Psyllid ID: psy8409
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 937 | 2.2.26 [Sep-21-2011] | |||||||
| P35227 | 344 | Polycomb group RING finge | yes | N/A | 0.200 | 0.546 | 0.407 | 2e-41 | |
| P25916 | 324 | Polycomb complex protein | yes | N/A | 0.225 | 0.651 | 0.398 | 8e-41 | |
| P23798 | 342 | Polycomb group RING finge | no | N/A | 0.200 | 0.549 | 0.407 | 9e-41 | |
| Q32KX7 | 326 | Polycomb complex protein | no | N/A | 0.207 | 0.595 | 0.396 | 3e-40 | |
| Q9TST0 | 326 | Polycomb complex protein | N/A | N/A | 0.207 | 0.595 | 0.391 | 4e-40 | |
| Q5R8L2 | 326 | Polycomb complex protein | yes | N/A | 0.207 | 0.595 | 0.391 | 5e-40 | |
| P35226 | 326 | Polycomb complex protein | no | N/A | 0.207 | 0.595 | 0.391 | 5e-40 | |
| Q5SDR3 | 326 | Polycomb complex protein | yes | N/A | 0.224 | 0.644 | 0.382 | 5e-39 | |
| Q8JIR0 | 320 | Polycomb complex protein | yes | N/A | 0.192 | 0.562 | 0.409 | 4e-38 | |
| Q640D5 | 323 | Polycomb complex protein | N/A | N/A | 0.199 | 0.578 | 0.404 | 1e-37 |
| >sp|P35227|PCGF2_HUMAN Polycomb group RING finger protein 2 OS=Homo sapiens GN=PCGF2 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 171 bits (434), Expect = 2e-41, Method: Compositional matrix adjust.
Identities = 82/201 (40%), Positives = 130/201 (64%), Gaps = 13/201 (6%)
Query: 18 VCKTCIVKYLKRHKYCPICDVLVYKTKPLQSIRPDTRLQNVVYKLIPGLYEKEMQRRQMF 77
CKTCIV+YL+ +KYCP+CDV V+KT+PL SIR D LQ++VYKL+PGL++ EM+RR+ F
Sbjct: 38 FCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDF 97
Query: 78 FSSTPIQNSLGLTGEDKGIITESSDIILPDENI-SITLEYLAHSSD-----------DIN 125
+++ P+ + ED+G + E L D+ I S+++E+ + D D +
Sbjct: 98 YAAYPLTEVPNGSNEDRGEVLEQEKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGD 157
Query: 126 KAVYGRRYLRCKASAPVSILHKFLKNKFNLSNKHCVELVCNNEQLTQNISVMDVAYIYQW 185
K G R+LRC A+ V L KFL+NK ++ +K+ VE++ +E L + ++MD+AYIY W
Sbjct: 158 KEKTGVRFLRCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPW 217
Query: 186 KKKTPMYLGYRILETKIKRIS 206
++ P+ L YR+ + KR++
Sbjct: 218 RRNGPLPLKYRV-QPACKRLT 237
|
Transcriptional repressor. Binds specifically to the DNA sequence 5'-GACTNGACT-3'. Has tumor suppressor activity. May play a role in control of cell proliferation and/or neural cell development. Regulates proliferation of early T progenitor cells by maintaining expression of HES1. Also plays a role in antero-posterior specification of the axial skeleton and negative regulation of the self-renewal activity of hematopoietic stem cells. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Is not functionally redundant with Bmi1; unlike Bmi1 does not stimulate the E3 ubiquitin-protein ligase activity in a reconstituted PRC1-like complex. Homo sapiens (taxid: 9606) |
| >sp|P25916|BMI1_MOUSE Polycomb complex protein BMI-1 OS=Mus musculus GN=Bmi1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P23798|PCGF2_MOUSE Polycomb group RING finger protein 2 OS=Mus musculus GN=Pcgf2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q32KX7|BMI1_BOVIN Polycomb complex protein BMI-1 OS=Bos taurus GN=BMI1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9TST0|BMI1_FELCA Polycomb complex protein BMI-1 OS=Felis catus GN=BMI1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5R8L2|BMI1_PONAB Polycomb complex protein BMI-1 OS=Pongo abelii GN=BMI1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P35226|BMI1_HUMAN Polycomb complex protein BMI-1 OS=Homo sapiens GN=BMI1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q5SDR3|BMI1_CHICK Polycomb complex protein BMI-1 OS=Gallus gallus GN=BMI1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8JIR0|BMI1A_DANRE Polycomb complex protein BMI-1-A OS=Danio rerio GN=bmi1a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q640D5|BMI1B_XENLA Polycomb complex protein BMI-1-B OS=Xenopus laevis GN=bmi1b PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 937 | ||||||
| 332027981 | 1426 | Polycomb complex protein BMI-1 [Acromyrm | 0.254 | 0.166 | 0.375 | 3e-46 | |
| 307207694 | 1474 | Polycomb complex protein BMI-1 [Harpegna | 0.256 | 0.162 | 0.371 | 2e-45 | |
| 322791296 | 1427 | hypothetical protein SINV_04327 [Solenop | 0.256 | 0.168 | 0.365 | 6e-45 | |
| 307173961 | 1468 | Polycomb complex protein BMI-1 [Camponot | 0.257 | 0.164 | 0.345 | 7e-45 | |
| 156547031 | 1468 | PREDICTED: hypothetical protein LOC10011 | 0.284 | 0.181 | 0.335 | 1e-44 | |
| 380027905 | 1303 | PREDICTED: uncharacterized protein LOC10 | 0.209 | 0.150 | 0.452 | 5e-44 | |
| 383858055 | 1378 | PREDICTED: uncharacterized protein LOC10 | 0.203 | 0.138 | 0.436 | 1e-43 | |
| 350422954 | 1391 | PREDICTED: hypothetical protein LOC10074 | 0.250 | 0.168 | 0.354 | 3e-43 | |
| 328793199 | 1395 | PREDICTED: hypothetical protein LOC41398 | 0.209 | 0.140 | 0.447 | 3e-43 | |
| 355754087 | 344 | DNA-binding protein Mel-18 [Macaca fasci | 0.200 | 0.546 | 0.407 | 1e-39 |
| >gi|332027981|gb|EGI68032.1| Polycomb complex protein BMI-1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Score = 193 bits (491), Expect = 3e-46, Method: Compositional matrix adjust.
Identities = 113/301 (37%), Positives = 170/301 (56%), Gaps = 63/301 (20%)
Query: 11 KLFFSFPVCKTCIVKYLKRHKYCPICDVLVYKTKPLQSIRPDTRLQNVVYKLIPGLYEKE 70
+ SF CK+CIVKYL+ +KYCPIC+V V+K++PL +IRPD LQ++VYKL+PG Y+ E
Sbjct: 36 ECLHSF--CKSCIVKYLENNKYCPICEVQVHKSRPLLNIRPDYILQDIVYKLVPGCYQNE 93
Query: 71 MQRRQMFFSSTPIQNSLGLTGEDKGIITESSDIILPDENISITLEY-------LAHSSDD 123
M+RR+ F++ P ++ ++ E +G ES I PDE++S++LEY L+ ++ D
Sbjct: 94 MRRRREFYAKHPEESIQTISSEARGKPIESY-IYSPDESLSLSLEYSDPHTKNLSETNTD 152
Query: 124 INKAVYGRRYLRCKASAPVSILHKFLKNKFNLSNKHCVELVCNNEQLTQNISVMDVAYIY 183
K++ RRY RC A+ + L K ++ K+ L + + V+++ E L + S+MDV YIY
Sbjct: 153 --KSIL-RRYFRCPAAVTIFHLQKLIRAKYGLGDINRVDIMYEEEPLCSSYSLMDVMYIY 209
Query: 184 QWKKKTPMYLGYRILETKIKRISETEEAENSKRLKLSEESNTDNSQNSRHKPITNDAIPI 243
W +K P++L YRI ET +SKRLKLSE+ N+ +K DA
Sbjct: 210 HWMRKVPLHLSYRIFET------------SSKRLKLSED-------NANYKKSLMDA--- 247
Query: 244 GCDINSNADNNTNTGNVIPKANDTSNHINKPAPPINNQGAHSNEWKEVELKINDNGVMSA 303
DI+S I ++ + EWKEV+LKI++ GVMS
Sbjct: 248 --DIDS--------------------------IEIKDEKSLKREWKEVQLKISETGVMSI 279
Query: 304 T 304
T
Sbjct: 280 T 280
|
Source: Acromyrmex echinatior Species: Acromyrmex echinatior Genus: Acromyrmex Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307207694|gb|EFN85331.1| Polycomb complex protein BMI-1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322791296|gb|EFZ15813.1| hypothetical protein SINV_04327 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307173961|gb|EFN64691.1| Polycomb complex protein BMI-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|156547031|ref|XP_001601096.1| PREDICTED: hypothetical protein LOC100116657 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|380027905|ref|XP_003697655.1| PREDICTED: uncharacterized protein LOC100865279 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383858055|ref|XP_003704518.1| PREDICTED: uncharacterized protein LOC100879416 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350422954|ref|XP_003493340.1| PREDICTED: hypothetical protein LOC100746991 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|328793199|ref|XP_397419.4| PREDICTED: hypothetical protein LOC413984 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|355754087|gb|EHH58052.1| DNA-binding protein Mel-18 [Macaca fascicularis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 937 | ||||||
| ZFIN|ZDB-GENE-040116-4 | 326 | bmi1b "B lymphoma Mo-MLV inser | 0.237 | 0.684 | 0.362 | 4.4e-35 | |
| MGI|MGI:88174 | 324 | Bmi1 "Bmi1 polycomb ring finge | 0.237 | 0.688 | 0.358 | 3.7e-34 | |
| UNIPROTKB|E2RTM4 | 326 | BMI1 "Uncharacterized protein" | 0.237 | 0.684 | 0.351 | 1.6e-33 | |
| MGI|MGI:99161 | 342 | Pcgf2 "polycomb group ring fin | 0.237 | 0.652 | 0.35 | 2e-33 | |
| RGD|1305097 | 342 | Pcgf2 "polycomb group ring fin | 0.237 | 0.652 | 0.35 | 2e-33 | |
| UNIPROTKB|Q32KX7 | 326 | BMI1 "Polycomb complex protein | 0.237 | 0.684 | 0.368 | 2.1e-33 | |
| UNIPROTKB|F2Z5D1 | 326 | BMI1 "Uncharacterized protein" | 0.237 | 0.684 | 0.364 | 2.1e-33 | |
| UNIPROTKB|P35226 | 326 | BMI1 "Polycomb complex protein | 0.237 | 0.684 | 0.364 | 2.7e-33 | |
| UNIPROTKB|Q5R8L2 | 326 | BMI1 "Polycomb complex protein | 0.237 | 0.684 | 0.364 | 2.7e-33 | |
| UNIPROTKB|Q9TST0 | 326 | BMI1 "Polycomb complex protein | 0.237 | 0.684 | 0.364 | 2.7e-33 |
| ZFIN|ZDB-GENE-040116-4 bmi1b "B lymphoma Mo-MLV insertion region 1b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 372 (136.0 bits), Expect = 4.4e-35, Sum P(2) = 4.4e-35
Identities = 86/237 (36%), Positives = 132/237 (55%)
Query: 19 CKTCIVKYLKRHKYCPICDVLVYKTKPLQSIRPDTRLQNVVYKLIPGLYEKEMQRRQMFF 78
CK CIV+YL+ KYCPICDV V+KTKPL +IR D LQ++VYKL+PGL++ EM+RR+ F+
Sbjct: 41 CKMCIVRYLETSKYCPICDVQVHKTKPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFY 100
Query: 79 SSTPIQNSLGLTGEDKGIIT-ESSDIILPDENISITLEYLAHSSDD--------INKAVY 129
+ P+ + G + ED+G ++ E II DE IS+++E+ D K V
Sbjct: 101 AEHPVDATNG-SNEDRGEVSDEDKRIIADDEIISLSIEFFDQKKLDGKDGEEKESTKEVT 159
Query: 130 GRRYLRCKASAPVSIXXXXXXXXXXXXXXXCVELVCNNEQLTQNISVMDVAYIYQWKKKT 189
+RYL+C A+ V +E++ +E L ++MD+AYIY W++
Sbjct: 160 VKRYLQCPAAMTVMHLRKFLRSKMDIPCTFQIEVMYEDEPLKDYYTLMDIAYIYTWRRNG 219
Query: 190 PMYLGYRILE--TKIKRISETEEAENSKRLKLSEESNTD--NSQNSRHKPITNDAIP 242
P+ L YR+ KIK S + +R +S++D NS + P T+ ++P
Sbjct: 220 PLPLKYRVRPGCKKIKLSSPRNDMSGGRRPDTESDSSSDKPNSPSIVAAPSTSSSMP 276
|
|
| MGI|MGI:88174 Bmi1 "Bmi1 polycomb ring finger oncogene" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RTM4 BMI1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99161 Pcgf2 "polycomb group ring finger 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305097 Pcgf2 "polycomb group ring finger 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32KX7 BMI1 "Polycomb complex protein BMI-1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z5D1 BMI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P35226 BMI1 "Polycomb complex protein BMI-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R8L2 BMI1 "Polycomb complex protein BMI-1" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9TST0 BMI1 "Polycomb complex protein BMI-1" [Felis catus (taxid:9685)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 937 | |||
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 4e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.003 |
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Score = 38.6 bits (90), Expect = 4e-04
Identities = 10/19 (52%), Positives = 14/19 (73%)
Query: 18 VCKTCIVKYLKRHKYCPIC 36
C+ CI++YLK+ CPIC
Sbjct: 25 FCRECILRYLKKKSKCPIC 43
|
Length = 45 |
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 937 | |||
| KOG2660|consensus | 331 | 100.0 | ||
| KOG0311|consensus | 381 | 99.04 | ||
| KOG2177|consensus | 386 | 98.38 | ||
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.24 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.15 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 97.95 | |
| KOG0287|consensus | 442 | 97.87 | ||
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 97.87 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.86 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 97.83 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 97.71 | |
| PF11816 | 331 | DUF3337: Domain of unknown function (DUF3337); Int | 97.68 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.61 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 97.6 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.49 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.42 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.35 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 97.31 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 97.26 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.16 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.08 | |
| KOG4159|consensus | 398 | 97.06 | ||
| KOG2164|consensus | 513 | 96.68 | ||
| KOG0823|consensus | 230 | 96.23 | ||
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 96.15 | |
| cd01611 | 112 | GABARAP Ubiquitin domain of GABA-receptor-associat | 96.15 | |
| KOG0802|consensus | 543 | 96.14 | ||
| cd01612 | 87 | APG12_C Ubiquitin-like domain of APG12. APG12_C Th | 96.03 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 95.9 | |
| PTZ00380 | 121 | microtubule-associated protein (MAP); Provisional | 95.68 | |
| KOG0297|consensus | 391 | 95.31 | ||
| PF02991 | 104 | Atg8: Autophagy protein Atg8 ubiquitin like; Inter | 95.29 | |
| KOG1813|consensus | 313 | 94.24 | ||
| PF04110 | 87 | APG12: Ubiquitin-like autophagy protein Apg12 ; In | 93.85 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 93.69 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 93.6 | |
| KOG1039|consensus | 344 | 93.53 | ||
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 93.17 | |
| KOG1654|consensus | 116 | 93.11 | ||
| KOG1002|consensus | 791 | 92.76 | ||
| KOG0824|consensus | 324 | 92.49 | ||
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 91.97 | |
| KOG4185|consensus | 296 | 91.88 | ||
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 91.7 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 91.38 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 91.04 | |
| KOG0825|consensus | 1134 | 90.69 | ||
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 90.44 | |
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 89.74 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 89.49 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 88.42 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 88.27 | |
| PF13764 | 802 | E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 | 88.21 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 87.88 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 87.67 | |
| KOG4628|consensus | 348 | 87.63 | ||
| KOG4739|consensus | 233 | 86.93 | ||
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 86.78 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 86.56 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 86.3 | |
| KOG1001|consensus | 674 | 85.92 | ||
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 85.62 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 84.85 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 84.62 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 84.62 | |
| KOG3800|consensus | 300 | 83.57 | ||
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 82.83 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 82.76 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 82.31 | |
| KOG0827|consensus | 465 | 81.79 |
| >KOG2660|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-43 Score=370.35 Aligned_cols=201 Identities=38% Similarity=0.694 Sum_probs=168.5
Q ss_pred cccccccCCccccCCcchHHhHHHHhcCCCCCccccccccccCCCCCCCCchhhHHHHHHhcCCchhhhHHhHhhhcccC
Q psy8409 2 TTILHKSGPKLFFSFPVCKTCIVKYLKRHKYCPICDVLVYKTKPLQSIRPDTRLQNVVYKLIPGLYEKEMQRRQMFFSST 81 (937)
Q Consensus 2 ~aLLhkt~tTLECLHSFCKSCIvKyLE~sksCPvCRk~IhkSrPL~sLRpDrTLQdIVyKLVPgL~esEmeRRREFYkKh 81 (937)
.|.|.+|.++.+|+|||||+||++||+.+++||+|+..+|+++|+++|+.|++||+|||||||+|+++|++|+++||+++
T Consensus 22 ~GYliDATTI~eCLHTFCkSCivk~l~~~~~CP~C~i~ih~t~pl~ni~~DrtlqdiVyKLVPgl~erE~k~~rdFy~~~ 101 (331)
T KOG2660|consen 22 GGYLIDATTITECLHTFCKSCIVKYLEESKYCPTCDIVIHKTHPLLNIRSDRTLQDIVYKLVPGLQEREMKRRRDFYKSR 101 (331)
T ss_pred cceeecchhHHHHHHHHHHHHHHHHHHHhccCCccceeccCccccccCCcchHHHHHHHHHcchHHHHHHHHHHHHHHhC
Confidence 37889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CccCCCCCCCCccCcccC-------------------CCCCCCCCCCeeEEEEEccCCCCcccccccccceEEecCCccH
Q psy8409 82 PIQNSLGLTGEDKGIITE-------------------SSDIILPDENISITLEYLAHSSDDINKAVYGRRYLRCKASAPV 142 (937)
Q Consensus 82 g~qesqsaSPEErGE~~D-------------------dlkLFC~DDQISLCLEC~sSredd~nlk~L~KRYLRCSArATV 142 (937)
+..+.+....+++++..+ +...+..|.++.+++++... .++.+.++||||++++||
T Consensus 102 ~~~d~~~~~~~~~~~~~~~ek~~~t~~~~~s~~l~~~~~~~~r~d~~~~~~~~e~~~-----~~k~l~~~fvrcsa~~Tv 176 (331)
T KOG2660|consen 102 PLVDVPAGDTPERGHVLGEEKVPDTSDEIASLSLEVEDFKQNRLDEQVSVGLDEGKD-----TLKDLVRRFLRCSAAATV 176 (331)
T ss_pred CCcccCCCCCcccccccCcccCCCchhhhhccccchhhcccchhhhhhhcCCCcccc-----cccccccceEeccHHHHH
Confidence 843332222221211111 11233445555554443322 355677999999999999
Q ss_pred HHHHHHHHHHcC-CCCCceEEEEECCeecCCCCchhhHHhhhccC-CCCCeEEEEEeeecccccccchHHhhhhcccccc
Q psy8409 143 SILHKFLKNKFN-LSNKHCVELVCNNEQLTQNISVMDVAYIYQWK-KKTPMYLGYRILETKIKRISETEEAENSKRLKLS 220 (937)
Q Consensus 143 sHLKKFLAkKLd-Lpse~EVEILCnGEpL~ddyTLMDfAyIYrWR-RksPMvL~YRIke~sikpip~~e~aE~~krlkls 220 (937)
.||+|||+.|++ ++...+|||+|+|++|++++|||+|+++++|+ +++||+|+||+.+. +++++|.
T Consensus 177 ~hlkkfl~~k~~~~~~~~~idi~~~d~~l~~~~TLk~i~~~~~~~~r~~pL~l~y~v~p~-------------v~~~~L~ 243 (331)
T KOG2660|consen 177 NHLKKFLRKKMDNLSNKSEIDILCEEELLGDYYTLKDIAYAYRWRSRDPPLPLRYRVKPK-------------VSRLKLT 243 (331)
T ss_pred HHHHHHHHHHhccccchhhheeecCCccccchhhhhhhhhhhcccccCCcceeEeccccc-------------cccceee
Confidence 999999999999 88999999999999999999999999999999 89999999999977 7788887
|
|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF11816 DUF3337: Domain of unknown function (DUF3337); InterPro: IPR021772 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd01611 GABARAP Ubiquitin domain of GABA-receptor-associated protein | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >cd01612 APG12_C Ubiquitin-like domain of APG12 | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PTZ00380 microtubule-associated protein (MAP); Provisional | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >PF02991 Atg8: Autophagy protein Atg8 ubiquitin like; InterPro: IPR004241 Autophagy is generally known as a process involved in the degradation of bulk cytoplasmic components that are non-specifically sequestered into an autophagosome, where they are sequestered into double-membrane vesicles and delivered to the degradative organelle, the lysosome/vacuole, for breakdown and eventual recycling of the resulting macromolecules | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >PF04110 APG12: Ubiquitin-like autophagy protein Apg12 ; InterPro: IPR007242 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG1654|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >KOG3800|consensus | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 937 | ||||
| 3rpg_B | 117 | Bmi1RING1B-Ubch5c Complex Structure Length = 117 | 8e-20 | ||
| 2ckl_A | 108 | Ring1b-Bmi1 E3 Catalytic Domain Structure Length = | 1e-19 | ||
| 2h0d_A | 97 | Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquiti | 2e-19 |
| >pdb|3RPG|B Chain B, Bmi1RING1B-Ubch5c Complex Structure Length = 117 | Back alignment and structure |
|
| >pdb|2CKL|A Chain A, Ring1b-Bmi1 E3 Catalytic Domain Structure Length = 108 | Back alignment and structure |
| >pdb|2H0D|A Chain A, Structure Of A Bmi-1-Ring1b Polycomb Group Ubiquitin Ligase Complex Length = 97 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
Score = 84.9 bits (210), Expect = 7e-20
Identities = 40/63 (63%), Positives = 52/63 (82%), Gaps = 2/63 (3%)
Query: 15 SFPVCKTCIVKYLKRHKYCPICDVLVYKTKPLQSIRPDTRLQNVVYKLIPGLYEKEMQRR 74
SF CKTCIV+YL+ KYCPICDV V+KT+PL +IR D LQ++VYKL+PGL++ EM+RR
Sbjct: 37 SF--CKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRR 94
Query: 75 QMF 77
+ F
Sbjct: 95 RDF 97
|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 937 | |||
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.47 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.02 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.93 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.79 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.77 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.75 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.74 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.72 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.72 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.67 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.65 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.63 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.63 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.62 | |
| 3gs2_A | 111 | E3 ubiquitin-protein ligase RING2; RING1B, CBOX, C | 98.61 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.59 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.57 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.56 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.52 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.5 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.5 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.46 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.35 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.34 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.23 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.22 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.2 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.19 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.18 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.13 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.12 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.11 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.09 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.08 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.06 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.06 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.06 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.05 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.04 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 97.97 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 97.97 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 97.95 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 97.94 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 97.93 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 97.91 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.91 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 97.88 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 97.87 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 97.86 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 97.82 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 97.8 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 97.71 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.59 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 97.53 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 97.49 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 97.36 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 97.19 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 97.16 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 97.11 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 97.1 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 97.04 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 96.96 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 96.91 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 96.67 | |
| 2r2q_A | 110 | Gamma-aminobutyric acid receptor-associated protei | 96.64 | |
| 1eo6_A | 117 | GATE-16, golgi-associated ATPase enhancer of 16 KD | 96.49 | |
| 2zjd_A | 130 | Microtubule-associated proteins 1A/1B light chain | 96.44 | |
| 4gdk_A | 91 | Ubiquitin-like protein ATG12; protein-protein conj | 96.41 | |
| 3h9d_A | 119 | ATG8, microtubule-associated protein 1A/1B, light | 96.24 | |
| 3rui_B | 118 | Autophagy-related protein 8; autophagosome formati | 96.21 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 96.13 | |
| 3m95_A | 125 | Autophagy related protein ATG8; alpha slash beta, | 95.88 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 95.49 | |
| 3w1s_C | 91 | Ubiquitin-like protein ATG12; ubiquitin fold, E3-l | 94.4 | |
| 1wz3_A | 96 | Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, pla | 94.39 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 94.23 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 94.05 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 93.71 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 93.48 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 93.4 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 93.04 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 93.02 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 92.97 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 92.84 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 92.68 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 92.66 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 92.44 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 92.35 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 92.22 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 92.16 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 91.96 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 91.91 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 91.01 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 90.98 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 90.94 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 90.7 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 90.44 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 90.43 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 90.27 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 90.26 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 89.87 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 89.69 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 89.59 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 89.47 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 89.31 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 89.3 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 89.2 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 89.2 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 89.16 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 89.11 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 89.09 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 88.72 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 88.66 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 88.45 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 88.14 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 87.96 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 87.13 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 87.0 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 86.84 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 86.2 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 85.79 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 85.69 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 85.51 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 85.07 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 84.93 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 84.83 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 84.61 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 84.31 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 83.97 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 83.53 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 83.12 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 82.79 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 82.6 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 83.12 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 82.04 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 81.74 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 80.98 |
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
Probab=99.47 E-value=1.8e-14 Score=125.96 Aligned_cols=81 Identities=48% Similarity=0.935 Sum_probs=71.2
Q ss_pred cccccCCccccCCcchHHhHHHHhcCCCCCccccccccccCCCCCCCCchhhHHHHHHhcCCchhhhHHhHhhhcccCCc
Q psy8409 4 ILHKSGPKLFFSFPVCKTCIVKYLKRHKYCPICDVLVYKTKPLQSIRPDTRLQNVVYKLIPGLYEKEMQRRQMFFSSTPI 83 (937)
Q Consensus 4 LLhkt~tTLECLHSFCKSCIvKyLE~sksCPvCRk~IhkSrPL~sLRpDrTLQdIVyKLVPgL~esEmeRRREFYkKhg~ 83 (937)
++.+...++.|||+||+.||.+++.....||.|+..+....|+..++.|..|++|++++++++++.|+.+|++||++++.
T Consensus 24 ~~~~p~~~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~l~~n~~l~~~i~~~~~~~~~~e~~~~~~~~~~~~~ 103 (108)
T 2ckl_A 24 YFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPS 103 (108)
T ss_dssp BCSSEEEETTTCCEEEHHHHHHHHTSCSBCTTTCCBSCSSCGGGGEEECHHHHHHHHHHSTTHHHHHHHHHHHHHHHSCC
T ss_pred HHhCcCEeCCCCChhhHHHHHHHHHhCCcCcCCCccccccCcccccCcCHHHHHHHHHHhhhHHHHHHHhHHHHHHhCcc
Confidence 34444444599999999999999998899999999998777777899999999999999999999999999999999976
Q ss_pred c
Q psy8409 84 Q 84 (937)
Q Consensus 84 q 84 (937)
.
T Consensus 104 ~ 104 (108)
T 2ckl_A 104 A 104 (108)
T ss_dssp -
T ss_pred c
Confidence 4
|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >3gs2_A E3 ubiquitin-protein ligase RING2; RING1B, CBOX, CBX7, polycomb, E3-ligase, chromosomal protein transcription regulation, chromatin regulator; 1.70A {Homo sapiens} PDB: 3ixs_A* 3h8h_A* | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A | Back alignment and structure |
|---|
| >1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 | Back alignment and structure |
|---|
| >2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A | Back alignment and structure |
|---|
| >4gdk_A Ubiquitin-like protein ATG12; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_A | Back alignment and structure |
|---|
| >3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} SCOP: d.15.1.0 | Back alignment and structure |
|---|
| >3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} SCOP: d.15.1.3 PDB: 2kq7_A 2zpn_A 3vxw_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} SCOP: d.15.1.3 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3w1s_C Ubiquitin-like protein ATG12; ubiquitin fold, E3-like, ATG3 binding, isopeptide bond betwe Gly186 and ATG5 Lys149, ligase; 2.60A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7 | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 937 | ||||
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 0.002 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 0.003 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Score = 35.2 bits (81), Expect = 0.002
Identities = 8/24 (33%), Positives = 12/24 (50%), Gaps = 2/24 (8%)
Query: 19 CKTCIVKYLKRHKYCPIC--DVLV 40
C+ +L H CP+C V+V
Sbjct: 32 HAECVDMWLGSHSTCPLCRLTVVV 55
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 937 | |||
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.78 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.7 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.68 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.64 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.48 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.39 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.25 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.18 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.17 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 97.99 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 97.77 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 97.71 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.66 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 97.55 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 97.51 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 96.11 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 95.99 | |
| d3d32a1 | 118 | GABA(A) receptor associated protein GABARAP {Human | 95.96 | |
| d1eo6a_ | 116 | Golgi-associated ATPase enhancer of 16 kD, Gate-16 | 95.32 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 94.86 | |
| d2zjda1 | 119 | Microtubule-associated proteins 1A/1B light chain | 94.74 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 93.44 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 92.85 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 92.39 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 92.29 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 91.87 | |
| d1x1ma1 | 94 | Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta | 91.5 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 91.37 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 91.13 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 91.12 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 90.78 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 90.61 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 90.54 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 90.53 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 90.43 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 90.35 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 90.1 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 89.98 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 89.77 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 88.74 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 87.98 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 87.85 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 87.38 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 86.57 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 85.0 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 83.02 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 82.91 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 82.77 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 81.45 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 80.13 |
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: brca1 RING domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.78 E-value=7.6e-10 Score=95.41 Aligned_cols=55 Identities=25% Similarity=0.573 Sum_probs=44.4
Q ss_pred cccccCCccccCCcchHHhHHHHhcCC---CCCccccccccccCCCCCCCCchhhHHHHHHhc
Q psy8409 4 ILHKSGPKLFFSFPVCKTCIVKYLKRH---KYCPICDVLVYKTKPLQSIRPDTRLQNVVYKLI 63 (937)
Q Consensus 4 LLhkt~tTLECLHSFCKSCIvKyLE~s---ksCPvCRk~IhkSrPL~sLRpDrTLQdIVyKLV 63 (937)
++.+. .++.|||+||+.||.+||... ..||.||..+... .+++|..|+++|+++.
T Consensus 30 ~~~~p-v~~~CgH~fC~~Ci~~~~~~~~~~~~CP~Cr~~~~~~----~l~~n~~l~~~ve~l~ 87 (103)
T d1jm7a_ 30 LIKEP-VSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKR----SLQESTRFSQLVEELL 87 (103)
T ss_dssp CCSSC-CBCTTSCCCCSHHHHHHHHSSSSSCCCTTTSCCCCTT----TCBCCCSSSHHHHHHH
T ss_pred hhCCe-EEcCCCCchhhHHHHHHHHHCCCCCcCcCCCCcCChh----hCCcCHHHHHHHHHHH
Confidence 34444 457899999999999999764 4799999988543 6899999999998873
|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eo6a_ d.15.1.3 (A:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2zjda1 d.15.1.3 (A:2-120) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|