Psyllid ID: psy8454


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930------
MFKTGDHKLNSSGMFIGVFSELQTGTMESTYDEDLSENIFFKALKTEHGELFEKATQDGWIICIPRVCSLPKYALTYEDFFNHILIPSEELPETHFRTLNDQEIRICNRIISIEADGGSTFSTQILFEETYYTDEMLKYKVLCIDNPLDINLENTNDASISNIQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTNDQFEYNPFDKQKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITACTALEDAQFNKMIRNLSDIQLKDLDIREDLYDTVPRARSEISHIDCYSTILGKIGCVRRCISAISKEDTRDKLQGNIITVDDLLPMIVFLVVKCALPNWIAHLTYMKQFHFSQSSNVCIDQDSFLITSLEASIEHIKSGLLIGPSEPEALMSYDDQEELANAKFKPTVEMSDLTTQLKVYNKYNNYKKISSLTKLFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAINLKHSQSKPTTQSMDDRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPKPLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRNITEIKKVEQLFALIENNEIKLIKSYFGLSNEEKVPDNACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSLVRVLTHEAPFVLK
ccccccccccccccEEEEcccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccccccccccccccEEEEEccEEEEEcccccccccccccccccccccccEEEEEEEcccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHccHHHHccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHccHHHHHHccccHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHcccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHccccHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHHcHHHHHHHHHHcccccccccccccccccccccHHHHcccHHHHHHHcccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHcccccccccccHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccc
ccccccccccccccEEEEHHHHccccccccccHHHHccHHHHHHHHHcHHHHHHHHHHccEEEEEccccccccccccccccEEEEEEccccccccEEEccccEEEEEccEEEEcccccccccccEEEEEEEcccccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHcHHHHHHHHHHHHHHHHHHHHccccccHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHcHHcccccccHHHEEEHccccHcHHHHHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHccccccHcccccccHHHHHHHHcccHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHcccHHHHHHHHHcccHHHHHHHHcccccccccccccHHHHHHHcccccHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccc
mfktgdhklnssGMFIGVFSelqtgtmestydedlsENIFFKALKTEHGELFEKatqdgwiiciprvcslpkyaltyedffnhilipseelpethfrtLNDQEIRICNRIIsieadggstfstQILFEETYYTDEMLKYKVLCIdnpldinlentndasiSNIQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTndqfeynpfdkQKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITACTALEDAQFNKMIRNLsdiqlkdldiredlydtvprarseishidcYSTILGKIGCVRRCISAISKEdtrdklqgniitvddlLPMIVFLVVKCALPNWIAHLTYMKqfhfsqssnvcidqdsFLITSLEASIEHIKSglligpsepealmsyddqeelanakfkptvemsdlTTQLKVYNKYNNYKKISSLTKLFefarlgdgdKVRAILQEEnkkedseslplchplcscddceeainlkhsqskpttqsmddrgfTVLHVAALYGRIKVVDLVLELgadtnsqdlcgcsplhyaatRGHQNVLLLLLHSgasinltdnegntalhlatnnGHETCVKALIYFNEQEVLNLNINAvnnqgdsplhaaARWGYTSIIQLLLdhganptlenkrkvtplqnannLHVAKLLNAyvhkpkplynylvpkekvsrppsppptqdkyldysdvneanisnvnvregvrprniTEIKKVEQLFALIENNEIKLIKSYfglsneekvpdnachplcqcakckedvvesesrpvtdeclninicnsdgyTALHIATSLGHYDLVRLLINYRadinivtrvkqltplhiacqNNNLSIVRLLLAAKQCnvnaqdyrgnTALHYAAINNHTNLATLLLksgarpqiknhygqTCLHMAQQMTSLSLVRVLtheapfvlk
mfktgdhklnssGMFIGVFSELQTGTMESTYDEDLSENIFFKALKTEHGELFEKATQDGWIICIPRVCSLPKYALTYEDFFNHILIPSEELPETHFRTLNDQEIRICNRIIsieadggstfsTQILFEETYYTDEMLKYKVLCIDNPLDINLENTNDASISNIQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTNDQFEYNPFDKQKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITACTALEDAQFNKMIRNLsdiqlkdldIREDLYDTvprarseishidcystilgkigCVRRCISAIskedtrdklqgniitvddlLPMIVFLVVKCALPNWIAHLTYMKQFHFSQSSNVCIDQDSFLITSLEASIEHIKSGLLIGPSEPEALMSYDDQEELANAkfkptvemsdlTTQLKVYNKYNNYKKISSLTKLFEFARLGDGDKVRAILQEenkkedseslplCHPLCSCDDCEEAINLKHsqskpttqsmddRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPKPLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNeanisnvnvregvrprniTEIKKVEQLFALIENNEIKLIKSYFGLSNEEKVPDNACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSLVRVLTheapfvlk
MFKTGDHKLNSSGMFIGVFSELQTGTMESTYDEDLSENIFFKALKTEHGELFEKATQDGWIICIPRVCSLPKYALTYEDFFNHILIPSEELPETHFRTLNDQEIRICNRIISIEADGGSTFSTQILFEETYYTDEMLKYKVLCIDNPLDINLENTNDASISNIQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTNDQFEYNPFDKQKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITACTALEDAQFNKMIRNLSDIQLKDLDIREDLYDTVPRARSEISHIDCYSTILGKIGCVRRCISAISKEDTRDKLQGNIITVDDLLPMIVFLVVKCALPNWIAHLTYMKQFHFSQSSNVCIDQDSFLITSLEASIEHIKSGLLIGPSEPEALMSYDDQEELANAKFKPTVEMSDLTTQLKVynkynnykkISSLTKLFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAINLKHSQSKPTTQSMDDRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPKPLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRNITEIKKVEQLFALIENNEIKLIKSYFGLSNEEKVPDNACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSLVRVLTHEAPFVLK
*************MFIGVFSELQTGTMESTYDEDLSENIFFKALKTEHGELFEKATQDGWIICIPRVCSLPKYALTYEDFFNHILIPSEELPETHFRTLNDQEIRICNRIISIEADGGSTFSTQILFEETYYTDEMLKYKVLCIDNPLDINLENTNDASISNIQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTNDQFEYNPFDKQKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITACTALEDAQFNKMIRNLSDIQLKDLDIREDLYDTVPRARSEISHIDCYSTILGKIGCVRRCISAISKEDTRDKLQGNIITVDDLLPMIVFLVVKCALPNWIAHLTYMKQFHFSQSSNVCIDQDSFLITSLEASIEHIKSGLLIG************************VEMSDLTTQLKVYNKYNNYKKISSLTKLFEFARLGDGDKVRAIL************PLCHPLCSCDDCEEAI****************RGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPKPLYNYLV**************************ANISNVNVREGVRPRNITEIKKVEQLFALIENNEIKLIKSYFGLSNEEKVPDNACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSLVRVLTHEAPF***
********LNSSGMFIGVFSELQTGTMESTYDEDLSENIFFKALKTEHGELFEKATQDGWIICIPRVCSLPKYALTYEDFFNHILIPSEELPETHFRTLNDQEIRICNRIISIEADGGSTFSTQILFEETYYTDEMLKYKVLCIDNPLDINLENTNDASISNIQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTNDQFEYNPFDKQKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITACTALEDAQFNKMIRNLSDIQLKDLDIREDLYDTVPRARSEISHIDCYSTILGKIGCVRRCISAISKEDTRDKLQGNIITVDDLLPMIVFLVVKCALPNWIAHLTYMKQFHFSQSSNVCIDQDSFLITSLEASIEHIKSGLLIGPSEPEALMSYDDQEELANAKFKPTVEMSDLTTQLKVYNKYNNYKKISSLTKLFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAINLKHSQSKPTTQSMDDRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPKPLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRNITEIKKVEQLFALIENNEIKLIKSYFGLSNEEKVPDNACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSLVRVLTHEAPFVL*
MFKTGDHKLNSSGMFIGVFSELQTGTMESTYDEDLSENIFFKALKTEHGELFEKATQDGWIICIPRVCSLPKYALTYEDFFNHILIPSEELPETHFRTLNDQEIRICNRIISIEADGGSTFSTQILFEETYYTDEMLKYKVLCIDNPLDINLENTNDASISNIQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTNDQFEYNPFDKQKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITACTALEDAQFNKMIRNLSDIQLKDLDIREDLYDTVPRARSEISHIDCYSTILGKIGCVRRCISAISKEDTRDKLQGNIITVDDLLPMIVFLVVKCALPNWIAHLTYMKQFHFSQSSNVCIDQDSFLITSLEASIEHIKSGLLIGPSEPEALMSYDDQEELANAKFKPTVEMSDLTTQLKVYNKYNNYKKISSLTKLFEFARLGDGDKVRAILQEE*********PLCHPLCSCDDCEEAINLKH*********MDDRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPKPLYNYLVPKE**********TQDKYLDYSDVNEANISNVNVREGVRPRNITEIKKVEQLFALIENNEIKLIKSYFGLSNEEKVPDNACHPLCQCAKCK**********VTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSLVRVLTHEAPFVLK
*******KLNSSGMFIGVFSELQTGTMESTYDEDLSENIFFKALKTEHGELFEKATQDGWIICIPRVCSLPKYALTYEDFFNHILIPSEELPETHFRTLNDQEIRICNRIISIEADGGSTFSTQILFEETYYTDEMLKYKVLCIDNPLDI*******ASISNIQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTNDQFEYNPFDKQKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITACTALEDAQFNKMIRNLSDIQLKDLDIREDLYDTVPRARSEISHIDCYSTILGKIGCVRRCISAISKEDTRDKLQGNIITVDDLLPMIVFLVVKCALPNWIAHLTYMKQFHFSQSSNVCIDQDSFLITSLEASIEHIKSGLLIGPSEPEALMSYDDQEELANAKFKPTVEMSDLTTQLKVYNKYNNYKKISSLTKLFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAINLKHSQSKPTTQSMDDRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPKPLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRNITEIKKVEQLFALIENNEIKLIKSYFGLSNEEKVPDNACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSLVRVLTHEAP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKTGDHKLNSSGMFIGVFSELQTGTMESTYDEDLSENIFFKALKTEHGELFEKATQDGWIICIPRVCSLPKYALTYEDFFNHILIPSEELPETHFRTLNDQEIRICNRIISIEADGGSTFSTQILFEETYYTDEMLKYKVLCIDNPLDINLENTNDASISNIQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTNDQFEYNPFDKQKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITACTALEDAQFNKMIRNLSDIQLKDLDIREDLYDTVPRARSEISHIDCYSTILGKIGCVRRCISAISKEDTRDKLQGNIITVDDLLPMIVFLVVKCALPNWIAHLTYMKQFHFSQSSNVCIDQDSFLITSLEASIEHIKSGLLIGPSEPEALMSYDDQEELANAKFKPTVEMSDLTTQLKVYNKYNNYKKISSLTKLFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAINLKHSQSKPTTQSMDDRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPKPLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRNITEIKKVEQLFALIENNEIKLIKSYFGLSNEEKVPDNACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSLVRVLTHEAPFVLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query936 2.2.26 [Sep-21-2011]
Q5REW9 1050 Ankyrin repeat domain-con yes N/A 0.887 0.791 0.327 1e-118
Q96NW4 1050 Ankyrin repeat domain-con yes N/A 0.886 0.790 0.329 1e-117
Q3UMR0 1048 Ankyrin repeat domain-con yes N/A 0.883 0.789 0.320 1e-114
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.479 0.238 0.300 2e-36
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.402 0.096 0.287 6e-34
Q02357 1862 Ankyrin-1 OS=Mus musculus no N/A 0.372 0.187 0.305 6e-34
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.410 0.195 0.267 1e-32
Q01484 3957 Ankyrin-2 OS=Homo sapiens no N/A 0.376 0.088 0.268 1e-32
Q12955 4377 Ankyrin-3 OS=Homo sapiens no N/A 0.452 0.096 0.275 2e-32
Q9ULJ7 1429 Ankyrin repeat domain-con no N/A 0.412 0.270 0.258 5e-26
>sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 Back     alignment and function desciption
 Score =  427 bits (1098), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 295/901 (32%), Positives = 472/901 (52%), Gaps = 70/901 (7%)

Query: 31  YDEDLSENIFFKALKTEHGELFEKATQDGWIICIPRVCSLPKYALTYEDFFNHILIPSEE 90
           YDEDL +N F+ AL+    +L  K  Q   I+ +P   SL     +   F ++ILIP EE
Sbjct: 4   YDEDLLKNPFYLALQKWRPDLCSKVAQIHGIVLVPCKGSLSSSIQSTCQFESYILIPVEE 63

Query: 91  LPETHFRTLNDQEIRICNRIISIEADGGSTFSTQILFEETYYTDEMLKYKVLCIDNPLDI 150
               HF+TLN +++ I    I + A      S  ILFEET+Y ++   + +LCI +PL+ 
Sbjct: 64  ----HFQTLNGKDVFIQGNRIKLGAGFTCLLSVPILFEETFYNEKEESFSILCIAHPLEK 119

Query: 151 NLENTNDASISN---IQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTNDQFEYNPFDK 207
              +    + S+   ++T+ D  + L   S      E+ D  I  F  T  + E      
Sbjct: 120 RESSEEPLAPSDPFSLKTIEDVREFLGRHS------ERFDRNIASFHRTFRECERKSLRH 173

Query: 208 QKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITACT 267
                  LY  CL   L+D+ L+  ++  +  ++ +K AVE Y+HH IY  + K +    
Sbjct: 174 HIDSANALYTKCLQQLLRDSHLKM-LAKQEAQMNLMKQAVEIYVHHEIYDLIFKYVGTME 232

Query: 268 ALEDAQFNKMIRNLSDIQLKDLDIREDLYDTVPRARSEISHIDCYSTILGKIGCVRRCIS 327
           A EDA FNK+ R+L D+Q KD+ ++ +    +PRA+ E++ ++  ++   K+ C+R+ + 
Sbjct: 233 ASEDAAFNKITRSLQDLQQKDIGVKPEFSFNIPRAKRELAQLNKCTSPQQKLVCLRKVVQ 292

Query: 328 AISKEDTRDKLQGNIITVDDLLPMIVFLVVKCALPNWIAHLTYMKQFHFSQSSNVCIDQD 387
            I++  ++ ++    +  DDLL ++++L+VK  +PNW+A+L+Y+K F FS S+    D+ 
Sbjct: 293 LITQSPSQ-RVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRFSSSAK---DEL 348

Query: 388 SFLITSLEASIEHIKSGLLIG-PSEPEALMSYDDQEELANAKFKPTVEMSDLTTQLKVYN 446
            + +TS EA+IE+I+ G L   P E E    + D+  L          MS L+       
Sbjct: 349 GYCLTSFEAAIEYIRQGSLSAKPPESEG---FGDRLFLKQ-------RMSLLS------- 391

Query: 447 KYNNYKKISSLTK-LFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAIN 505
                +  SS T  LF+    G+  +V  +L +E+  +D+    +CHPLC CDDCE+ ++
Sbjct: 392 -----QMTSSPTDCLFKHIASGNQKEVERLLSQEDHDKDAVQ-KMCHPLCFCDDCEKLVS 445

Query: 506 LK-HSQSKPTTQSMDDRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAAT 564
            + +  S  T  S DDRG T LHVAAL G+  ++DL++  GA  N+ D  G +PLH A  
Sbjct: 446 GRLNDPSVVTPFSRDDRGHTPLHVAALCGQASLIDLLVSKGAVVNATDYHGATPLHLACQ 505

Query: 565 RGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVN 624
           +G+Q+V LLLLH  AS  + DN GNT LHLA   GHE CVKAL+Y++   V +  ++  N
Sbjct: 506 KGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYD---VESCRLDIGN 562

Query: 625 NQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPK 684
            +GD+PLH AARWGY +II+ LL +GA+P ++N+ K TPL+ A N  +  ++ AY     
Sbjct: 563 EKGDTPLHIAARWGYQAIIETLLQNGASPEIQNRLKETPLKCALNSKILSVMEAY----- 617

Query: 685 PLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRNI-TEIKKVEQL 743
               +L  + +     +P  +  + +D      +  S  ++  G R      + ++VE+L
Sbjct: 618 ----HLSFERRQKSSEAPVQSLQRSVDSISQESSTSSFSSMSAGSRQEETKKDYREVEKL 673

Query: 744 FALIENNEIKLIKSYFGLSNEE---------KVPDNACHPLCQCAKCKEDVVESESRPVT 794
              + + ++++++     + E+          V    CHPLCQC KC          P +
Sbjct: 674 LRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAVDPEFCHPLCQCPKCAPAQKRLAKVPAS 733

Query: 795 DECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNL 854
              L +N+ + DG + L++A   G  DL+ LL+ + A+        Q  PLH+ACQ  + 
Sbjct: 734 G--LGVNVTSQDGSSPLYVAALHGRADLIPLLLKHGANAG-ARNADQAVPLHLACQQGHF 790

Query: 855 SIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHM 914
            +V+ LL +     N +D  GNT L YA    H  +  LLL+ GA     N+ G T LH 
Sbjct: 791 QVVKCLLDSN-AKPNKKDLSGNTPLIYACSGGHHEVVALLLQHGAAINTSNNKGNTALHE 849

Query: 915 A 915
           A
Sbjct: 850 A 850




May be a Rab21 guanine exchange factor and regulate endosome dynamics.
Pongo abelii (taxid: 9601)
>sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 Back     alignment and function description
>sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query936
345482552969 PREDICTED: ankyrin repeat domain-contain 0.913 0.882 0.389 0.0
218783306920 putative VPS9-ankyrin repeat-containing 0.929 0.945 0.375 1e-178
242014166885 ankyrin repeat-containing protein, putat 0.895 0.946 0.369 1e-160
332017619873 Ankyrin repeat domain-containing protein 0.899 0.964 0.350 1e-150
307195669875 Ankyrin repeat domain-containing protein 0.907 0.970 0.357 1e-150
322794489881 hypothetical protein SINV_01456 [Solenop 0.912 0.969 0.352 1e-145
307170759797 Ankyrin repeat domain-containing protein 0.822 0.966 0.361 1e-143
390351983 1079 PREDICTED: ankyrin repeat domain-contain 0.926 0.803 0.338 1e-138
91089471761 PREDICTED: similar to VPS9-ankyrin repea 0.800 0.984 0.341 1e-127
281339121 1050 hypothetical protein PANDA_004160 [Ailur 0.891 0.794 0.338 1e-120
>gi|345482552|ref|XP_001607835.2| PREDICTED: ankyrin repeat domain-containing protein 27-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/912 (38%), Positives = 542/912 (59%), Gaps = 57/912 (6%)

Query: 27  MESTYDEDLSENIFFKALKTEHGELFEKATQDGWIICIPRVCSLPKYALTYEDFFNHILI 86
           ME  YDEDLS+N FF+ L+ ++  +F +A  +GWIIC+PR  +  K ALT EDF  HILI
Sbjct: 70  MEFNYDEDLSQNSFFQTLQEDYQPIFNRAIGEGWIICVPRCGTFTKGALTKEDFLGHILI 129

Query: 87  PSEELPETHFRTLNDQEIRICNRIISIEADGGSTFSTQILFEETYYTDEMLKYKVLCIDN 146
           P++ELP THF TL D E+R+ NR ++IE +     S  +LFEET+YT++  KY V CI+ 
Sbjct: 130 PNDELPGTHFHTLTDTEVRLYNRALTIECEDSEPRSLHLLFEETFYTEDNNKYCVWCIEG 189

Query: 147 PLDINLENTNDASISNIQTLRDCIDLLWTESKGKEIFEKMDEAIKMFLLTNDQ-FEYNPF 205
            L+    ++ D  +  + +L++C+DLLW E   K + +++D AI+ F   + +  E    
Sbjct: 190 LLEQGTTSSRD-EVPVVSSLKECVDLLWAEVSDKSVLKELDAAIEEFERAHSKSLENECL 248

Query: 206 DKQKYLVEKLYQNCLNICLKDNKLRQSISINKYLIDSIKLAVETYMHHGIYKTLIKGITA 265
             Q+ LV  LY   L I LKDN LR+    ++Y + +IKL  ETY+ HG+ K L + ++ 
Sbjct: 249 QMQRDLVSMLYAKGLRILLKDNGLRERTLESRYFMQTIKLCAETYVLHGLRKILPQAVSF 308

Query: 266 CTALEDAQFNKMIRNLSDIQLKDLDIREDLYDTVPRARSEISHIDCYSTILGKIGCVRRC 325
           CTA EDA  NK+I+NL D+QL D  +R DLYD V RA+ E+S +D Y T+LGK  C++R 
Sbjct: 309 CTAAEDASLNKIIKNLHDLQLADFGVRPDLYDGVTRAKLELSRLDSYFTVLGKTSCLKRA 368

Query: 326 ISAISKEDTRDKLQGNIITVDDLLPMIVFLVVKCALPNWIAHLTYMKQFHFSQSSNVCID 385
              +S+ ++        ++ D+LLP+++FLVVK  L +W A LT+MKQF +S SS    D
Sbjct: 369 ARFVSQGESS-------VSSDELLPVLIFLVVKSGLASWCAQLTFMKQFRYSASSAYEAD 421

Query: 386 QDSFLITSLEASIEHIKSG-LLIGPSEPEALMSYDDQEELANAKFKPTVEMSDLTTQLKV 444
           +  FL+TSLEA++EH+KSG +   PSE + L   D Q  + +   K  +E SD    L  
Sbjct: 422 EAGFLVTSLEAAVEHVKSGSVRQAPSEAQ-LDKVDGQ--VKSTDEKNGLEESDSQGGL-- 476

Query: 445 YNKYNNYKKISSLTKLFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAI 504
                       + +LFE A+ G+  +V+ IL ++ +    E+  LCHPLC C+ CE ++
Sbjct: 477 ------------MGELFEHAKSGNLSEVQRILTDDAEGASKET-KLCHPLCLCESCERSL 523

Query: 505 NLKHSQSKPTTQ-SMDDRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAA 563
           +       P      DDRG   L +A ++G++ VVD +LE GAD N  D  G + LH AA
Sbjct: 524 SRSSDSELPAGLLWRDDRGQGCLQLACVHGQVTVVDYLLERGADPNDVDAEGVNCLHCAA 583

Query: 564 TRGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAV 623
            RGHQN LLLLLH+ A I+ TD  GN+ALH A ++GH+ CVKAL+YF E+  + LN++A 
Sbjct: 584 ARGHQNTLLLLLHANARIDATDARGNSALHFAADHGHDACVKALLYFAERGRVPLNVSAA 643

Query: 624 NNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHK- 682
           N QGD+PLH A++WGY+SI+++LL++GA+P+ +N+R  TP+  A++ H+A+L      + 
Sbjct: 644 NQQGDTPLHFASKWGYSSIVEILLEYGADPSYKNRRGQTPMTLAHSGHIARLFEGSSSRT 703

Query: 683 --PKPLYNYLVP-KEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRNITE-IK 738
             P     Y    KE ++         +   D       + ++   R G    ++TE + 
Sbjct: 704 STPTGSSGYGSGVKESIA---------EAVGDDHSAKSGSAASTPSRLGYHRSSLTEGMH 754

Query: 739 KVEQLFALIENNEIKLIKSYFGLSN-------EEKVPDNACHPLCQCAKC---KEDVVES 788
           K+++LFA +   +I+L   Y GL          E+     CHPLC C KC   +E   E 
Sbjct: 755 KIDRLFAAVAEGDIRLASYYLGLEGPCNKTYISEQDEPKFCHPLCNCEKCVSIEELSYEK 814

Query: 789 ESRPVTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIA 848
           E++P     + IN  NS G TALHIA+++G  +++++L++  A +N+VTR +  TPLH+A
Sbjct: 815 ETKPP----IAINAVNSSGETALHIASAVGCTEIIQVLLDAGAKVNLVTRSEGRTPLHLA 870

Query: 849 CQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYG 908
           C ++    V++LL+   CN +A+D   +T LH ++   +  +  +L++ GA P+I+N  G
Sbjct: 871 CMHDRTKTVKMLLSCGSCNPDAKDNARDTPLHLSSRAGNVRIVEMLVRHGANPRIRNLAG 930

Query: 909 QTCLHMAQQMTS 920
            T L   +++ S
Sbjct: 931 ATPLDEVERIKS 942




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|218783306|dbj|BAH03677.1| putative VPS9-ankyrin repeat-containing protein [Bombyx mori] Back     alignment and taxonomy information
>gi|242014166|ref|XP_002427766.1| ankyrin repeat-containing protein, putative [Pediculus humanus corporis] gi|212512220|gb|EEB15028.1| ankyrin repeat-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332017619|gb|EGI58316.1| Ankyrin repeat domain-containing protein 27 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307195669|gb|EFN77511.1| Ankyrin repeat domain-containing protein 27 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322794489|gb|EFZ17542.1| hypothetical protein SINV_01456 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307170759|gb|EFN62884.1| Ankyrin repeat domain-containing protein 27 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|390351983|ref|XP_003727786.1| PREDICTED: ankyrin repeat domain-containing protein 27 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|91089471|ref|XP_968843.1| PREDICTED: similar to VPS9-ankyrin repeat-containing protein [Tribolium castaneum] gi|270011402|gb|EFA07850.1| hypothetical protein TcasGA2_TC005420 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|281339121|gb|EFB14705.1| hypothetical protein PANDA_004160 [Ailuropoda melanoleuca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query936
UNIPROTKB|F1NGS0 981 ANKRD27 "Uncharacterized prote 0.476 0.454 0.371 2.7e-126
UNIPROTKB|F1RNY3 1056 ANKRD27 "Uncharacterized prote 0.467 0.414 0.368 7.7e-123
UNIPROTKB|F1N642 1048 ANKRD27 "Uncharacterized prote 0.517 0.461 0.348 1.4e-122
UNIPROTKB|Q96NW4 1050 ANKRD27 "Ankyrin repeat domain 0.467 0.417 0.361 2.6e-120
MGI|MGI:2444103 1048 Ankrd27 "ankyrin repeat domain 0.467 0.417 0.355 3.6e-115
UNIPROTKB|F1PYJ6 1044 ANKRD27 "Uncharacterized prote 0.392 0.351 0.324 1.9e-92
RGD|1307106377 Ankrd27 "ankyrin repeat domain 0.384 0.954 0.310 4e-45
UNIPROTKB|P16157 1881 ANK1 "Ankyrin-1" [Homo sapiens 0.487 0.242 0.306 1.6e-36
UNIPROTKB|F1PRD8 1857 ANK1 "Uncharacterized protein" 0.487 0.245 0.306 4.3e-36
UNIPROTKB|F1PRC8 1916 ANK1 "Uncharacterized protein" 0.487 0.237 0.306 4.5e-36
UNIPROTKB|F1NGS0 ANKRD27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 754 (270.5 bits), Expect = 2.7e-126, Sum P(2) = 2.7e-126
 Identities = 180/484 (37%), Positives = 268/484 (55%)

Query:   460 LFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAINLK-HSQSKPTTQSM 518
             LF+    G+ ++V  +L + +  +D+    +CHPLC CD CE+ ++ K +  S  T  S 
Sbjct:   410 LFKHIASGNQEEVERLLSQGDSDKDTVQ-KMCHPLCYCDKCEKLVSGKLNDPSIITPFSR 468

Query:   519 DDRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSG 578
             DDRG+T LH+AA+ G+  +VDL++  GA  N+ D  G +PLH A  +G+QNV LLLLH  
Sbjct:   469 DDRGYTPLHIAAICGQTSLVDLLVAKGAIVNATDYHGSTPLHLACQKGYQNVTLLLLHYK 528

Query:   579 ASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWG 638
             AS ++ DN GNT LHLA   GHE CVKAL+Y+   +V +  ++  N +GD+PLH AARWG
Sbjct:   529 ASTDVQDNNGNTPLHLACTYGHEDCVKALVYY---DVHSCRLDIGNEKGDTPLHIAARWG 585

Query:   639 YTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPKPLYNYLVPK--EKV 696
             Y  II++LL +GANP  +N+ K T LQ A N  +  L+           NYL  +  +  
Sbjct:   586 YQGIIEVLLQNGANPNTQNRMKETSLQCALNSKILSLMEL---------NYLTFERGQSA 636

Query:   697 SRPP--SPPPTQDKYLDYSDVNEANISNVNVREGVRPRNITEIKKVEQLFALIENNEIKL 754
             S  P  SP  + + +   S V+  + ++++ R+    +N    K+VE+L   + + ++++
Sbjct:   637 SESPLRSPQHSTETFSRGSSVSSLSSASIDTRQD-EAKN--SYKEVEKLLRAVADGDLEM 693

Query:   755 IKSYFGLSNE--EKVPDNA-------CHPLCQCAKCKEDVVESESRPVTDECLNINICNS 805
             ++     + E  E   D         CHPLCQC+KC     + +   V    L +N+ N 
Sbjct:   694 VRYLLEWTEEDLEDEDDTVSTSKPEFCHPLCQCSKCGP--AQKKFARVPANGLGVNVSNQ 751

Query:   806 DGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLA--A 863
             DG+T LH+A   GH DLV LL+ + A I+     +   PLH+ACQ  +  +V  L+   A
Sbjct:   752 DGFTPLHMAALHGHSDLVSLLLKHGASIS-AKNAEHAVPLHLACQKGHSQVVECLMDYNA 810

Query:   864 KQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSL 923
             KQ   N +D  GNT L YA +N H     LLL+ GA   + N  G T LH A    + +L
Sbjct:   811 KQ---NKKDAYGNTPLIYACLNGHYETTALLLQHGASVNLSNAKGNTALHEAVIGKNEAL 867

Query:   924 VRVL 927
             V +L
Sbjct:   868 VDLL 871


GO:0005085 "guanyl-nucleotide exchange factor activity" evidence=IEA
GO:0005764 "lysosome" evidence=IEA
GO:0005769 "early endosome" evidence=IEA
GO:0045022 "early endosome to late endosome transport" evidence=IEA
UNIPROTKB|F1RNY3 ANKRD27 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N642 ANKRD27 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96NW4 ANKRD27 "Ankyrin repeat domain-containing protein 27" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444103 Ankrd27 "ankyrin repeat domain 27 (VPS9 domain)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PYJ6 ANKRD27 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1307106 Ankrd27 "ankyrin repeat domain 27 (VPS9 domain)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P16157 ANK1 "Ankyrin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRD8 ANK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRC8 ANK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96NW4ANR27_HUMANNo assigned EC number0.32920.88670.7904yesN/A
Q3UMR0ANR27_MOUSENo assigned EC number0.32070.88350.7891yesN/A
Q5REW9ANR27_PONABNo assigned EC number0.32740.88780.7914yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query936
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-35
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-34
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-32
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-27
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-25
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-24
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-16
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-16
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-14
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-14
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-14
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-14
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 9e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-13
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-12
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-11
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-11
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-11
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-11
pfam02204104 pfam02204, VPS9, Vacuolar sorting protein 9 (VPS9) 6e-11
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 9e-11
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-10
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-10
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-10
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-10
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-10
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-10
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-10
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-10
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-09
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-09
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-09
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-09
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-09
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 7e-09
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-08
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 3e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-08
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-07
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-07
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-07
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-07
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 4e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-06
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-06
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-06
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-06
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-06
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 6e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-06
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 9e-06
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-05
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-05
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-05
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 7e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-05
smart0024830 smart00248, ANK, ankyrin repeats 9e-05
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 4e-04
PHA02741169 PHA02741, PHA02741, hypothetical protein; Provisio 4e-04
smart00167117 smart00167, VPS9, Domain present in VPS9 5e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 6e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-04
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 8e-04
smart0024830 smart00248, ANK, ankyrin repeats 9e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.001
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.001
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 0.001
smart0024830 smart00248, ANK, ankyrin repeats 0.002
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.003
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 0.003
PHA02791284 PHA02791, PHA02791, ankyrin-like protein; Provisio 0.003
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.004
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  129 bits (325), Expect = 5e-35
 Identities = 54/127 (42%), Positives = 79/127 (62%), Gaps = 2/127 (1%)

Query: 801 NICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLL 860
           N  + DG T LH+A S GH ++V+LL+   AD+N      + TPLH+A +N +L IV+LL
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGR-TPLHLAAKNGHLEIVKLL 59

Query: 861 LAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTS 920
           L     +VNA+D  GNT LH AA N + ++  LLLK GA    ++  G+T LH+A +   
Sbjct: 60  LEKG-ADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGH 118

Query: 921 LSLVRVL 927
           L +V++L
Sbjct: 119 LEVVKLL 125


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|216928 pfam02204, VPS9, Vacuolar sorting protein 9 (VPS9) domain Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165108 PHA02741, PHA02741, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|128469 smart00167, VPS9, Domain present in VPS9 Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165154 PHA02791, PHA02791, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 936
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
KOG4177|consensus 1143 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
KOG4177|consensus 1143 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
KOG0508|consensus 615 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 100.0
KOG0508|consensus615 99.98
KOG0509|consensus 600 99.96
PHA02792 631 ankyrin-like protein; Provisional 99.96
KOG0509|consensus 600 99.95
PHA02795 437 ankyrin-like protein; Provisional 99.95
PHA02795 437 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.94
KOG4369|consensus 2131 99.94
KOG0502|consensus296 99.93
smart00167117 VPS9 Domain present in VPS9. Domain present in yea 99.93
PHA02859209 ankyrin repeat protein; Provisional 99.93
KOG0507|consensus 854 99.92
KOG0507|consensus 854 99.91
KOG4369|consensus 2131 99.91
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.9
KOG0502|consensus296 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.9
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.87
PLN03192823 Voltage-dependent potassium channel; Provisional 99.87
KOG0505|consensus 527 99.87
KOG0514|consensus452 99.85
PHA02743166 Viral ankyrin protein; Provisional 99.85
KOG0505|consensus 527 99.84
PHA02741169 hypothetical protein; Provisional 99.83
PF02204104 VPS9: Vacuolar sorting protein 9 (VPS9) domain; In 99.82
KOG0512|consensus228 99.81
KOG0514|consensus452 99.8
PHA02884 300 ankyrin repeat protein; Provisional 99.79
PHA02736154 Viral ankyrin protein; Provisional 99.79
PHA02743166 Viral ankyrin protein; Provisional 99.79
PHA02741169 hypothetical protein; Provisional 99.78
KOG0195|consensus 448 99.77
PHA02884 300 ankyrin repeat protein; Provisional 99.76
PHA02736154 Viral ankyrin protein; Provisional 99.76
KOG0512|consensus228 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.67
KOG3676|consensus 782 99.67
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.64
KOG0195|consensus448 99.62
KOG3676|consensus 782 99.58
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.57
KOG4214|consensus117 99.54
KOG4214|consensus117 99.47
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.47
KOG1710|consensus 396 99.41
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.39
KOG1710|consensus396 99.34
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.33
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.32
KOG0515|consensus752 99.31
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.31
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.29
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.26
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.25
KOG0515|consensus752 99.24
KOG2320|consensus651 98.82
KOG0506|consensus622 98.7
KOG0782|consensus1004 98.69
KOG0783|consensus 1267 98.68
PF1360630 Ank_3: Ankyrin repeat 98.66
KOG0506|consensus622 98.64
KOG0818|consensus 669 98.61
KOG0818|consensus 669 98.58
KOG0783|consensus 1267 98.58
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.54
KOG0782|consensus1004 98.52
KOG0705|consensus749 98.47
KOG0705|consensus749 98.39
PF1360630 Ank_3: Ankyrin repeat 98.38
KOG2319|consensus477 98.32
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.31
KOG2384|consensus 223 98.3
KOG0522|consensus 560 98.28
KOG3609|consensus 822 98.22
KOG0521|consensus785 98.2
KOG0522|consensus 560 98.06
KOG3609|consensus 822 97.94
KOG2319|consensus477 97.93
KOG0511|consensus516 97.92
KOG2384|consensus 223 97.92
KOG0520|consensus 975 97.88
KOG0511|consensus 516 97.76
KOG0521|consensus785 97.72
KOG0520|consensus975 97.67
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.26
KOG2505|consensus591 96.19
KOG2505|consensus591 95.93
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.34
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.33
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.02
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.77
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 92.01
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.63
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 85.92
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.6e-44  Score=432.03  Aligned_cols=419  Identities=24%  Similarity=0.274  Sum_probs=337.3

Q ss_pred             CCChHHHHHHHHCCCHHHHHHHHHhcccCccCCCCCcccccccCCchhhHH-----------------------------
Q psy8454         454 ISSLTKLFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAI-----------------------------  504 (936)
Q Consensus       454 ~~~~~~L~~A~~~G~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----------------------------  504 (936)
                      ..+.|+||.|+..|+.|+|+.|++..+......+..+.+|+..+.......                             
T Consensus        39 ~~~~t~LH~A~~~g~~e~V~~ll~~~~~~~~~~~~~~~tpLh~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~  118 (682)
T PHA02876         39 SIPFTAIHQALQLRQIDIVEEIIQQNPELIYITDHKCHSTLHTICIIPNVMDIVISLTLDCDIILDIKYASIILNKHKLD  118 (682)
T ss_pred             cccchHHHHHHHHHhhhHHHHHHHhCcccchhhchhhccccccccCCCCccccccccccchhhcccccHHHHHHHHHHHH
Confidence            357889999999999999999999987743333444555555333110000                             


Q ss_pred             ---Hhhhc--cCCCCcc----cCCCCCCcHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCcHHHHHHHhCcHHHHHHHH
Q psy8454         505 ---NLKHS--QSKPTTQ----SMDDRGFTVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLL  575 (936)
Q Consensus       505 ---~~~~~--~~~~~~~----~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll  575 (936)
                         ...+.  .......    .......++++.|+..|+.+++++|++.|+++|.+|..|.||||+|+..|+.++|++|+
T Consensus       119 ~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~~Gadvn~~d~~G~TpLh~Aa~~G~~~iv~~LL  198 (682)
T PHA02876        119 EACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLEGGADVNAKDIYCITPIHYAAERGNAKMVNLLL  198 (682)
T ss_pred             HHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHH
Confidence               00000  0000000    11234567899999999999999999999999999999999999999999999999999


Q ss_pred             hCCCCCCcCCCCCCcHHHHHHHcCcHHHHHHHHhcccccccccCcccccCCCChHHHHHHHhCCHHHHHHHHHCCCCCCC
Q psy8454         576 HSGASINLTDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTL  655 (936)
Q Consensus       576 ~~g~~~~~~d~~g~t~L~~A~~~g~~eiv~~Ll~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~  655 (936)
                      +.|++++..+..|.||||+|+..|+.+++++|++.+.      ++    ..+.++|+.|+..++.+++++|++.|++++.
T Consensus       199 ~~Gad~n~~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~------~~----~~~~~~L~~ai~~~~~~~~~~Ll~~g~~vn~  268 (682)
T PHA02876        199 SYGADVNIIALDDLSVLECAVDSKNIDTIKAIIDNRS------NI----NKNDLSLLKAIRNEDLETSLLLYDAGFSVNS  268 (682)
T ss_pred             HCCCCcCccCCCCCCHHHHHHHcCCHHHHHHHHhcCC------CC----CCCcHHHHHHHHcCCHHHHHHHHHCCCCCCC
Confidence            9999999999999999999999999999999998652      22    2356799999999999999999999999999


Q ss_pred             cccCCCChhhhhhchhHH-HHHHHhhcCCCccccccCCCCCCCCCCCCCCCCcccccccccccccccccccccCCCCcch
Q psy8454         656 ENKRKVTPLQNANNLHVA-KLLNAYVHKPKPLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRNI  734 (936)
Q Consensus       656 ~d~~g~t~l~~a~~~~~~-~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  734 (936)
                      .+..|.||||+|+..+.. +++..+...+...                                              ..
T Consensus       269 ~d~~g~TpLh~Aa~~~~~~~iv~lLl~~gadi----------------------------------------------n~  302 (682)
T PHA02876        269 IDDCKNTPLHHASQAPSLSRLVPKLLERGADV----------------------------------------------NA  302 (682)
T ss_pred             CCCCCCCHHHHHHhCCCHHHHHHHHHHCCCCC----------------------------------------------CC
Confidence            999999999999976654 3444444222111                                              11


Q ss_pred             hhhhhHHHHHHHHHcC-cHHHHHHHhcCCcCCCCCC-CCCcccchhcccchhhhhccCccccccCCCcccCCCCCCcHHH
Q psy8454         735 TEIKKVEQLFALIENN-EIKLIKSYFGLSNEEKVPD-NACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALH  812 (936)
Q Consensus       735 ~~~~~~~~l~~ai~~g-~~~~vk~Ll~~~~~~~~~~-~~~~~l~~~~~~~~~~~~~~~~~l~~~~~d~n~~d~~g~t~L~  812 (936)
                      .+..+.+||+.|+..| ..++++.|+..+.+.+..+ .+.+|++.+.....  .......+++.|+++|.+|..|.||||
T Consensus       303 ~d~~g~TpLh~Aa~~g~~~~~v~~Ll~~gadin~~d~~g~TpLh~A~~~~~--~~~iv~lLl~~gadin~~d~~G~TpLh  380 (682)
T PHA02876        303 KNIKGETPLYLMAKNGYDTENIRTLIMLGADVNAADRLYITPLHQASTLDR--NKDIVITLLELGANVNARDYCDKTPIH  380 (682)
T ss_pred             cCCCCCCHHHHHHHhCCCHHHHHHHHHcCCCCCCcccCCCcHHHHHHHhCC--cHHHHHHHHHcCCCCccCCCCCCCHHH
Confidence            2234567999999998 6999999999998876544 45567776554322  122345678899999999999999999


Q ss_pred             HHHHcCCHHHHHHHHhCCCCcccccccCCCcHHHHHHhCCC-HHHHHHHHhcCCCCCCCCCCCCCcHHHHHHHcC-CHHH
Q psy8454         813 IATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNN-LSIVRLLLAAKQCNVNAQDYRGNTALHYAAINN-HTNL  890 (936)
Q Consensus       813 ~Aa~~g~~~~v~~LL~~g~~v~~~~~~~g~TpLh~A~~~g~-~~iv~~LL~~g~~dvn~~d~~g~TpL~~A~~~g-~~~i  890 (936)
                      +|+..|+.+++++|+++|++++..+ ..|.||||+|+..++ ..++++|++.| +++|.+|..|+||||+|++.| +.++
T Consensus       381 ~Aa~~~~~~iv~~Ll~~gad~~~~~-~~g~T~Lh~A~~~~~~~~~vk~Ll~~g-adin~~d~~G~TpLh~Aa~~~~~~~i  458 (682)
T PHA02876        381 YAAVRNNVVIINTLLDYGADIEALS-QKIGTALHFALCGTNPYMSVKTLIDRG-ANVNSKNKDLSTPLHYACKKNCKLDV  458 (682)
T ss_pred             HHHHcCCHHHHHHHHHCCCCccccC-CCCCchHHHHHHcCCHHHHHHHHHhCC-CCCCcCCCCCChHHHHHHHhCCcHHH
Confidence            9999999999999999999999998 789999999987665 56799999998 999999999999999999977 7899


Q ss_pred             HHHHHHcCCCCcCcccCCCcHHHHHHHcCCHHHHHHHhhhCCCc
Q psy8454         891 ATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSLVRVLTHEAPFV  934 (936)
Q Consensus       891 v~~LL~~Ga~~~~~d~~g~T~L~~A~~~g~~~iv~~Ll~~~~~~  934 (936)
                      +++|+++||+++.+|..|.||+++|+.++  .+++.|+..++..
T Consensus       459 v~lLl~~Gad~n~~d~~g~tpl~~a~~~~--~~v~~Ll~~~a~~  500 (682)
T PHA02876        459 IEMLLDNGADVNAINIQNQYPLLIALEYH--GIVNILLHYGAEL  500 (682)
T ss_pred             HHHHHHCCCCCCCCCCCCCCHHHHHHHhC--CHHHHHHHCCCCC
Confidence            99999999999999999999999999876  5799998887753



>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>smart00167 VPS9 Domain present in VPS9 Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PF02204 VPS9: Vacuolar sorting protein 9 (VPS9) domain; InterPro: IPR003123 This domain is present in yeast vacuolar sorting protein 9 and other proteins Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG2320|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG2319|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2319|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query936
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-34
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-10
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 9e-24
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 7e-18
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-21
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-20
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-20
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-16
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-20
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 8e-17
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-20
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-16
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-19
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-15
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 6e-19
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-14
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-19
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-11
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 8e-19
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-14
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-18
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-15
1uoh_A226 Human Gankyrin Length = 226 1e-18
1uoh_A226 Human Gankyrin Length = 226 6e-15
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-18
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 6e-15
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-18
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 5e-12
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-18
2xeh_A157 Structural Determinants For Improved Thermal Stabil 8e-16
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-18
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 6e-18
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-14
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-18
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-15
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-17
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-16
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-12
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-17
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 3e-15
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-17
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 8e-16
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-17
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-15
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-17
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-12
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-17
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 5e-16
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-13
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 4e-17
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-12
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-17
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-13
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 7e-17
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 7e-17
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 8e-13
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 7e-17
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 3e-15
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 9e-17
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-15
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-13
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-12
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 9e-17
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-10
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-08
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-16
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 9e-14
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-16
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-13
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 7e-16
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-09
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 9e-16
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 4e-12
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-15
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 3e-09
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-15
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 3e-09
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 5e-09
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-15
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-11
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 5e-10
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-14
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 5e-09
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-14
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 6e-09
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 2e-13
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 7e-13
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 3e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-12
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-06
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-04
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-12
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 4e-06
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-06
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-12
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-09
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-12
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-08
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 4e-12
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 7e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 4e-12
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-11
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 5e-12
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-08
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-08
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 6e-12
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 7e-05
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 1e-11
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 1e-04
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-11
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-11
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 7e-10
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 1e-11
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-04
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-11
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 4e-11
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 6e-11
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 3e-10
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 8e-07
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 9e-11
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-10
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 6e-09
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 3e-10
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 5e-05
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 4e-10
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 1e-07
3uxg_A172 Crystal Structure Of Rfxank Length = 172 5e-10
3uxg_A172 Crystal Structure Of Rfxank Length = 172 2e-07
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 5e-10
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 1e-07
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 2e-05
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 5e-10
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 5e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 6e-10
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 8e-10
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 3e-07
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 8e-10
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 2e-05
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 9e-10
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-08
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 1e-09
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 4e-07
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 1e-09
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 4e-07
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 1e-09
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 4e-07
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 6e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 1e-09
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 2e-06
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-09
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 4e-09
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 4e-09
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 4e-09
3so8_A162 Crystal Structure Of Ankra Length = 162 5e-09
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 7e-09
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 7e-09
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-08
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 2e-08
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 3e-08
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 3e-08
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 4e-08
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 4e-08
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 4e-08
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 7e-08
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-05
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 8e-07
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-06
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-05
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 4e-06
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 4e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 4e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 5e-05
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 5e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 8e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 4e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-04
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 8e-06
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 2e-05
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 3e-05
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 3e-05
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 5e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 5e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 8e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 4e-04
1ycs_B239 P53-53bp2 Complex Length = 239 5e-05
1ycs_B239 P53-53bp2 Complex Length = 239 7e-05
1ycs_B239 P53-53bp2 Complex Length = 239 4e-04
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 7e-05
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 1e-04
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 2e-04
2rfa_A 232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 6e-04
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 2e-04
3deo_A183 Structural Basis For Specific Substrate Recognition 2e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 144 bits (362), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 130/421 (30%), Positives = 200/421 (47%), Gaps = 71/421 (16%) Query: 524 TVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINL 583 T LH+AA G +V +L+ A N++ +PLH AA GH N++ LLL + A+ NL Sbjct: 49 TPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNL 108 Query: 584 TDNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSII 643 G+T LH+A GH V AL+ E+E + + +G +PLH AA++G + Sbjct: 109 ATTAGHTPLHIAAREGHVETVLALL---EKEA---SQACMTKKGFTPLHVAAKYGKVRVA 162 Query: 644 QLLLDHGANPTLENKRKVTPLQNA---NNLHVAKLLNAYVHKPKPLYNYLVPKEKVSRPP 700 +LLL+ A+P K +TPL A NNL + KL L+P+ P Sbjct: 163 ELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKL--------------LLPRG--GSPH 206 Query: 701 SPPPTQDKYLDYSDVNEANISNVNVREGVRPRNITEIKKVEQLFALIENNEIKLIKS--- 757 SP G P +I + N++++ +S Sbjct: 207 SP----------------------AWNGYTPLHIAA-----------KQNQVEVARSLLQ 233 Query: 758 YFGLSNEEKVPDNACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALHIATSL 817 Y G +N E V PL A +E E + ++ + N N+ N G T LH+ Sbjct: 234 YGGSANAESV--QGVTPLHLAA--QEGHAEMVALLLSKQA-NGNLGNKSGLTPLHLVAQE 288 Query: 818 GHYDLVRLLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNT 877 GH + +LI + ++ TR+ TPLH+A N+ +V+ LL Q +VNA+ G + Sbjct: 289 GHVPVADVLIKHGVMVDATTRMG-YTPLHVASHYGNIKLVKFLL-QHQADVNAKTKLGYS 346 Query: 878 ALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLS---LVRVLTHEAPFV 934 LH AA HT++ TLLLK+GA P + G T L +A+++ +S +++V+T E FV Sbjct: 347 PLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFV 406 Query: 935 L 935 L Sbjct: 407 L 407
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query936
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-49
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-36
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-35
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-34
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-34
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-30
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-27
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-27
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-27
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-20
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-44
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-40
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-39
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-31
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-44
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-41
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-38
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-33
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-31
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-43
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-43
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-42
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-42
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-38
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-38
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-37
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-36
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-36
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-35
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-34
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-32
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-32
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-43
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-43
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-38
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-36
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-35
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-34
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-30
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-29
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 6e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-43
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-42
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-41
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-34
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-34
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-34
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-32
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-31
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-26
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-26
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-43
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-42
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-38
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-34
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-31
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-42
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-42
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-40
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-33
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-33
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-30
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-30
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-27
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-26
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-23
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-20
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-08
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-42
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-42
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-41
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-40
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-37
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-34
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-34
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-33
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-33
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-25
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-42
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-41
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-37
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 7e-36
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-35
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-34
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-31
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-30
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-42
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-38
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-38
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-37
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-36
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-32
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-27
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-20
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-42
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-38
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-34
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-32
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-31
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-30
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-30
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-25
3hra_A 201 Ankyrin repeat family protein; structural protein; 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-42
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-36
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-35
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-34
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-34
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-34
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-27
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-21
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-20
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-41
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-40
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-36
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-36
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-35
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-33
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-30
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 9e-25
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-41
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-35
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-33
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-33
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-33
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-05
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-41
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-35
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-33
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-33
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-28
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-22
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-41
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-36
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-34
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-32
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-30
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-40
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-39
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-37
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-37
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-35
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-30
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-27
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-24
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-40
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-39
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-37
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-35
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-35
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-32
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-31
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-30
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-26
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-25
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-40
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-36
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-35
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-31
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-29
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-40
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-35
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-34
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-31
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-28
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-39
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-33
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-32
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-30
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-29
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-39
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-36
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-36
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-34
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-32
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-32
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-31
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-30
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-30
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-30
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-30
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-27
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-25
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-39
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-37
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-36
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-35
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-34
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-29
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-24
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-22
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-39
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-35
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-34
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-39
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-37
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-35
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-31
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-39
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-35
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-33
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-32
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-16
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-38
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-37
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-35
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-33
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-33
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-29
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-26
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-26
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-21
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-38
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-37
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-37
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-37
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-36
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-34
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-33
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-31
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-29
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-28
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-38
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-38
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-31
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-31
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-29
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-26
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-38
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-35
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-33
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-31
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-31
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-28
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-17
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-07
3deo_A 183 Signal recognition particle 43 kDa protein; chloro 2e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-38
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-34
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-32
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-31
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-26
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-13
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-37
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-36
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 5e-32
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-31
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-30
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-29
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-29
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-28
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-26
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-23
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 8e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-37
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-36
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-32
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-26
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-12
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 2e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-36
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-35
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-34
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-30
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-30
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-27
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-24
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-24
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-23
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-22
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-34
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-31
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-30
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-28
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-25
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-24
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-22
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-22
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-34
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-32
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-31
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-27
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 9e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-34
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-31
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-30
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-23
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-21
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-33
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-29
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-27
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-22
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-32
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-21
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-08
2rfa_A232 Transient receptor potential cation channel subfa 2e-32
2rfa_A232 Transient receptor potential cation channel subfa 5e-32
2rfa_A232 Transient receptor potential cation channel subfa 4e-31
2rfa_A232 Transient receptor potential cation channel subfa 2e-29
2rfa_A232 Transient receptor potential cation channel subfa 2e-29
2rfa_A232 Transient receptor potential cation channel subfa 3e-27
2rfa_A232 Transient receptor potential cation channel subfa 2e-25
2rfa_A232 Transient receptor potential cation channel subfa 6e-22
2rfa_A232 Transient receptor potential cation channel subfa 6e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-32
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-31
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-29
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-28
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-24
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-32
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-32
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-30
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-29
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-28
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-28
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-24
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-23
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-20
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-08
2etb_A256 Transient receptor potential cation channel subfam 3e-30
2etb_A256 Transient receptor potential cation channel subfam 6e-29
2etb_A256 Transient receptor potential cation channel subfam 6e-25
2etb_A256 Transient receptor potential cation channel subfam 1e-21
2etb_A256 Transient receptor potential cation channel subfam 6e-19
2etb_A256 Transient receptor potential cation channel subfam 2e-16
2etb_A256 Transient receptor potential cation channel subfam 2e-05
2pnn_A273 Transient receptor potential cation channel subfa 4e-30
2pnn_A273 Transient receptor potential cation channel subfa 2e-27
2pnn_A273 Transient receptor potential cation channel subfa 3e-24
2pnn_A273 Transient receptor potential cation channel subfa 3e-21
2pnn_A273 Transient receptor potential cation channel subfa 1e-19
2pnn_A273 Transient receptor potential cation channel subfa 2e-19
2pnn_A273 Transient receptor potential cation channel subfa 3e-19
2pnn_A273 Transient receptor potential cation channel subfa 2e-17
2pnn_A273 Transient receptor potential cation channel subfa 2e-12
2pnn_A273 Transient receptor potential cation channel subfa 9e-09
2efe_A267 Similarity to vacuolar protein sorting-associated 1e-29
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-29
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-28
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-27
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-23
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-19
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-06
2ot3_A274 RAB5 GDP/GTP exchange factor; rabex-5, VPS9 domain 2e-28
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-28
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-26
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-26
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-19
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-18
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-16
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-27
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-25
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-24
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-22
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-22
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-26
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-25
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-21
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-21
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-20
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-16
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 5e-15
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-18
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-16
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-17
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-17
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-16
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-16
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-12
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-11
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-15
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-14
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-10
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
 Score =  173 bits (442), Expect = 8e-49
 Identities = 61/316 (19%), Positives = 97/316 (30%), Gaps = 68/316 (21%)

Query: 620 INAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTL---ENKRKVTPLQNA---NNLHVA 673
              V   GD+ LH A    +   +  LL   A       +N    T L  A         
Sbjct: 2   FGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTV 61

Query: 674 K-LLNAYVHKPKPLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRP- 731
           + L  A                                    V  A       R G    
Sbjct: 62  EKLYAAGA---------------------------------GVLVAE------RGGHTAL 82

Query: 732 -----RNITEIKKVEQLFALIEN--NEIKLIKSYFGLSNEEKVPDNACHPLCQCAK--CK 782
                        V     L++   +  +     +   +++  PD +  P    ++   +
Sbjct: 83  HLACRVRAHTCACV-----LLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPE 137

Query: 783 EDVVES-ESRPVTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQ 841
            +     E   +      +   N DG+T LH+A      ++VRLL +  AD+N       
Sbjct: 138 NEEEPRDEDWRL-----QLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCG 192

Query: 842 LTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARP 901
            TPLH+A +    S++ LLL A   +  A+ Y G T L  A +  +  LA LL   GA  
Sbjct: 193 RTPLHLAVEAQAASVLELLLKAG-ADPTARMYGGRTPLGSALLRPNPILARLLRAHGAPE 251

Query: 902 QIKNHYGQTCLHMAQQ 917
                   +    +  
Sbjct: 252 PEDGGDKLSPCSSSGS 267


>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2efe_A Similarity to vacuolar protein sorting-associated VPS9; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_A 2efc_A* 2efh_A* Length = 267 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2ot3_A RAB5 GDP/GTP exchange factor; rabex-5, VPS9 domain, vesicular traffic, protein transport; 2.10A {Homo sapiens} SCOP: a.222.1.1 PDB: 1txu_A Length = 274 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query936
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2ot3_A274 RAB5 GDP/GTP exchange factor; rabex-5, VPS9 domain 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2efe_A267 Similarity to vacuolar protein sorting-associated 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.98
2rfa_A232 Transient receptor potential cation channel subfa 99.98
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.91
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.87
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.84
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.81
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.81
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.81
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.8
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.8
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.79
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.79
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.77
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.75
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.71
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.69
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=2.1e-53  Score=489.04  Aligned_cols=389  Identities=29%  Similarity=0.385  Sum_probs=344.3

Q ss_pred             ccCCChHHHHHHHHCCCHHHHHHHHHhcccCccCCCCCcccccccCCchhhHHHhhhccCCCCcccCCCCCCcHHHHHHH
Q psy8454         452 KKISSLTKLFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAINLKHSQSKPTTQSMDDRGFTVLHVAAL  531 (936)
Q Consensus       452 ~~~~~~~~L~~A~~~G~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~  531 (936)
                      .+..+.|+|+.|+..|++++|++|++.+.+.+.                                 ++..|.||||+|+.
T Consensus        10 ~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~---------------------------------~~~~~~t~L~~A~~   56 (437)
T 1n11_A           10 GGESGLTPLHVASFMGHLPIVKNLLQRGASPNV---------------------------------SNVKVETPLHMAAR   56 (437)
T ss_dssp             -----CCHHHHHHHHTCHHHHHHHHHTTCCSCC---------------------------------SSSCCCCHHHHHHH
T ss_pred             cCCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCC---------------------------------CCCCCCCHHHHHHH
Confidence            456788999999999999999999999865432                                 56789999999999


Q ss_pred             cCCHHHHHHHHhcCCCCCCCCCCCCcHHHHHHHhCcHHHHHHHHhCCCCCCcCCCCCCcHHHHHHHcCcHHHHHHHHhcc
Q psy8454         532 YGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINLTDNEGNTALHLATNNGHETCVKALIYFN  611 (936)
Q Consensus       532 ~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~d~~g~t~L~~A~~~g~~eiv~~Ll~~~  611 (936)
                      .|+.+++++|+++|++++.++..|.||||+|+..|+.+++++|+++|++++..+..|.||||+|+..|+.+++++|++.+
T Consensus        57 ~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~  136 (437)
T 1n11_A           57 AGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKE  136 (437)
T ss_dssp             HTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTT
T ss_pred             cCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999865


Q ss_pred             cccccccCcccccCCCChHHHHHHHhCCHHHHHHHHHCCCCCCCcccCCCChhhhhhchhHHHHHHHhhcCCCccccccC
Q psy8454         612 EQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNANNLHVAKLLNAYVHKPKPLYNYLV  691 (936)
Q Consensus       612 ~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~d~~g~t~l~~a~~~~~~~ll~~~~~~~~~~~~~~~  691 (936)
                            .+.+..+..|.||||+|++.|+.+++++|+++|++++..+..|.|||++|+..+..++++.++..+....    
T Consensus       137 ------~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~----  206 (437)
T 1n11_A          137 ------ASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPH----  206 (437)
T ss_dssp             ------CCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSC----
T ss_pred             ------CCCcCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCC----
Confidence                  4567788899999999999999999999999999999999999999999999999999988874332210    


Q ss_pred             CCCCCCCCCCCCCCCcccccccccccccccccccccCCCCcchhhhhhHHHHHHHHHcCcHHHHHHHhcCCcCCCCCC-C
Q psy8454         692 PKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRNITEIKKVEQLFALIENNEIKLIKSYFGLSNEEKVPD-N  770 (936)
Q Consensus       692 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ai~~g~~~~vk~Ll~~~~~~~~~~-~  770 (936)
                                                                .....+.++|+.|+..|+.+++++|++.+.+.+... .
T Consensus       207 ------------------------------------------~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~  244 (437)
T 1n11_A          207 ------------------------------------------SPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQ  244 (437)
T ss_dssp             ------------------------------------------CCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTT
T ss_pred             ------------------------------------------CcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCC
Confidence                                                      111234568999999999999999999988776543 4


Q ss_pred             CCcccchhcccchhhhhccCccccccCCCcccCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCcccccccCCCcHHHHHHh
Q psy8454         771 ACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQ  850 (936)
Q Consensus       771 ~~~~l~~~~~~~~~~~~~~~~~l~~~~~d~n~~d~~g~t~L~~Aa~~g~~~~v~~LL~~g~~v~~~~~~~g~TpLh~A~~  850 (936)
                      ..+|++.+......   .+.+++++.|++++..+..|.||||+|+..|+.+++++|+++|++++..+ ..|.||||+|+.
T Consensus       245 g~t~L~~A~~~g~~---~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~-~~g~t~L~~A~~  320 (437)
T 1n11_A          245 GVTPLHLAAQEGHA---EMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATT-RMGYTPLHVASH  320 (437)
T ss_dssp             CCCHHHHHHHTTCH---HHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCC-SSCCCHHHHHHH
T ss_pred             CCCHHHHHHHCCCH---HHHHHHHhcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCCCC-CCCCCHHHHHHH
Confidence            56677766544332   23456788999999999999999999999999999999999999999998 899999999999


Q ss_pred             CCCHHHHHHHHhcCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCcCcccCCCcHHHHHHHcCCHHHHHHHhhh
Q psy8454         851 NNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCLHMAQQMTSLSLVRVLTHE  930 (936)
Q Consensus       851 ~g~~~iv~~LL~~g~~dvn~~d~~g~TpL~~A~~~g~~~iv~~LL~~Ga~~~~~d~~g~T~L~~A~~~g~~~iv~~Ll~~  930 (936)
                      .|+.++|++|+++| +++|.+|..|+||||+|+++|+.++|++|+++||+++.+|..|+||+++|++.|+.+++++|...
T Consensus       321 ~g~~~~v~~Ll~~g-ad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~g~~~~~~~l~~~  399 (437)
T 1n11_A          321 YGNIKLVKFLLQHQ-ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVV  399 (437)
T ss_dssp             SSCSHHHHHHHHTT-CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHHHH
T ss_pred             cCcHHHHHHHHhcC-CCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCcHHHHHHHHhc
Confidence            99999999999998 99999999999999999999999999999999999999999999999999999999999999643



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2ot3_A RAB5 GDP/GTP exchange factor; rabex-5, VPS9 domain, vesicular traffic, protein transport; 2.10A {Homo sapiens} SCOP: a.222.1.1 PDB: 1txu_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2efe_A Similarity to vacuolar protein sorting-associated VPS9; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_A 2efc_A* 2efh_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 936
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-54
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-25
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-24
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-20
d2ot3a1249 a.222.1.1 (A:139-387) Rab5 GDP/GTP exchange factor 3e-29
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-23
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-13
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-12
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-24
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-19
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-11
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-24
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-17
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-15
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-15
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-10
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-08
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-07
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-24
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-18
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-17
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-15
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-14
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-13
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-23
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-13
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-23
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-20
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-18
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-12
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-21
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-19
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-14
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-13
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-09
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-17
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-13
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-13
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-13
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-09
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-11
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-08
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-06
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-10
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-11
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-11
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 6e-11
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-08
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 4e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-09
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 8e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.004
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-08
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 6e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  193 bits (490), Expect = 1e-54
 Identities = 111/435 (25%), Positives = 173/435 (39%), Gaps = 85/435 (19%)

Query: 524 TVLHVAALYGRIKVVDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASINL 583
           T LHVA+  G + +V  +L+ GA  N  ++   +PLH AA  GH  V   LL + A +N 
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 61

Query: 584 TDNEGNTALHLATNNGHETCVKALI---------------------------YFNEQEVL 616
              +  T LH A   GH   VK L+                                   
Sbjct: 62  KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEK 121

Query: 617 NLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPLQNA---NNLHVA 673
             +   +  +G +PLH AA++G   + +LLL+  A+P    K  +TPL  A   NNL + 
Sbjct: 122 EASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIV 181

Query: 674 KLLNAYVHKPKPLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRN 733
           KLL                                          +  +           
Sbjct: 182 KLLLP-------------------------------------RGGSPHSPAWNGYTPLHI 204

Query: 734 ITEIKKVEQLFALIENNEIKLIKSYFGLSNEEKVPDNACHPLCQCAKCK-EDVVESESRP 792
             +  +VE   +L++       +S  G             PL   A+    ++V      
Sbjct: 205 AAKQNQVEVARSLLQYGGSANAESVQG-----------VTPLHLAAQEGHAEMVA----L 249

Query: 793 VTDECLNINICNSDGYTALHIATSLGHYDLVRLLINYRADINIVTRVKQLTPLHIACQNN 852
           +  +  N N+ N  G T LH+    GH  +  +LI +   ++  TR+   TPLH+A    
Sbjct: 250 LLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGY-TPLHVASHYG 308

Query: 853 NLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIKNHYGQTCL 912
           N+ +V+  L   Q +VNA+   G + LH AA   HT++ TLLLK+GA P   +  G T L
Sbjct: 309 NIKLVK-FLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPL 367

Query: 913 HMAQQMTSLSLVRVL 927
            +A+++  +S+  VL
Sbjct: 368 AIAKRLGYISVTDVL 382


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ot3a1 a.222.1.1 (A:139-387) Rab5 GDP/GTP exchange factor (Rabex-5) {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query936
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2ot3a1249 Rab5 GDP/GTP exchange factor (Rabex-5) {Human (Hom 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.98
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.89
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.87
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.82
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.8
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.5e-46  Score=423.12  Aligned_cols=354  Identities=29%  Similarity=0.400  Sum_probs=309.6

Q ss_pred             HHHHHHHHCCCHHHHHHHHHhcccCccCCCCCcccccccCCchhhHHHhhhccCCCCcccCCCCCCcHHHHHHHcCCHHH
Q psy8454         458 TKLFEFARLGDGDKVRAILQEENKKEDSESLPLCHPLCSCDDCEEAINLKHSQSKPTTQSMDDRGFTVLHVAALYGRIKV  537 (936)
Q Consensus       458 ~~L~~A~~~G~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~  537 (936)
                      ||||.||..|+.++|++|++.|++.+                                 .+|..|.||||+|+..|+.++
T Consensus         2 TpL~~Aa~~g~~~~v~~Ll~~g~~in---------------------------------~~d~~g~TpL~~A~~~g~~~i   48 (408)
T d1n11a_           2 TPLHVASFMGHLPIVKNLLQRGASPN---------------------------------VSNVKVETPLHMAARAGHTEV   48 (408)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHTTCCSC---------------------------------CSSSCCCCHHHHHHHHTCHHH
T ss_pred             ChHHHHHHCcCHHHHHHHHHCCCCCC---------------------------------CCCCCCCCHHHHHHHcCCHHH
Confidence            79999999999999999999987543                                 367889999999999999999


Q ss_pred             HHHHHhcCCCCCCCCCCCCcHHHHHHHhCcHHHHHHHHhCCCCC---------------------------------CcC
Q psy8454         538 VDLVLELGADTNSQDLCGCSPLHYAATRGHQNVLLLLLHSGASI---------------------------------NLT  584 (936)
Q Consensus       538 v~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~g~~~---------------------------------~~~  584 (936)
                      +++|+++|++++.++..|.||||+|+..|+.+++++|+..+.+.                                 +..
T Consensus        49 v~~Ll~~gadi~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  128 (408)
T d1n11a_          49 AKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACM  128 (408)
T ss_dssp             HHHHHHHTCCSSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCC
T ss_pred             HHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhccccccccccccccccccc
Confidence            99999999999999999999999999999999999998765443                                 345


Q ss_pred             CCCCCcHHHHHHHcCcHHHHHHHHhcccccccccCcccccCCCChHHHHHHHhCCHHHHHHHHHCCCCCCCcccCCCChh
Q psy8454         585 DNEGNTALHLATNNGHETCVKALIYFNEQEVLNLNINAVNNQGDSPLHAAARWGYTSIIQLLLDHGANPTLENKRKVTPL  664 (936)
Q Consensus       585 d~~g~t~L~~A~~~g~~eiv~~Ll~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~d~~g~t~l  664 (936)
                      +..|.++++.|+..++.+++++|++++      .+++..+..|.+||++|++.|+.+++++|+++|++++..+..|.||+
T Consensus       129 ~~~~~~~l~~a~~~~~~~~v~~ll~~~------~~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l  202 (408)
T d1n11a_         129 TKKGFTPLHVAAKYGKVRVAELLLERD------AHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPL  202 (408)
T ss_dssp             CTTSCCHHHHHHHTTCHHHHHHHHHTT------CCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHH
T ss_pred             ccccchHHHHHHHcCCHHHHHHHHHcC------CCCCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcc
Confidence            677889999999999999999999865      56788888999999999999999999999999999999999999999


Q ss_pred             hhhhchhHHHHHHHhhcCCCccccccCCCCCCCCCCCCCCCCcccccccccccccccccccccCCCCcchhhhhhHHHHH
Q psy8454         665 QNANNLHVAKLLNAYVHKPKPLYNYLVPKEKVSRPPSPPPTQDKYLDYSDVNEANISNVNVREGVRPRNITEIKKVEQLF  744 (936)
Q Consensus       665 ~~a~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  744 (936)
                      +.+......+....+.......                                              ........++++
T Consensus       203 ~~~~~~~~~~~~~~l~~~~~~~----------------------------------------------~~~~~~~~t~l~  236 (408)
T d1n11a_         203 HIAAKQNQVEVARSLLQYGGSA----------------------------------------------NAESVQGVTPLH  236 (408)
T ss_dssp             HHHHHTTCHHHHHHHHHTTCCT----------------------------------------------TCCCTTCCCHHH
T ss_pred             hhhhccchhhhhhhhhhccccc----------------------------------------------cccCCCCCCHHH
Confidence            9998777666666554221111                                              111112345788


Q ss_pred             HHHHcCcHHHHHHHhcCCcCCCCCCCCCcccchhcccchhhhhccCccccccCCCcccCCCCCCcHHHHHHHcCCHHHHH
Q psy8454         745 ALIENNEIKLIKSYFGLSNEEKVPDNACHPLCQCAKCKEDVVESESRPVTDECLNINICNSDGYTALHIATSLGHYDLVR  824 (936)
Q Consensus       745 ~ai~~g~~~~vk~Ll~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~d~n~~d~~g~t~L~~Aa~~g~~~~v~  824 (936)
                      .|+..+..++++++....                                   ...+..+..|.|||+.|++.++.++++
T Consensus       237 ~a~~~~~~~~~~~~~~~~-----------------------------------~~~~~~~~~g~~~l~~a~~~~~~~i~~  281 (408)
T d1n11a_         237 LAAQEGHAEMVALLLSKQ-----------------------------------ANGNLGNKSGLTPLHLVAQEGHVPVAD  281 (408)
T ss_dssp             HHHHTTCHHHHHHHHTTT-----------------------------------CCTTCCCTTCCCHHHHHHHHTCHHHHH
T ss_pred             HHHHhCcHhHhhhhhccc-----------------------------------cccccccCCCCChhhhhhhcCcHHHHH
Confidence            999999999999888643                                   335777889999999999999999999


Q ss_pred             HHHhCCCCcccccccCCCcHHHHHHhCCCHHHHHHHHhcCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCcCc
Q psy8454         825 LLINYRADINIVTRVKQLTPLHIACQNNNLSIVRLLLAAKQCNVNAQDYRGNTALHYAAINNHTNLATLLLKSGARPQIK  904 (936)
Q Consensus       825 ~LL~~g~~v~~~~~~~g~TpLh~A~~~g~~~iv~~LL~~g~~dvn~~d~~g~TpL~~A~~~g~~~iv~~LL~~Ga~~~~~  904 (936)
                      +|+++|++++..+ ..+.||||.|+..++.++++++++.| +++|.+|..|+||||+|+++|+.++|++|+++||+++++
T Consensus       282 ~Ll~~g~~~~~~~-~~~~t~L~~~~~~~~~~~~~~ll~~g-~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~  359 (408)
T d1n11a_         282 VLIKHGVMVDATT-RMGYTPLHVASHYGNIKLVKFLLQHQ-ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEV  359 (408)
T ss_dssp             HHHHHTCCTTCCC-SSCCCHHHHHHHSSCSHHHHHHHHTT-CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCC
T ss_pred             HHHHCCCcccccc-ccccccchhhcccCcceeeeeecccc-ccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCC
Confidence            9999999999998 88999999999999999999999998 999999999999999999999999999999999999999


Q ss_pred             ccCCCcHHHHHHHcCCHHHHHHH---hhhCCC
Q psy8454         905 NHYGQTCLHMAQQMTSLSLVRVL---THEAPF  933 (936)
Q Consensus       905 d~~g~T~L~~A~~~g~~~iv~~L---l~~~~~  933 (936)
                      |..|+||||+|+++||.++|++|   +++++.
T Consensus       360 d~~G~t~L~~A~~~~~~~iv~~L~~~~~~~~~  391 (408)
T d1n11a_         360 SSDGTTPLAIAKRLGYISVTDVLKVVTDETSF  391 (408)
T ss_dssp             CSSSCCHHHHHHHTTCHHHHHHHHHHCCCCSS
T ss_pred             CCCCCCHHHHHHHcCCHHHHHHHHHHHhcccc
Confidence            99999999999999999999866   444444



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ot3a1 a.222.1.1 (A:139-387) Rab5 GDP/GTP exchange factor (Rabex-5) {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure