Psyllid ID: psy8390

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420--
MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAASMTPEQRQREYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGITEILEKRVTDSQQKENQRSNLVAARSKMNTLRNLRSELPNATDKRSVASSALTQEYKYSNFNSGVASSAGNNAINYSLSNIGAGGMAITAAASQAIAATQQMKQGRRTASLKASYEAIHGGAGSSADIISKELAGAAQTAIAAIQDTHKKNKKKSVGGSSNLSMGTINMNTTSSALHSLMMETSSSNSKLHGSTSAAAPMEDLAAGSALGAGEEEMDTGYGPDEPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKWYCPLCLEKMAASKANHYGGSSRKHRK
ccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccc
cccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccHcccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccEEEEEEEcccccEEEcccccccEEEEEcccccccccccccccEcccccHHHHHHcccccccccHHHHcc
MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAASMTPEQRQREYENLLQEYnkpmidseeKINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGITEILEKRVTDSQQKENQRSNLVAARSKMNTLRNLrselpnatdkrsvassaltqeykysnfnsgvassagnnainyslsnigagGMAITAAASQAIAATQQMKQGRRTASLKASYEAihggagssaDIISKELAGAAQTAIAAIQDTHkknkkksvggssnlsmgtinmNTTSSALHSLMMEtsssnsklhgstsaaapmedlaagsalgageeemdtgygpdeprycrcneqahyNFYTIFCSQVAFGVMVacdskncpyewyhcecvgiapdnppkgkwycplcLEKMAASKanhyggssrkhrk
MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAASMTPEQRQREYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDIQKFKLeleadnsgiteilekrvtdsqqkenqrsnlvaarskmntlrnlrselpnatdkrsvASSALTQEYKYSNFNSGVASSAGNNAINYSLSNIGAGGMAITAAASQAIAATQQMKQGRRTASLKASYEAIHGGAGSSADIISKELAGAAQTAIAAIqdthkknkkksvggssnlsmgtINMNTTSSALHSLMMETSSSNSKLHGSTSAAAPMEDLAAGSALGAGEEEMDTGYGPDEPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKWYCPLCLEKMAASkanhyggssrkhrk
MLYLEDYIELVEILPQELRDRFTEMRlldlqsqnsldqlqnKVNQFYQMAASMTPEQRQREYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGITEILEKRVTDSQQKENQRSNLVAARSKMNTLRNLRSELPNATDKRSVASSALTQEYKYSNFNSGVASSAGNNAINYSLSNigaggmaitaaasqaiaatqqmKQGRRTASLKASYEAIHGGAGSSADIISKELagaaqtaiaaiqDTHkknkkksvggssnlsMGTINMNTTSSALHSLMMETSSSNSKLHGSTSAAAPMedlaagsalgageeeMDTGYGPDEPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKWYCPLCLEKMAASKANHYGGSSRKHRK
**YLEDYIELVEILPQELRDRFTEMRLLDL************************************************KINLATQIQEFFNKYTRKLEQDIQKFKLELE*****************************************************************************NAINYSLSNIGAGGMAITAAA*************************************************************************************************************************************RYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKWYCPLCLEKM*****************
MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKV*******************************DSEEKINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGITEILEKRVTD**************RSKMNTLRNLRSELPNATDKR********************************************AA**********************************************************************************************************************************************AHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKWYCP***********************
MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAASMTPEQRQREYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGITEILEKRV************LVAARSKMNTLRNLRSELPNATDKRSVASSALTQEYKYSNFNSGVASSAGNNAINYSLSNIGAGGMAITAAASQ******************ASYEAIHGGAGSSADIISKELAGAAQTAIAAIQD************SSNLSMGTINMNTTSSALHSLMM**************AAAPMEDLAAGSALGAGEEEMDTGYGPDEPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKWYCPLCLEKMAASK*************
MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAASMTPEQRQREYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGIT*************************************************************************************AITAAASQAIAATQQ******************************************************************************************************************MDTGYGPDEPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKWYCPLCLEKM*****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAASMTPEQRQREYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGITEILEKRVTDSQQxxxxxxxxxxxxxxxxxxxxxRSELPNATDKRSVASSALTQEYKYSNFNSGVASSAGNNAINYSLSNIGAGGMAITAAASQAIAATQQMKQGRRTASLKASYEAIHGGAGSSADIISKELAGAAQTAIAAIQDTHKKNKKKSVGGSSNLSMGTINMNTTSSALHSLMMETSSSNSKLHGSTSAAAPMEDLAAGSALGAGEEEMDTGYGPDEPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKWYCPLCLEKMAASKANHYGGSSRKHRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query422 2.2.26 [Sep-21-2011]
Q66KD5417 Inhibitor of growth prote yes N/A 0.914 0.925 0.371 9e-61
Q8VEK6421 Inhibitor of growth prote yes N/A 0.895 0.897 0.354 6e-60
Q498T3421 Inhibitor of growth prote yes N/A 0.933 0.935 0.363 2e-58
Q9NXR8418 Inhibitor of growth prote yes N/A 0.888 0.897 0.361 3e-58
Q7ZX31416 Inhibitor of growth prote N/A N/A 0.890 0.903 0.368 5e-58
Q5ZK36417 Inhibitor of growth prote yes N/A 0.921 0.932 0.359 1e-54
Q5RBA1403 Inhibitor of growth prote yes N/A 0.850 0.890 0.342 2e-49
Q6FSB1274 Chromatin modification-re yes N/A 0.137 0.211 0.540 6e-15
Q757W2285 Chromatin modification-re yes N/A 0.113 0.168 0.58 7e-14
P38806282 Chromatin modification-re yes N/A 0.144 0.216 0.5 2e-13
>sp|Q66KD5|ING3_XENTR Inhibitor of growth protein 3 OS=Xenopus tropicalis GN=ing3 PE=2 SV=1 Back     alignment and function desciption
 Score =  234 bits (597), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 164/442 (37%), Positives = 240/442 (54%), Gaps = 56/442 (12%)

Query: 1   MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAASMTPEQRQR 60
           MLYLEDY+E++E LP +LRDRFTEMR +DLQ QN++DQL+ +V +F+  A    PE R+ 
Sbjct: 1   MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVGEFFMNAKKNKPEWREE 60

Query: 61  EYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGITEILE 120
           +  ++ ++Y K + D++EK+ LA QI +  +++ RKL+Q++ KFK+ELEADN+GITEILE
Sbjct: 61  QMASIKKDYFKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILE 120

Query: 121 KRV----TDSQQKENQ--RSNLVAARSKMN-----------TLRNLRSE-----LPNATD 158
           +R     T SQ   N    S+ +  + K N           + +  +SE     L +   
Sbjct: 121 RRSLELDTPSQPVNNHHVHSHSLGEKRKHNPSSHHSTTDHVSEKKFKSEALLSTLTSDAS 180

Query: 159 KRSVASSALTQEYKYSNFNSGVASSAGNNAINYSLSNIGAGGMAITAAASQAIAATQQMK 218
           K + A          +N    V +S    + N S  + GAG  AIT AA+QA+ AT QMK
Sbjct: 181 KENTAGCRNNLSSSSTNNVYNVNASQPLTSYNISSLSTGAGAGAITMAAAQAVQATAQMK 240

Query: 219 QGRRTASLKASYEAIHGG--------AGSSADIISKELAGAAQTAIAAIQDTHKKNKKKS 270
           +GRRT+SLKASYEA            +  SA   S  LA      + +   T  ++ +KS
Sbjct: 241 EGRRTSSLKASYEAFKNNDFQLGISLSRDSATYSSSALASTLTQTLTSSATTDSRSGRKS 300

Query: 271 VGGSSNLSMGTINMNTTSSALHSLMMETSSSNSKLHGSTSAAAPMEDLAAGSALGAGEEE 330
              S+N S    + +++SS+  S    +S+   +L    +AA P  D  +         +
Sbjct: 301 --KSNNKSASQQSSSSSSSSSLSSCSSSSALAHELSHQQTAAIPESDTNS---------Q 349

Query: 331 MDTGYGPDEPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDN 390
           +D  Y P+EPRYC CN             QV++G MV CD+++CP EW+H  CVG++   
Sbjct: 350 VDWTYDPNEPRYCICN-------------QVSYGEMVGCDNQDCPIEWFHYGCVGLS--E 394

Query: 391 PPKGKWYCPLCLEKMAASKANH 412
            PKGKWYCP C   M    + H
Sbjct: 395 APKGKWYCPQCTAAMKRRGSRH 416
Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histone H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription (By similarity). NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage.
Xenopus tropicalis (taxid: 8364)
>sp|Q8VEK6|ING3_MOUSE Inhibitor of growth protein 3 OS=Mus musculus GN=Ing3 PE=2 SV=2 Back     alignment and function description
>sp|Q498T3|ING3_RAT Inhibitor of growth protein 3 OS=Rattus norvegicus GN=Ing3 PE=2 SV=1 Back     alignment and function description
>sp|Q9NXR8|ING3_HUMAN Inhibitor of growth protein 3 OS=Homo sapiens GN=ING3 PE=1 SV=2 Back     alignment and function description
>sp|Q7ZX31|ING3_XENLA Inhibitor of growth protein 3 OS=Xenopus laevis GN=ing3 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZK36|ING3_CHICK Inhibitor of growth protein 3 OS=Gallus gallus GN=ING3 PE=2 SV=1 Back     alignment and function description
>sp|Q5RBA1|ING3_PONAB Inhibitor of growth protein 3 OS=Pongo abelii GN=ING3 PE=2 SV=1 Back     alignment and function description
>sp|Q6FSB1|YNG2_CANGA Chromatin modification-related protein YNG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YNG2 PE=3 SV=1 Back     alignment and function description
>sp|Q757W2|YNG2_ASHGO Chromatin modification-related protein YNG2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YNG2 PE=3 SV=1 Back     alignment and function description
>sp|P38806|YNG2_YEAST Chromatin modification-related protein YNG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNG2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query422
335892832395 inhibitor of growth protein 3 [Apis mell 0.841 0.898 0.423 1e-72
380024495395 PREDICTED: LOW QUALITY PROTEIN: inhibito 0.841 0.898 0.421 5e-72
270001416404 hypothetical protein TcasGA2_TC000235 [T 0.881 0.920 0.414 1e-68
91078014360 PREDICTED: similar to inhibitor of growt 0.822 0.963 0.419 6e-68
332373684418 unknown [Dendroctonus ponderosae] 0.883 0.892 0.404 4e-65
383860907398 PREDICTED: inhibitor of growth protein 3 0.848 0.899 0.430 5e-64
193664662371 PREDICTED: inhibitor of growth protein 3 0.800 0.911 0.373 6e-64
350405263398 PREDICTED: inhibitor of growth protein 3 0.848 0.899 0.400 3e-63
340726100398 PREDICTED: LOW QUALITY PROTEIN: inhibito 0.848 0.899 0.398 6e-63
427788009442 Putative inhibitor of growth protein 3 [ 0.902 0.861 0.391 9e-63
>gi|335892832|ref|NP_001229446.1| inhibitor of growth protein 3 [Apis mellifera] Back     alignment and taxonomy information
 Score =  280 bits (715), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 185/437 (42%), Positives = 251/437 (57%), Gaps = 82/437 (18%)

Query: 1   MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAASMTPEQRQR 60
           MLYLEDY+E++E LPQELRDRFTEMR +DL  QNS+D L+ KV  F+  A  M P +++ 
Sbjct: 1   MLYLEDYVEMIEHLPQELRDRFTEMREMDLGVQNSMDSLEKKVKIFFANAKKMKPSEKEA 60

Query: 61  EYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGITEILE 120
           EYE + +EY K + D++EK++LA Q+ +  ++Y R+L+Q++ KFK+ELEADN GITEILE
Sbjct: 61  EYEAIRREYYKTLEDADEKVHLANQMYDLVDRYLRRLDQELHKFKMELEADNKGITEILE 120

Query: 121 KR-------VTDSQQKENQRSNLVAARSKMN-----------------------TLRNLR 150
           KR        T+S QKEN+ S   ++RS+ N                        +  + 
Sbjct: 121 KRSLELDQPPTNSSQKENRYSFTTSSRSRDNHSHSRAEKRRDSNASSTSIEKRLAIEKIS 180

Query: 151 SELPNATDKRSVASSALTQEYKYSNFNSGVASSAGNNAINYSLSNIGAGGMAITAAASQA 210
             LP +    SV S  +       +  + +A+S G  +++Y+L +IGAGG AI AAASQA
Sbjct: 181 PSLPESRPA-SVNSGPIIAATSVPSTPTAIANSVG--SVSYNLGHIGAGGNAIAAAASQA 237

Query: 211 IAATQQMKQGRRTASLKASYEAIHGGAGSSADIISKELAGAAQTAIAAIQDTHKKNKKKS 270
           IAATQQM+ GRRTASLKASYEAI+ G   +A+  S+ELAGAA   IAAIQ+T+KK+KKK 
Sbjct: 238 IAATQQMQHGRRTASLKASYEAINTGGIHAAEF-SRELAGAA---IAAIQETNKKHKKKV 293

Query: 271 VGG--SSNLSMGTINMNTTSSALHSLMMETSSSNSKLHGSTSAAAPMEDLAAGSALGAGE 328
                SS++   ++    +   + +      S N                          
Sbjct: 294 TTAVPSSSVVAASVQQPVSPPVITTNTQVVDSDNP------------------------- 328

Query: 329 EEMDTGYGPDEPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAP 388
              D  Y P+EPRYC CN             QV++G MVACD+ +CP+EW+H  CVGI  
Sbjct: 329 ---DWTYDPNEPRYCICN-------------QVSYGDMVACDNSDCPFEWFHYPCVGIT- 371

Query: 389 DNPPKGKWYCPLCLEKM 405
             PPKGKWYCP C   M
Sbjct: 372 -APPKGKWYCPQCTSSM 387

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380024495|ref|XP_003696031.1| PREDICTED: LOW QUALITY PROTEIN: inhibitor of growth protein 3-like [Apis florea] Back     alignment and taxonomy information
>gi|270001416|gb|EEZ97863.1| hypothetical protein TcasGA2_TC000235 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91078014|ref|XP_969965.1| PREDICTED: similar to inhibitor of growth family, member 3 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332373684|gb|AEE61983.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|383860907|ref|XP_003705929.1| PREDICTED: inhibitor of growth protein 3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|193664662|ref|XP_001949763.1| PREDICTED: inhibitor of growth protein 3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|350405263|ref|XP_003487378.1| PREDICTED: inhibitor of growth protein 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340726100|ref|XP_003401400.1| PREDICTED: LOW QUALITY PROTEIN: inhibitor of growth protein 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|427788009|gb|JAA59456.1| Putative inhibitor of growth protein 3 [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query422
FB|FBgn0030945 686 Ing3 "Ing3" [Drosophila melano 0.447 0.275 0.355 1.4e-52
UNIPROTKB|Q5ZK36417 ING3 "Inhibitor of growth prot 0.931 0.942 0.319 1.5e-51
UNIPROTKB|E1BQ25418 ING3 "Uncharacterized protein" 0.936 0.944 0.317 1.7e-50
UNIPROTKB|F1SJF6418 ING3 "Uncharacterized protein" 0.933 0.942 0.319 3.6e-50
UNIPROTKB|Q9NXR8418 ING3 "Inhibitor of growth prot 0.931 0.940 0.321 4.6e-50
UNIPROTKB|E2R0U9418 ING3 "Uncharacterized protein" 0.936 0.944 0.313 5.8e-50
UNIPROTKB|Q66KD5417 ing3 "Inhibitor of growth prot 0.928 0.940 0.311 1.5e-49
MGI|MGI:1919027421 Ing3 "inhibitor of growth fami 0.928 0.931 0.311 5.2e-49
RGD|1310556421 Ing3 "inhibitor of growth fami 0.936 0.938 0.311 5.2e-49
ZFIN|ZDB-GENE-040109-3416 ing3 "inhibitor of growth fami 0.462 0.468 0.366 6.8e-49
FB|FBgn0030945 Ing3 "Ing3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 295 (108.9 bits), Expect = 1.4e-52, Sum P(3) = 1.4e-52
 Identities = 70/197 (35%), Positives = 107/197 (54%)

Query:     1 MLYLEDYIELVEILPQELRDRFTEMRXXXXXXXXXXXXXXXKVNQFYQMAA--SMTPEQR 58
             MLYLEDY+E++E LPQELRDRFTEMR               K + F++      +  E  
Sbjct:     1 MLYLEDYLEMIEHLPQELRDRFTEMRELDLAVQNNMDSLDKKAHMFFKQCKRDELQHESM 60

Query:    59 QREYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGITEI 118
               E+ +L  EY K M D++EK+ +ATQI E   +Y R+L+ ++ KFK ELEADN+GITEI
Sbjct:    61 DTEFHSLRGEYFKVMEDADEKVAIATQIHELVERYLRRLDSELFKFKCELEADNNGITEI 120

Query:   119 LEKRVTDSQQKENQRSNLVAARSKMNTLRNLRSELPNATDKRSVASSALTQEYKYSNFNS 178
             LE+R  +         N  AA + + ++    +    A+   ++ +S+       +  +S
Sbjct:   121 LERRSLELD------GNSTAATALLLSMNQKENRYYGASSANTMVNSSTGHATGAATGSS 174

Query:   179 GVASSAGNNAINYSLSN 195
             G+A  +G      +LS+
Sbjct:   175 GIALVSGAAGTGGALSS 191
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0000123 "histone acetyltransferase complex" evidence=IPI
UNIPROTKB|Q5ZK36 ING3 "Inhibitor of growth protein 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQ25 ING3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SJF6 ING3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NXR8 ING3 "Inhibitor of growth protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0U9 ING3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q66KD5 ing3 "Inhibitor of growth protein 3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
MGI|MGI:1919027 Ing3 "inhibitor of growth family, member 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310556 Ing3 "inhibitor of growth family, member 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040109-3 ing3 "inhibitor of growth family, member 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q66KD5ING3_XENTRNo assigned EC number0.37100.91460.9256yesN/A
Q5RBA1ING3_PONABNo assigned EC number0.34240.85070.8908yesN/A
Q9NXR8ING3_HUMANNo assigned EC number0.36120.88860.8971yesN/A
Q498T3ING3_RATNo assigned EC number0.36300.93360.9358yesN/A
Q5ZK36ING3_CHICKNo assigned EC number0.35990.92180.9328yesN/A
Q8VEK6ING3_MOUSENo assigned EC number0.35460.89570.8978yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
pfam12998104 pfam12998, ING, Inhibitor of growth proteins N-ter 2e-28
COG5034271 COG5034, TNG2, Chromatin remodeling protein, conta 7e-19
pfam0062851 pfam00628, PHD, PHD-finger 2e-09
smart0024947 smart00249, PHD, PHD zinc finger 7e-08
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
>gnl|CDD|221887 pfam12998, ING, Inhibitor of growth proteins N-terminal histone-binding Back     alignment and domain information 
 Score =  107 bits (270), Expect = 2e-28
 Identities = 34/104 (32%), Positives = 62/104 (59%), Gaps = 1/104 (0%)

Query: 2   LYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAAS-MTPEQRQR 60
           LYLEDY++ +E LP EL+  FTE+R +D Q Q  + +L  ++ +F +   S ++  + + 
Sbjct: 1   LYLEDYLDDLENLPLELQRNFTEIREIDAQVQKIIKELDEQIQKFIKENGSNLSNPKEEE 60

Query: 61  EYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDIQKF 104
             + + +E  K     +EK+ LA Q  E  +K+ R+L++D++K 
Sbjct: 61  LLKRIQEELIKAQELQDEKVQLANQAYELVDKHIRRLDKDLEKL 104

Histones undergo numerous post-translational modifications, including acetylation and methylation, at residues which are then probable docking sites for various chromatin remodelling complexes. Inhibitor of growth proteins (INGs) specifically bind to residues that have been thus modified. INGs carry a well-characterized C-terminal PHD-type zinc-finger domain, binding with lysine 4-tri-methylated histone H3 (H3K4me3), as well as this N-terminal domain that binds unmodified H3 tails. Although these two regions can bind histones independently, together they increase the apparent association of the ING for the H3 tail. Length = 104
>gnl|CDD|227367 COG5034, TNG2, Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 422
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 99.97
KOG1973|consensus274 99.94
PF12998105 ING: Inhibitor of growth proteins N-terminal histo 99.94
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.81
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.62
KOG1512|consensus381 98.16
KOG1244|consensus336 98.03
KOG0825|consensus 1134 97.77
KOG4299|consensus 613 97.76
KOG4323|consensus 464 97.31
KOG0383|consensus 696 96.91
KOG0956|consensus 900 96.9
KOG1245|consensus 1404 96.71
KOG0955|consensus 1051 96.52
KOG1632|consensus 345 96.24
KOG0954|consensus 893 96.23
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 96.12
COG5141 669 PHD zinc finger-containing protein [General functi 94.63
KOG4443|consensus 694 93.99
KOG1844|consensus 508 93.69
KOG0957|consensus707 92.85
KOG0957|consensus 707 92.35
KOG2752|consensus 345 90.66
KOG1473|consensus 1414 90.53
KOG1632|consensus345 89.84
PF07227 446 DUF1423: Protein of unknown function (DUF1423); In 86.39
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 86.28
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information 
Probab=99.97  E-value=2.8e-31  Score=254.69  Aligned_cols=114  Identities=19%  Similarity=0.255  Sum_probs=94.8

Q ss_pred             cHHHHHHHhhcChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HhcCCC-hHHHHHHHHHHHHHHhhhhhchHH
Q psy8390           3 YLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQ---MAASMT-PEQRQREYENLLQEYNKPMIDSEE   78 (422)
Q Consensus         3 YLEDyLE~IE~LP~ELqR~ltlIRELD~~~q~~~~~ld~~~~kfl~---~~~s~~-~ee~~~~~~~I~~~~~ka~elaDE   78 (422)
                      -|+||+|.|+++|.|..++|++|.++|+++.++++.+++.+. |++   +.+... .+..+.+++.|++.|-+++.+..+
T Consensus         6 ~Lnd~~d~l~n~P~et~~~~t~l~~iD~k~~d~~k~l~q~~s-i~k~~~~~~~~t~~e~ed~l~k~i~Ell~~a~~~~~~   84 (271)
T COG5034           6 GLNDITDHLANVPSETDIRFTELSEIDAKVCDIIKNLRQMIS-ILKKIIDLDSQTYEEVEDGLLKEIRELLLKAIYIQKE   84 (271)
T ss_pred             HHHHHHHHHHhCChhhhhhhhhhhhhhHHHHHHHHHHHHHHH-HHHHHhhcccCccccchhHHHHHHHHHHHHHHHHHHH
Confidence            599999999999999999999999999999999999998877 444   333443 444555668999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCCCchhhhhhh
Q psy8390          79 KINLATQIQEFFNKYTRKLEQDIQKFKLELEADNSGITEILEKRV  123 (422)
Q Consensus        79 KV~LA~q~ydLVDrhiRrLD~dL~kf~~ELEadn~GIte~lEkrs  123 (422)
                      |+.|++.+--+++||+++||..+.+.      ...++++.||.+.
T Consensus        85 ~~~l~d~~~~l~~Rh~~~~d~~~a~~------~h~~~~~~ie~~~  123 (271)
T COG5034          85 KSDLADRAEKLLRRHRKLLDDRIAKR------PHEKVAARIENCH  123 (271)
T ss_pred             HHHHHHHHHHHHHHHHHhhhhHHHhh------hhhhhhhhhhhhh
Confidence            99999999999999999999888663      3355666776543

>KOG1973|consensus Back     alignment and domain information
>PF12998 ING: Inhibitor of growth proteins N-terminal histone-binding; InterPro: IPR024610 Histones undergo numerous post-translational modifications, including acetylation and methylation, at residues which are then probable docking sites for various chromatin remodelling complexes Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>KOG1244|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>KOG0956|consensus Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG1632|consensus Back     alignment and domain information
>KOG0954|consensus Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG4443|consensus Back     alignment and domain information
>KOG1844|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG2752|consensus Back     alignment and domain information
>KOG1473|consensus Back     alignment and domain information
>KOG1632|consensus Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
2qic_A62 Crystal Structure Of The Ing1 Phd Finger In Complex 2e-13
3c6w_A59 Crystal Structure Of The Ing5 Phd Finger In Complex 3e-12
2vnf_A60 Molecular Basis Of Histone H3k4me3 Recognition By I 3e-12
2g6q_A62 Crystal Structure Of Ing2 Phd Domain In Complex Wit 4e-12
1wes_A71 Solution Structure Of Phd Domain In Inhibitor Of Gr 5e-12
1weu_A91 Solution Structure Of Phd Domain In Ing1-Like Prote 5e-12
2m1r_A63 Phd Domain Of Ing4 N214d Mutant Length = 63 5e-12
2k1j_A63 Plan Homeodomain Finger Of Tumour Supressor Ing4 Le 6e-12
1wen_A71 Solution Structure Of Phd Domain In Ing1-Like Prote 2e-11
1x4i_A70 Solution Structure Of Phd Domain In Inhibitor Of Gr 5e-11
2pnx_A55 The Phd Finger Of Ing4 In Complex With An H3k4me3 H 6e-11
2jmi_A90 Nmr Solution Structure Of Phd Finger Fragment Of Ye 1e-09
2k16_A75 Solution Structure Of The Free Taf3 Phd Domain Leng 1e-04
>pdb|2QIC|A Chain A, Crystal Structure Of The Ing1 Phd Finger In Complex With A Histone H3k4me3 Peptide Length = 62 Back     alignment and structure 
Iteration: 1

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 15/65 (23%)
Query: 337 PDEPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKW 396
           P+EP YC CN             QV++G M+ CD+  CP EW+H  CVG+  ++ PKGKW
Sbjct: 8   PNEPTYCLCN-------------QVSYGEMIGCDNDECPIEWFHFSCVGL--NHKPKGKW 52
Query: 397 YCPLC 401
           YCP C
Sbjct: 53  YCPKC 57
>pdb|3C6W|A Chain A, Crystal Structure Of The Ing5 Phd Finger In Complex With H3k4me3 Peptide Length = 59 Back     alignment and structure
>pdb|2VNF|A Chain A, Molecular Basis Of Histone H3k4me3 Recognition By Ing4 Length = 60 Back     alignment and structure
>pdb|2G6Q|A Chain A, Crystal Structure Of Ing2 Phd Domain In Complex With H3k4me3 Peptide Length = 62 Back     alignment and structure
>pdb|1WES|A Chain A, Solution Structure Of Phd Domain In Inhibitor Of Growth Family, Member 1-Like Length = 71 Back     alignment and structure
>pdb|1WEU|A Chain A, Solution Structure Of Phd Domain In Ing1-Like Protein Bac25009 Length = 91 Back     alignment and structure
>pdb|2M1R|A Chain A, Phd Domain Of Ing4 N214d Mutant Length = 63 Back     alignment and structure
>pdb|2K1J|A Chain A, Plan Homeodomain Finger Of Tumour Supressor Ing4 Length = 63 Back     alignment and structure
>pdb|1WEN|A Chain A, Solution Structure Of Phd Domain In Ing1-Like Protein Bac25079 Length = 71 Back     alignment and structure
>pdb|1X4I|A Chain A, Solution Structure Of Phd Domain In Inhibitor Of Growth Protein 3 (Ing3) Length = 70 Back     alignment and structure
>pdb|2PNX|A Chain A, The Phd Finger Of Ing4 In Complex With An H3k4me3 Histone Peptide Length = 55 Back     alignment and structure
>pdb|2JMI|A Chain A, Nmr Solution Structure Of Phd Finger Fragment Of Yeast Yng1 Protein In Free State Length = 90 Back     alignment and structure
>pdb|2K16|A Chain A, Solution Structure Of The Free Taf3 Phd Domain Length = 75 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query422
4afl_A104 P29ING4, inhibitor of growth protein 4; cell cycle 2e-25
1x4i_A70 Inhibitor of growth protein 3; structural genomics 1e-24
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 5e-24
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 6e-24
1weu_A91 Inhibitor of growth family, member 4; structural g 6e-23
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 7e-23
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 1e-22
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 2e-22
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-19
1wem_A76 Death associated transcription factor 1; structura 2e-12
1wew_A78 DNA-binding family protein; structural genomics, P 2e-11
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 9e-11
3o70_A68 PHD finger protein 13; PHF13, structural genomics 1e-10
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 2e-10
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 4e-10
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 1e-09
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 2e-09
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 4e-09
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 5e-09
1wee_A72 PHD finger family protein; structural genomics, PH 1e-08
1we9_A64 PHD finger family protein; structural genomics, PH 1e-08
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 3e-08
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 4e-08
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 6e-08
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 1e-07
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 2e-07
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 7e-07
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 1e-06
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-06
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 2e-04
3kv5_D 488 JMJC domain-containing histone demethylation prote 3e-06
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 5e-06
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 7e-06
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 8e-06
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 1e-05
2yt5_A66 Metal-response element-binding transcription facto 1e-05
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 1e-05
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 4e-05
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
2ro1_A 189 Transcription intermediary factor 1-beta; KAP, TIF 6e-05
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 1e-04
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 1e-04
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 2e-04
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 3e-04
>4afl_A P29ING4, inhibitor of growth protein 4; cell cycle, tumour suppressor, chromatin remodelling; 2.28A {Homo sapiens} Length = 104 Back     alignment and structure
 Score = 98.4 bits (245), Expect = 2e-25
 Identities = 28/101 (27%), Positives = 56/101 (55%)

Query: 1   MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAASMTPEQRQR 60
            +YLE Y++ +E LP EL+  F  MR LD ++++   ++     ++   A S++ E++  
Sbjct: 3   GMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLA 62

Query: 61  EYENLLQEYNKPMIDSEEKINLATQIQEFFNKYTRKLEQDI 101
             + + + Y K     ++K+ LA Q  E  +K+ R+L+ D+
Sbjct: 63  LLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDL 103
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query422
4afl_A104 P29ING4, inhibitor of growth protein 4; cell cycle 99.96
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.75
1weu_A91 Inhibitor of growth family, member 4; structural g 99.74
1x4i_A70 Inhibitor of growth protein 3; structural genomics 99.74
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.73
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.73
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.67
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.67
1wew_A78 DNA-binding family protein; structural genomics, P 99.53
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 99.44
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.41
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 99.41
1wee_A72 PHD finger family protein; structural genomics, PH 99.35
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 99.34
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.31
1we9_A64 PHD finger family protein; structural genomics, PH 99.3
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.27
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 99.26
1wem_A76 Death associated transcription factor 1; structura 99.25
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 99.13
3kv5_D 488 JMJC domain-containing histone demethylation prote 99.12
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 99.09
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.09
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.07
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 99.06
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.03
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.02
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.98
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.97
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.96
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.96
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 98.92
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.91
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.91
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.88
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.88
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.83
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.81
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.8
2yt5_A66 Metal-response element-binding transcription facto 98.77
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.73
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.72
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 98.7
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 98.67
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.65
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.63
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.59
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.58
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.57
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 98.49
2ro1_A 189 Transcription intermediary factor 1-beta; KAP, TIF 98.41
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 97.82
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.77
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 97.74
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.35
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.32
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.18
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 97.14
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.01
1wil_A89 KIAA1045 protein; ring finger domain, structural g 93.86
2xzr_A114 Immunoglobulin-binding protein EIBD; cell adhesion 90.13
3ghg_A562 Fibrinogen alpha chain; triple-stranded coiled coi 87.46
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 85.15
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 84.14
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 82.2
>4afl_A P29ING4, inhibitor of growth protein 4; cell cycle, tumour suppressor, chromatin remodelling; 2.28A {Homo sapiens} Back     alignment and structure
Probab=99.96  E-value=7.5e-29  Score=209.62  Aligned_cols=102  Identities=27%  Similarity=0.464  Sum_probs=98.3

Q ss_pred             CccHHHHHHHhhcChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHhhhhhchHHHH
Q psy8390           1 MLYLEDYIELVEILPQELRDRFTEMRLLDLQSQNSLDQLQNKVNQFYQMAASMTPEQRQREYENLLQEYNKPMIDSEEKI   80 (422)
Q Consensus         1 m~YLEDyLE~IE~LP~ELqR~ltlIRELD~~~q~~~~~ld~~~~kfl~~~~s~~~ee~~~~~~~I~~~~~ka~elaDEKV   80 (422)
                      ++|||||+|+|++||.||+|+|++||+||.+++++++++++++++|++..++.+++++...+..|++.|.++++++||||
T Consensus         3 ~~yledyld~ie~LP~El~r~~~~irelD~~~~~~~~~i~~~~~~~~~~~~~~~~~~r~~~l~~I~~~~~~~~~l~dEKv   82 (104)
T 4afl_A            3 GMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMSSARSLSSEEKLALLKQIQEAYGKCKEFGDDKV   82 (104)
T ss_dssp             CHHHHHHHHSGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCChhhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            47999999999999999999999999999999999999999999999988889999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q psy8390          81 NLATQIQEFFNKYTRKLEQDIQ  102 (422)
Q Consensus        81 ~LA~q~ydLVDrhiRrLD~dL~  102 (422)
                      +||++||||||+|+||||.||+
T Consensus        83 ~lA~~~~dlvdkhirrLD~dla  104 (104)
T 4afl_A           83 QLAMQTYEMVDKHIRRLDTDLA  104 (104)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHC-
T ss_pred             HHHHHHHHHHHHHHHHHhhhcC
Confidence            9999999999999999999974
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 422
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 4e-19
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 2e-16
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 1e-13
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 6e-13
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 3e-12
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 9e-12
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 1e-10
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 6e-10
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 2e-09
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 3e-08
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 6e-06
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Inhibitor of growth protein 4, Ing4
species: Homo sapiens [TaxId: 9606]

 Score = 78.0 bits (192), Expect = 4e-19
 Identities = 25/66 (37%), Positives = 36/66 (54%), Gaps = 15/66 (22%)

Query: 339 EPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKWYC 398
           EP YC              C QV++G M+ CD+ +C  EW+H  CVG+     P+GKW+C
Sbjct: 1   EPTYC-------------LCHQVSYGEMIGCDNPDCSIEWFHFACVGL--TTKPRGKWFC 45

Query: 399 PLCLEK 404
           P C ++
Sbjct: 46  PRCSQE 51
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query422
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.58
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 99.52
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 99.26
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 99.18
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.16
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.07
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 99.0
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.99
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.95
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.93
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.76
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD Inhibitor of growth protein 2, Ing2
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.58  E-value=5.5e-16  Score=121.34  Aligned_cols=58  Identities=48%  Similarity=1.311  Sum_probs=48.7

Q ss_pred             CCCCCCCCCceeEeccccccccchhcccccCCCceeeecCCCCCCcceecccCCcCCCCCCCCceecccCcch
Q psy8390         332 DTGYGPDEPRYCRCNEQAHYNFYTIFCSQVAFGVMVACDSKNCPYEWYHCECVGIAPDNPPKGKWYCPLCLEK  404 (422)
Q Consensus       332 ~~~~d~~e~~yCiC~~~~~~~~y~~~C~~~~~g~MI~CD~c~C~~~WfH~~CVgi~~~~~p~~~W~Cp~C~~~  404 (422)
                      +...|+++.+||||++             +.++.||.|+...|+..|||+.||+|+  .+|.++||||.|+..
T Consensus         8 ~~~~d~~e~~~CiC~~-------------~~~~~~i~c~~~~C~~~wfH~~Cvgl~--~~p~~~w~C~~C~~~   65 (71)
T d1wesa_           8 EFAIDPNEPTYCLCNQ-------------VSYGEMIGCDNEQCPIEWFHFSCVSLT--YKPKGKWYCPKCRGD   65 (71)
T ss_dssp             CSCCCSSSCCCSTTCC-------------CCCSSEECCSCTTCSCCCEETTTTTCS--SCCSSCCCCTTTSSC
T ss_pred             CCCcCCCCCCEEEeCC-------------CCCCCEEEEECCCCCCcCccCccCCCC--cCCCCcEECcCCccc
Confidence            5667788889999994             466788888776787789999999998  889999999999654
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure