Psyllid ID: psy8464


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MNSNLPFFEPDTERMGKIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGGLNVLQSSPKLAYLNLCGNRIKDLETLEPLFGST
cccccccccccccccccccccEEEccccccccccccHHHcccccEEEcccccccccccccccccccEEcccccccccccccccccccccEEEccccccccccccccccccc
cccccccccHHHHHccccEEEEEEEccccccccccccHHHHHHHHHHHHHccHHcHccccccHHccEEEccccccccHHHHHHccccccEEEccccccccHHccccccccc
mnsnlpffepdtermgkiqikelnldncrstNIAALTSEFTNLKILSAINVGltslkgfpelpaltrlelsdnrisgglnvlqsspklAYLNLCGNRikdletleplfgst
mnsnlpffepdterMGKIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGGLNVLQSSPKLAYLNLCGNRIkdletleplfgst
MNSNLPFFEPDTERMGKIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGGLNVLQSSPKLAYLNLCGNRIKDLETLEPLFGST
****************KIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGGLNVLQSSPKLAYLNLCGNRIKDLETL*******
***NLPFFEPDTERMGKIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGGLNVLQSSPKLAYLNLCGNRIKDLETLEPLFGS*
MNSNLPFFEPDTERMGKIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGGLNVLQSSPKLAYLNLCGNRIKDLETLEPLFGST
***NLPFFEPDTERMGKIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGGLNVLQSSPKLAYLNLCGNRIKDL*TLEP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSNLPFFEPDTERMGKIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGGLNVLQSSPKLAYLNLCGNRIKDLETLEPLFGST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q28XE2 263 Acidic leucine-rich nucle yes N/A 0.801 0.338 0.741 4e-31
Q9V895 261 Acidic leucine-rich nucle yes N/A 0.801 0.340 0.741 8e-31
Q5ZMN0 262 Acidic leucine-rich nucle yes N/A 0.801 0.339 0.586 1e-20
P51122 249 Acidic leucine-rich nucle yes N/A 0.792 0.353 0.615 6e-18
Q6NUW5 250 Acidic leucine-rich nucle yes N/A 0.801 0.356 0.543 7e-18
Q8HY67 249 Acidic leucine-rich nucle yes N/A 0.792 0.353 0.615 8e-18
Q7ZUP0 254 Acidic leucine-rich nucle no N/A 0.801 0.350 0.608 1e-17
Q7ZY40 263 Acidic leucine-rich nucle N/A N/A 0.801 0.338 0.532 2e-17
Q6P1U7 242 Acidic leucine-rich nucle no N/A 0.792 0.363 0.615 3e-17
Q86QS6 275 Acidic leucine-rich nucle N/A N/A 0.801 0.323 0.505 8e-17
>sp|Q28XE2|AN32A_DROPS Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Drosophila pseudoobscura pseudoobscura GN=Anp32a PE=3 SV=2 Back     alignment and function desciption
 Score =  132 bits (333), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%)

Query: 19  QIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGG 78
           QI+ELNLDNCRST+I  LT E+T L+ LS INVGLT+LKGFP+LP L +LELSDNRIS G
Sbjct: 16  QIQELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSG 75

Query: 79  LNVLQSSPKLAYLNLCGNRIKDLETLEPL 107
           LN L +SPKL YLNL GN+IKDLETL+PL
Sbjct: 76  LNYLTTSPKLQYLNLSGNKIKDLETLKPL 104




Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex.
Drosophila pseudoobscura pseudoobscura (taxid: 46245)
>sp|Q9V895|AN32A_DROME Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Drosophila melanogaster GN=Anp32a PE=2 SV=1 Back     alignment and function description
>sp|Q5ZMN0|AN32B_CHICK Acidic leucine-rich nuclear phosphoprotein 32 family member B OS=Gallus gallus GN=ANP32B PE=2 SV=1 Back     alignment and function description
>sp|P51122|AN32A_BOVIN Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Bos taurus GN=ANP32A PE=1 SV=2 Back     alignment and function description
>sp|Q6NUW5|AN32E_DANRE Acidic leucine-rich nuclear phosphoprotein 32 family member E OS=Danio rerio GN=anp32e PE=1 SV=1 Back     alignment and function description
>sp|Q8HY67|AN32A_CANFA Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Canis familiaris GN=ANP32A PE=2 SV=1 Back     alignment and function description
>sp|Q7ZUP0|AN32A_DANRE Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Danio rerio GN=anp32a PE=2 SV=1 Back     alignment and function description
>sp|Q7ZY40|AN32E_XENLA Acidic leucine-rich nuclear phosphoprotein 32 family member E OS=Xenopus laevis GN=anp32e PE=1 SV=1 Back     alignment and function description
>sp|Q6P1U7|AN32B_XENTR Acidic leucine-rich nuclear phosphoprotein 32 family member B OS=Xenopus tropicalis GN=anp32b PE=2 SV=1 Back     alignment and function description
>sp|Q86QS6|AN32_SCHMA Acidic leucine-rich nuclear phosphoprotein 32-related protein OS=Schistosoma mansoni GN=SMV0119 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
332375691 249 unknown [Dendroctonus ponderosae] 0.855 0.381 0.721 4e-31
242004917 276 conserved hypothetical protein [Pediculu 0.810 0.326 0.755 2e-30
442749617 260 Putative leucine-rich acidic nuclear pro 0.855 0.365 0.731 8e-30
33518715 243 mapmodulin-like protein [Rhodnius prolix 0.801 0.366 0.764 8e-30
260820479 240 hypothetical protein BRAFLDRAFT_239771 [ 0.801 0.370 0.764 9e-30
241042409 248 Mapmodulin, putative [Ixodes scapularis] 0.855 0.383 0.731 1e-29
325303822 262 TPA_exp: mapmodulin-like protein [Amblyo 0.855 0.362 0.721 1e-29
427781505 245 Putative microtubule binding protein [Rh 0.855 0.387 0.721 2e-29
195153333 263 GL17265 [Drosophila persimilis] gi|19846 0.801 0.338 0.741 2e-29
307202763 253 Acidic leucine-rich nuclear phosphoprote 0.810 0.355 0.744 2e-29
>gi|332375691|gb|AEE62986.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 81/97 (83%), Gaps = 2/97 (2%)

Query: 13  ERMGK--IQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLEL 70
           E+ GK    IKELNLDNCRSTNI  LT EF NL+ LS INVGLTSLKGFP+LP L +LEL
Sbjct: 8   EKRGKNPADIKELNLDNCRSTNIVGLTDEFENLETLSLINVGLTSLKGFPKLPNLKKLEL 67

Query: 71  SDNRISGGLNVLQSSPKLAYLNLCGNRIKDLETLEPL 107
           SDNRISGG ++L++SPKLAYLNL GN+IKD+E+LE L
Sbjct: 68  SDNRISGGFDILETSPKLAYLNLSGNKIKDVESLESL 104




Source: Dendroctonus ponderosae

Species: Dendroctonus ponderosae

Genus: Dendroctonus

Family: Curculionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242004917|ref|XP_002423322.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212506341|gb|EEB10584.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|442749617|gb|JAA66968.1| Putative leucine-rich acidic nuclear protein [Ixodes ricinus] Back     alignment and taxonomy information
>gi|33518715|gb|AAQ20840.1| mapmodulin-like protein [Rhodnius prolixus] Back     alignment and taxonomy information
>gi|260820479|ref|XP_002605562.1| hypothetical protein BRAFLDRAFT_239771 [Branchiostoma floridae] gi|229290896|gb|EEN61572.1| hypothetical protein BRAFLDRAFT_239771 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|241042409|ref|XP_002407054.1| Mapmodulin, putative [Ixodes scapularis] gi|215492088|gb|EEC01729.1| Mapmodulin, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|325303822|tpg|DAA34585.1| TPA_exp: mapmodulin-like protein [Amblyomma variegatum] Back     alignment and taxonomy information
>gi|427781505|gb|JAA56204.1| Putative microtubule binding protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|195153333|ref|XP_002017582.1| GL17265 [Drosophila persimilis] gi|198460703|ref|XP_001361795.2| GA19125 [Drosophila pseudoobscura pseudoobscura] gi|218511919|sp|Q28XE2.2|AN32A_DROPS RecName: Full=Acidic leucine-rich nuclear phosphoprotein 32 family member A gi|194113378|gb|EDW35421.1| GL17265 [Drosophila persimilis] gi|198137103|gb|EAL26374.2| GA19125 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|307202763|gb|EFN82054.1| Acidic leucine-rich nuclear phosphoprotein 32 family member A [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
UNIPROTKB|Q28XE2 263 Anp32a "Acidic leucine-rich nu 0.801 0.338 0.741 6.2e-30
FB|FBgn0034282 261 Mapmodulin "Mapmodulin" [Droso 0.846 0.360 0.715 7.9e-30
UNIPROTKB|F1SIU2 263 LOC100155298 "Uncharacterized 0.801 0.338 0.619 1e-22
ZFIN|ZDB-GENE-030131-7850 263 anp32a "acidic (leucine-rich) 0.963 0.406 0.525 1e-22
UNIPROTKB|P51122 249 ANP32A "Acidic leucine-rich nu 0.792 0.353 0.615 2.6e-22
UNIPROTKB|F1PQ43 231 ANP32A "Acidic leucine-rich nu 0.792 0.380 0.615 3.4e-22
UNIPROTKB|Q8HY67 249 ANP32A "Acidic leucine-rich nu 0.792 0.353 0.615 3.4e-22
UNIPROTKB|Q5ZMN0 262 ANP32B "Acidic leucine-rich nu 0.801 0.339 0.586 7e-22
UNIPROTKB|Q3SZC6 261 ANP32B "Acidic leucine-rich nu 0.792 0.337 0.571 7e-22
UNIPROTKB|Q92688 251 ANP32B "Acidic leucine-rich nu 0.792 0.350 0.560 2.4e-21
UNIPROTKB|Q28XE2 Anp32a "Acidic leucine-rich nuclear phosphoprotein 32 family member A" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
 Score = 331 (121.6 bits), Expect = 6.2e-30, P = 6.2e-30
 Identities = 66/89 (74%), Positives = 76/89 (85%)

Query:    19 QIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGG 78
             QI+ELNLDNCRST+I  LT E+T L+ LS INVGLT+LKGFP+LP L +LELSDNRIS G
Sbjct:    16 QIQELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLPNLKKLELSDNRISSG 75

Query:    79 LNVLQSSPKLAYLNLCGNRIKDLETLEPL 107
             LN L +SPKL YLNL GN+IKDLETL+PL
Sbjct:    76 LNYLTTSPKLQYLNLSGNKIKDLETLKPL 104




GO:0005634 "nucleus" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS
GO:0005783 "endoplasmic reticulum" evidence=ISS
GO:0006913 "nucleocytoplasmic transport" evidence=ISS
GO:0048471 "perinuclear region of cytoplasm" evidence=ISS
FB|FBgn0034282 Mapmodulin "Mapmodulin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIU2 LOC100155298 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7850 anp32a "acidic (leucine-rich) nuclear phosphoprotein 32 family, member A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P51122 ANP32A "Acidic leucine-rich nuclear phosphoprotein 32 family member A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQ43 ANP32A "Acidic leucine-rich nuclear phosphoprotein 32 family member A" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8HY67 ANP32A "Acidic leucine-rich nuclear phosphoprotein 32 family member A" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMN0 ANP32B "Acidic leucine-rich nuclear phosphoprotein 32 family member B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZC6 ANP32B "Acidic leucine-rich nuclear phosphoprotein 32 family member B" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q92688 ANP32B "Acidic leucine-rich nuclear phosphoprotein 32 family member B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8HY67AN32A_CANFANo assigned EC number0.61530.79270.3534yesN/A
P51122AN32A_BOVINNo assigned EC number0.61530.79270.3534yesN/A
Q28XE2AN32A_DROPSNo assigned EC number0.74150.80180.3384yesN/A
O35381AN32A_MOUSENo assigned EC number0.58240.79270.3562yesN/A
Q9V895AN32A_DROMENo assigned EC number0.74150.80180.3409yesN/A
P49911AN32A_RATNo assigned EC number0.59340.79270.3562yesN/A
Q6NUW5AN32E_DANRENo assigned EC number0.54340.80180.356yesN/A
Q5ZMN0AN32B_CHICKNo assigned EC number0.58690.80180.3396yesN/A
P39687AN32A_HUMANNo assigned EC number0.58240.79270.3534yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
 Score = 32.5 bits (75), Expect = 0.003
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 63  PALTRLELSDNRISGGLNVLQSSPKLAYLNLCGNRIKDLETLE 105
             L  L+LS+N+I+  L  L + P L  L+L GN+I DL  L 
Sbjct: 1   TNLETLDLSNNQITD-LPPLSNLPNLETLDLSGNKITDLSPLS 42


Leucine rich repeats are short sequence motifs present in a number of proteins with diverse functions and cellular locations. These repeats are usually involved in protein-protein interactions. Each Leucine Rich Repeat is composed of a beta-alpha unit. These units form elongated non-globular structures. Leucine Rich Repeats are often flanked by cysteine rich domains. Length = 43

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.43
KOG0617|consensus264 99.28
KOG0617|consensus 264 99.21
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.08
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
KOG0444|consensus 1255 99.04
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.03
KOG4194|consensus 873 98.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.95
KOG0444|consensus 1255 98.95
KOG4194|consensus 873 98.94
PLN03150 623 hypothetical protein; Provisional 98.93
KOG0472|consensus 565 98.91
KOG0472|consensus565 98.89
KOG1259|consensus 490 98.83
PLN03150623 hypothetical protein; Provisional 98.83
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.8
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.7
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.7
KOG1644|consensus 233 98.65
KOG0531|consensus 414 98.64
KOG0618|consensus 1081 98.63
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.61
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.59
KOG1259|consensus490 98.59
KOG4237|consensus 498 98.57
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.57
KOG0618|consensus 1081 98.56
KOG4237|consensus 498 98.55
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.53
KOG0532|consensus 722 98.5
KOG0532|consensus 722 98.49
KOG1859|consensus 1096 98.46
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.37
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.34
KOG0531|consensus 414 98.32
KOG1859|consensus 1096 98.26
KOG4579|consensus177 98.25
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.22
KOG2739|consensus 260 98.14
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.11
KOG4579|consensus177 98.06
KOG4658|consensus 889 97.86
KOG1644|consensus233 97.85
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.79
KOG3207|consensus 505 97.66
KOG3207|consensus 505 97.65
KOG4658|consensus 889 97.63
KOG2982|consensus 418 97.4
KOG2123|consensus 388 97.34
KOG3665|consensus 699 97.33
KOG3665|consensus 699 97.29
KOG2123|consensus 388 97.27
KOG2739|consensus260 97.1
KOG1909|consensus 382 96.99
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.84
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.38
KOG1909|consensus382 96.09
PRK15386 426 type III secretion protein GogB; Provisional 95.74
KOG2982|consensus 418 95.54
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.5
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.99
PRK15386 426 type III secretion protein GogB; Provisional 94.94
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 94.14
smart0037026 LRR Leucine-rich repeats, outliers. 93.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.97
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.56
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 93.18
KOG0473|consensus 326 90.47
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.66
KOG3763|consensus 585 86.75
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.28
KOG3763|consensus 585 84.76
KOG2120|consensus 419 84.46
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 83.89
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
Probab=99.43  E-value=9e-14  Score=82.05  Aligned_cols=94  Identities=38%  Similarity=0.578  Sum_probs=33.2

Q ss_pred             cCcCCccEEEcCCCCCCChhhhhhcCCCccEEecccccCCCCCCCCCCCCCCEEEcCCCcCCCcccccC-CCCCCcEEEc
Q psy8464          15 MGKIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGGLNVLQ-SSPKLAYLNL   93 (111)
Q Consensus        15 ~~~~~l~~l~l~~n~i~~~~~~~~~~~~l~~l~l~~~~~~~l~~~~~l~~L~~l~l~~n~~~~~~~~~~-~~~~L~~l~l   93 (111)
                      .++..+++|++++|.|+.+...-..+.+++.+++++|.++.+.++..+.+|+.|++++|.++.+.+.+. .++.|+.|++
T Consensus        16 ~n~~~~~~L~L~~n~I~~Ie~L~~~l~~L~~L~Ls~N~I~~l~~l~~L~~L~~L~L~~N~I~~i~~~l~~~lp~L~~L~L   95 (175)
T PF14580_consen   16 NNPVKLRELNLRGNQISTIENLGATLDKLEVLDLSNNQITKLEGLPGLPRLKTLDLSNNRISSISEGLDKNLPNLQELYL   95 (175)
T ss_dssp             --------------------S--TT-TT--EEE-TTS--S--TT----TT--EEE--SS---S-CHHHHHH-TT--EEE-
T ss_pred             ccccccccccccccccccccchhhhhcCCCEEECCCCCCccccCccChhhhhhcccCCCCCCccccchHHhCCcCCEEEC
Confidence            333567888999999988765534677888999999999888888888889999999999887444443 5788999999


Q ss_pred             CCCCCCCCcCCCCCC
Q psy8464          94 CGNRIKDLETLEPLF  108 (111)
Q Consensus        94 ~~n~l~~~~~~~~l~  108 (111)
                      ++|.+.++..+..++
T Consensus        96 ~~N~I~~l~~l~~L~  110 (175)
T PF14580_consen   96 SNNKISDLNELEPLS  110 (175)
T ss_dssp             TTS---SCCCCGGGG
T ss_pred             cCCcCCChHHhHHHH
Confidence            999888776555443



>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
2je0_A149 Crystal Structure Of Pp32 Length = 149 3e-17
2jqd_A169 Structure Of The Leucine-Rich Repeat Domain Of Lanp 3e-17
2ell_A168 Solution Structure Of The Leucine Rich Repeat Of Hu 2e-16
>pdb|2JE0|A Chain A, Crystal Structure Of Pp32 Length = 149 Back     alignment and structure

Iteration: 1

Score = 83.2 bits (204), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 53/92 (57%), Positives = 64/92 (69%), Gaps = 3/92 (3%) Query: 19 QIKELNLDNCRST--NIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRIS 76 +KEL LDN RS + LT EF L+ LS INVGLTS+ P+L L +LELSDNR+S Sbjct: 18 DVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVS 77 Query: 77 GGLNVL-QSSPKLAYLNLCGNRIKDLETLEPL 107 GGL VL + P L +LNL GN+IKDL T+EPL Sbjct: 78 GGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPL 109
>pdb|2JQD|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of Lanp Length = 169 Back     alignment and structure
>pdb|2ELL|A Chain A, Solution Structure Of The Leucine Rich Repeat Of Human Acidic Leucine- Rich Nuclear Phosphoprotein 32 Family Member B Length = 168 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-20
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-19
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-09
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 9e-06
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 5e-10
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 5e-10
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 1e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-08
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 5e-07
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 1e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-08
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-07
1ds9_A 198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-04
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-04
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 2e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-04
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 6e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-04
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
 Score = 78.2 bits (193), Expect = 6e-20
 Identities = 53/92 (57%), Positives = 62/92 (67%), Gaps = 3/92 (3%)

Query: 19  QIKELNLDNCRSTNIA--ALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRIS 76
            +KEL LDN RS       LT EF  L+ LS INVGLTS+   P+L  L +LELSDNR+S
Sbjct: 18  DVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVS 77

Query: 77  GGLNVLQSS-PKLAYLNLCGNRIKDLETLEPL 107
           GGL VL    P L +LNL GN+IKDL T+EPL
Sbjct: 78  GGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPL 109


>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.62
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.62
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.58
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.54
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.54
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.53
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.53
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.52
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.51
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.51
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.51
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.5
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 99.5
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.49
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.49
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.49
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.48
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.47
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.46
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.46
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.45
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.45
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.45
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.44
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.43
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.43
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.43
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.42
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.42
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.42
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.41
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.4
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.4
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.4
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.4
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.39
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.39
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.39
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.39
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.39
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.38
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.38
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.38
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.37
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.37
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 99.37
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 99.37
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.36
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.36
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.35
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.35
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.35
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.34
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.33
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.33
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.33
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.32
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.32
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.31
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.31
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.31
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.3
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.3
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.29
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.28
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.28
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 99.27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.25
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.23
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.23
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.2
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.2
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.19
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.19
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.14
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.98
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.78
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.72
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.64
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.45
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.41
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.37
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.29
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.29
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.26
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.17
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.15
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 97.89
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.76
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.75
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.6
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.54
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 97.42
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.31
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.28
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.65
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.62
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.6
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.55
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.45
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.2
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 95.95
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 95.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.42
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.23
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 80.62
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
Probab=99.68  E-value=1.9e-15  Score=89.79  Aligned_cols=97  Identities=25%  Similarity=0.309  Sum_probs=83.4

Q ss_pred             CCCCCCCCCcccccCcCCccEEEcCCCCCCChhhhhhcCCCccEEecccccCCCCC--CCCCCCCCCEEEcCCCcCCCcc
Q psy8464           2 NSNLPFFEPDTERMGKIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLK--GFPELPALTRLELSDNRISGGL   79 (111)
Q Consensus         2 ~~~l~~~p~~~~~~~~~~l~~l~l~~n~i~~~~~~~~~~~~l~~l~l~~~~~~~l~--~~~~l~~L~~l~l~~n~~~~~~   79 (111)
                      ++.+.++|..++    +.++.|++++|.++.+|..+..+.+|+.+++++|.++.++  .|..+.+|+.|++++|.+..++
T Consensus        19 ~~~l~~ip~~~~----~~l~~L~L~~n~i~~ip~~~~~l~~L~~L~Ls~N~i~~i~~~~f~~l~~L~~L~Ls~N~l~~i~   94 (193)
T 2wfh_A           19 NKGLKVLPKGIP----RDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIP   94 (193)
T ss_dssp             TSCCSSCCSCCC----TTCCEEECCSSCCCSCCGGGGGCTTCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCCBCC
T ss_pred             CCCCCcCCCCCC----CCCCEEECCCCcCchhHHHhhcccCCCEEECCCCcCCEeCHhHccCCCCCCEEECCCCccCEeC
Confidence            456788886543    6799999999999998888899999999999999999887  5888999999999999998866


Q ss_pred             cc-cCCCCCCcEEEcCCCCCCCCc
Q psy8464          80 NV-LQSSPKLAYLNLCGNRIKDLE  102 (111)
Q Consensus        80 ~~-~~~~~~L~~l~l~~n~l~~~~  102 (111)
                      +. +..+++|+.|++++|.++.+.
T Consensus        95 ~~~f~~l~~L~~L~L~~N~l~~~~  118 (193)
T 2wfh_A           95 PRTFDGLKSLRLLSLHGNDISVVP  118 (193)
T ss_dssp             TTTTTTCTTCCEEECCSSCCCBCC
T ss_pred             HHHhCCCCCCCEEECCCCCCCeeC
Confidence            54 778899999999999998764



>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 111
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2 227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 43.8 bits (102), Expect = 8e-07
 Identities = 17/78 (21%), Positives = 31/78 (39%), Gaps = 2/78 (2%)

Query: 19  QIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGG 78
            +  L L     ++I+ + S  T L+ L   N  ++ +     L  +  L    N+IS  
Sbjct: 308 NLTYLTLYFNNISDISPV-SSLTKLQRLFFANNKVSDVSSLANLTNINWLSAGHNQIS-D 365

Query: 79  LNVLQSSPKLAYLNLCGN 96
           L  L +  ++  L L   
Sbjct: 366 LTPLANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.61
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 99.52
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.51
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.42
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.41
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.35
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.34
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.34
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.29
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.28
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.27
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.23
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.18
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.16
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.05
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 99.03
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.99
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.99
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.96
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.84
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.72
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.5
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.13
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.09
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.96
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.64
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.17
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.15
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.66
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.70  E-value=1.5e-16  Score=87.25  Aligned_cols=99  Identities=27%  Similarity=0.441  Sum_probs=86.4

Q ss_pred             CCCCCCCCCcccccCcCCccEEEcCCCCCCChhhhhhcCCCccEEecccccCCCCCCCCCCCCCCEEEcCCCcCCCcc--
Q psy8464           2 NSNLPFFEPDTERMGKIQIKELNLDNCRSTNIAALTSEFTNLKILSAINVGLTSLKGFPELPALTRLELSDNRISGGL--   79 (111)
Q Consensus         2 ~~~l~~~p~~~~~~~~~~l~~l~l~~n~i~~~~~~~~~~~~l~~l~l~~~~~~~l~~~~~l~~L~~l~l~~n~~~~~~--   79 (111)
                      +++++.++. +..+  +.+++|++++|.++.+|..+..+++|+.+++++|.++.++.+..+++|+.+++++|++..+.  
T Consensus         7 ~n~l~~l~~-l~~l--~~L~~L~ls~N~l~~lp~~~~~l~~L~~L~l~~N~i~~l~~~~~l~~L~~L~l~~N~i~~~~~~   83 (124)
T d1dcea3           7 HKDLTVLCH-LEQL--LLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGVANLPRLQELLLCNNRLQQSAAI   83 (124)
T ss_dssp             TSCCSSCCC-GGGG--TTCCEEECCSSCCCCCCGGGGGCTTCCEEECCSSCCCCCGGGTTCSSCCEEECCSSCCCSSSTT
T ss_pred             CCCCCCCcc-cccC--CCCCEEECCCCccCcchhhhhhhhcccccccccccccccCccccccccCeEECCCCccCCCCCc
Confidence            467777764 6777  89999999999999998888999999999999999999998889999999999999998754  


Q ss_pred             cccCCCCCCcEEEcCCCCCCCCcC
Q psy8464          80 NVLQSSPKLAYLNLCGNRIKDLET  103 (111)
Q Consensus        80 ~~~~~~~~L~~l~l~~n~l~~~~~  103 (111)
                      ..++.++.|+.+++++|.+++.+.
T Consensus        84 ~~l~~~~~L~~L~l~~N~i~~~~~  107 (124)
T d1dcea3          84 QPLVSCPRLVLLNLQGNSLCQEEG  107 (124)
T ss_dssp             GGGGGCTTCCEEECTTSGGGGSSS
T ss_pred             hhhcCCCCCCEEECCCCcCCcCcc
Confidence            246788999999999999976643



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure