++|.+++..  +-++| +|+..++..+|+++||+| +.|+
T Consensus       100 ----------------D~~--~~~~~-------~~~l~~~~~~--~~~ivith~~~~~~~ad~i~~v~~-~~g~  145 (173)
T 3kta_B          100 ----------------DDA--NVKRV-------ADLIKESSKE--SQFIVITLRDVMMANADKIIGVSM-RDGV  145 (173)
T ss_dssp             ----------------CHH--HHHHH-------HHHHHHHTTT--SEEEEECSCHHHHTTCSEEEEEEE-ETTE
T ss_pred             ----------------CHH--HHHHH-------HHHHHHhccC--CEEEEEEecHHHHHhCCEEEEEEe-cCCE
Confidence                            887  88898       6788888754  34555 999999999999999999 6675



>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query926
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.86
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 99.31
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 99.11
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.07
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.64
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.27
d2hyda1255 Putative multidrug export ATP-binding/permease pro 95.4
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 95.28
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 95.24
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 94.89
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 94.61
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 92.85
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 92.49
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.6
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 89.93
d1g2912240 Maltose transport protein MalK, N-terminal domain 89.86
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 89.59
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 89.3
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 89.01
d2awna2232 Maltose transport protein MalK, N-terminal domain 88.73
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 87.6
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 86.54
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 86.1
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 86.01
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 81.97
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Smc head domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.86  E-value=1.2e-22  Score=195.98  Aligned_cols=192  Identities=25%  Similarity=0.389  Sum_probs=110.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccchhhhhcCCCC
Q psy834          398 KEQQRLAPLLDRLRRYEADLKALYKRRWILQKKFDKVKHTRRQKFENMYDFVNDNIDATYKVHLKSSACQVYLIVSGWPK  477 (926)
Q Consensus       398 KAIEQYEEfeEQyEELeaRrEELdKekeSIrELIEeLDKEKrEAFmkTFKQVNenFsEIFKeLV~NsssPi~L~lSgwP~  477 (926)
                      +..+++......+..+..+++++......+.+.+.+++......|...|+.++..|.++|++|......           
T Consensus       224 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~l~~i~~~l~~~~~~-----------  292 (427)
T d1w1wa_         224 PRGSRYDEAEGRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNS-----------  292 (427)
T ss_dssp             -----------------------------------------------CHHHHHHHHHHHHHHTC----------------
T ss_pred             ccccchhhhccccccccccchhhhhhhhhhhhcchhhhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhhh-----------
Confidence            344566667777888888899999999999999999999999999999999999999999998621100           


Q ss_pred             cccchhhhhhccccCcccccCCCceeeeeccCCCCCccccceEEEEeCCCCcccccccCchhHHHHHHHHHHHHHhcccc
Q psy834          478 KKENLVIVVQSNLFSPQALTQSFGHAFLDITGAEQEPYLAGMNFSCTPQGRSYVGIQHLSGGERTLAALAMIFTIWKLVV  557 (926)
Q Consensus       478 GkGNLvIv~qSnLFspsal~qgGGsAeLdLtEDeEDPFeSGVeISVSPPGKr~QsIQQLSGGEKSLVALALIFAIQKcDP  557 (926)
                         .              ....+|.+.|.+ .+.++++..||.|.|.++||....+..||||||++++|||+||++.+.|
T Consensus       293 ---~--------------~~~~~~~~~l~~-~~~~~~~~~~i~i~~~~~~~~~~~~~~lSgGEk~~~~lal~lal~~~~~  354 (427)
T d1w1wa_         293 ---N--------------VELAGGNASLTI-EDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQP  354 (427)
T ss_dssp             -----------------------CEEEEC-------------CEEEECTTCCCCCGGGSCHHHHHHHHHHHHHHHHTSSC
T ss_pred             ---h--------------ccccCceeEEee-eccCcccccCceEEEEeccchhhhhhhhccchHHHHHHHHHHHHhcCCC
Confidence               0              111478999998 6678899999999999999999999999999999999999999999999


Q ss_pred             CCCCCCceecCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCchhhhhhcccCCCCChhhhccCC
Q psy834          558 RVQQLRPLTPPPQSDPESGTQGELSPPTPGPNPHSRVNPNPNSRANPNPNPNSRANPNLSRRAQANNSAQNPLPEVSSSP  637 (926)
Q Consensus       558 ~V~q~aPi~~~~~~~~~~~~~~Ev~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~N~~R~~~~~~~~~~~l~e~~~~~  637 (926)
                           .||+.+          ||+|+-|                        |..  |..++       .++|.++++ .
T Consensus       355 -----~pilil----------DE~d~~L------------------------d~~--~~~~~-------~~~l~~~~~-~  385 (427)
T d1w1wa_         355 -----SPFFVL----------DEVDAAL------------------------DIT--NVQRI-------AAYIRRHRN-P  385 (427)
T ss_dssp             -----CSEEEE----------SSTTTTC------------------------CHH--HHHHH-------HHHHHHHCB-T
T ss_pred             -----CCEEEE----------eCCCCCC------------------------CHH--HHHHH-------HHHHHHHhC-C
Confidence                 999999          9999999                        777  88898       778888754 5


Q ss_pred             CceeEe-ecChhhHHhhhhhccee-eecCCCC
Q psy834          638 NTRSRV-QSSPTTRSRVQSSLTIQ-SAEQGSP  667 (926)
Q Consensus       638 ~tr~~v-~~~~~t~sr~~~~~~v~-~aE~G~~  667 (926)
                      ++-|+| ||+|-+|..+|..++|+ +-+.|+-
T Consensus       386 ~~Q~I~iTH~~~~~~~ad~~~~V~~~~~~g~s  417 (427)
T d1w1wa_         386 DLQFIVISLKNTMFEKSDALVGVYRQQQENSS  417 (427)
T ss_dssp             TBEEEEECSCHHHHTTCSEEEEEEEETTTTEE
T ss_pred             CCEEEEEeCCHHHHHhcccEEEEEEeCCCCeE
Confidence            677888 99999999999999998 4555543



>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure