Psyllid ID: psy8497


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920------1930------1940------1950------1960------1970------1980------1990------2000------2010------2020------2030------2040------2050------2060------2070------2080------2090------2100------2110------2120------2130------2140------2150------2160------2170------2180------2190------2200------2210------2220------2230------2240------2250------2260------2270------2280------2290------2300------2310------2320------2330------2340------2350-----
MAHDIQKCARTKDVLSNIDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVERPKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPSLRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSAESLVKFHSLMGEINLDHAFNVGLVPDNLTGDQINWTQRVQTLLAKPLDQAQEREDVEQTAEESSKVENTKPLRGAPSKEVTKKGASKEGTKWNLTDGQSEEESDSENDGKPDENGSQRGSKRSKEFKTQEKCVKGAGEDENGDRKASKDEQKIDGANSAEKSLEDKHGKKITNSFEAVGEIVQNDTETTKENNQTDEVPEENGLVGNPNKAEVGDLNECESCTDSFHMNEHSDENDLGNNTKESQKQKGHKSKKKKDRKRKGNGDKRDPQGNNANQREIRDNSATLDKTEKESVNNVESKDERPPSTANNPDGTEWEDIPSDTIPNDETSNDNKLTPVDFDYINDFVNQTPSETGDRPLVHGPNSVPKIDTPSDDYLVANMKACLTNDSVRVQVLMEKLDHVDASVLADWILNKHNNVAALFRSEDQSNSVRIGDNDGTGNRSITRSKQNSQSGDHTDLKDSNRPNANTDPSTGKNVKDIQSREIKSYASLSMFSPCQTTLNKFDTQYNSSDYQSDSKPYGDRTKRRSRPRKNKENTDILNTLGQDKTSAHGRTPSGGHRTPERRRSDGVRNDTRDERNGAYTGDKGGRNRGHSVNSRKDHSFAGETPRSKGGFDSYLDQSMDSFLDKSCREESFLKRSHMPKRDLVVYDDAFDMFSPAANNLDEYEIDYVEQPVDEKKSRRELSQKMDSDRYRPDSDGDPNRRPSSQESLHHNDSLDIKLRKKLKPGHRLQRNSKKRHSKISTERSNSNSAPREKSSDAKQAANEEENITGGNDENKTPVASEVRNKNKKVKGVKEKNPSIVGDEKRRYWWRSPPGGGPNAARHKVCDDTDFQISWNDPHPPKLTHGTGKSRSKSSHSKQSKRSAENPSCRRMRGQDAFAPGGVATPSFGMNRAYEENFSKLDLSSYHDEHAVFLPNSSSEDDCDGLSHGDEANGLASEDADEYSGSSLNSSCIDLNCDHLENDFSEEEAEEYLEETYVTDEYHECDDERCSHDDCGDLDYQQYEKLRGRQANTPTKTIGDTQGKRGGRVNTRSNHVNSEDKSRVHTSEDRLNFKGWIREMELYNVSTNVNVSDDDGLDESYNMIKTPTPRKRNGASGESSVEREDVGGGKSLRNLLLRRALMNKQNEVNLWHRENQGWNQKAQGWNEHTEVQTGLNQGWHQKTQGWNEHSELQNGIDYGRLPIGHQHNHDHRHKHRFNHSSSGGNPNARISNRQRSVVPLDHPFVSNFSNSFNFDTSFSNGMSQRFSNGSQPARCFVETHKGKTRLNDVSRCEHQGEFLPSLRKRCDVGHHQVYASSPCLSKHGRIGSNKRTGFQLTSLQVDRHTQMDQYFRNGGPMMKQYLCSTQGLQRFKHHHSSSHSQSEFDPKRLHSKESSHKRNRKANDFNDTCGAVANETFDGEDSKGGSDDENNLIVTLSEAGDSEVDVEGENSPTDEDEDANNSQNDGESTAQNSQSDENSHDGESDSHSVKSNESHFGNSRCQPKTAYQSSSAQSEDGTSYKSISWDAYSVIDEPESYDVSWRTCSSESAAREKNSGQRSRGSGDKAARKSASLPASQIALRDGKGDFKSPRKASHSLKDGKRYGNAQSFEAARNSNPYEAPMPGAWQPVLEGTSVFDDAEKSSKSGPKSSKAGPKSSKPGPKSSKPGPKSSKRYPSRSGSSGLNNRTEGNSVSHTWENHFATGTDRRSHQYPAYGSMSRHDLYFDESQLLGNEALGRGEIRGSGGGFASRVSSVGPANESGLVVAGWNRCDREGHDPARGLPMRSHFHGVKRSNHCDRKPRGGRKRLESSGNETFDIVEDLDGLSLNEGCQRVNGFGRGRKGGNGNGRGNSERLAPTCSHYRENTNSFRYLDNRVCGHKDAKSRYQGNQIRGHIKDAKPCFHGNLNETDLTYDRLSSDYDSTFSCGDFFLDSSYEDGPAHESEGCSYEHVLRAHPAYYPSLDVPRLKAVLERQREFMESYASQMSVYLNVARNIAGNSYFDF
cccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccEEEcccHHHHHHHcccccccccccEEEEEccHHHHccccHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHcccccEEEEccccccccccEEEEEEEccccccccccccHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHccccccEEEEccccccccccccccEEEEccccccccccEEccccccccccccEEEEEEcHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHcHHHcccccEEHHHHHHHcccccHHHHHHHHHcccccEEHHHccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccHHHcccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHcccccccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccHHHHHcccccccccccccccccccccccEEccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHccccccccccccccccccHHccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccHHHHccccccccEEEcccccccccccccccccccEEEEEEEEcccHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccHHHHHHHcccccccccccHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcEEHHHHHHcccccccccc
ccccccccccccccccccccccHHHccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHccEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEEEccccccccEEEEEEEEccHcccccccccHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHccccHHHccccccHHHHHHHHHHHHccccEEEEEEEHHHcccccccccEEEEEccccccHHHEEEEccccccccccEEEEEEcHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHcccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHEEEcccccEEEccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHcccccEEEEEHHHHcccccHHHHHHHHHHHcccEEEEEEcccccccEEEEcccccccccEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccHHHHHcccccHHHHHHccccccccEEEEccHHHcccHHHcccccEEEEEEccccccHHcHHHHHccccccccccccccccccccccHHHccccccHcHHHHHccccccccEEccccccccEcccccccccccccccHHHHHHHHHHHcccccccccccccEHHEEccccccccEcccccccccccccEEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccHHHHHHcccccccccccccEEEcccccccccccccccccccccccccccHHcccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccccccccEEcccccccccEEccccccccccccccccccccccccccHHHHEEEEEcccccEcccccccccccccccccccccccccccccccEEccccccHHHHHHHHHHHHHHHcccccHHHHHcccccHHccccccccEEccccccccccccccccHHHHHHcccccccccccccccccccccccEcccccccccccEEccccccccccccccEEccccccccccccccccccEccccccccEEEEEcccccccccccccccccccccHHHHHcccccccEEEEcccccccccccccccccccEEEEEEEccccHHHHHHccccHHHHHHHHccccHHHcccccccccccccccccHcccccccccccccccccccccccEEccccccccccccccccccEEEEEcccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccEEEEEEcEEEEEcccccccEEEEEcccHHHHHHHcccccccccccHHHHHcccccHHHEEEcccccccccccccccccccccccccccHHHHHHcccccccccccccccEEcccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcHHHHHccHHcccccEEccccccccEEccccccccccEEEEccccccccccccccccccccccccccccccccccccccccEccccccccEEEEEccccccccccccEEcccccccccccccccccccccccccccccccccccEEccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccHHHHEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
mahdiqkcartkdVLSNIDvlfendvliekpirqglqengfvkespiqmaafpyvlnGYDAIvqsksgtgkSIVFVVAALNKLiklpvqqpqtiilapTREIAVQITDVVRSVGAHVKNLHVDYfiggtqverpkrpvqivvgspgrIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIysqlppmkQMLVVSATYSHDNLATLQKymvdpllirpedatrpllGVKQLVALipecknpslryvdEEKKLVQLLSqtpfnqcvifsnyqlrpeVICENLananfgaeylsgAQDQKARLAsldsfkrgkvRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRmgragrygtrGLVITIVSAESLVKFHSLMgeinldhafnvglvpdnltgdqiNWTQRVQTLLAkpldqaqereDVEQTAEEsskventkplrgapskevtkkgaskegtkwnltdgqseeesdsendgkpdengsqrgskrskefktqekcvkgagedengdrkaskdeqkidganSAEKsledkhgkkiTNSFEAVGEIVQndtettkennqtdevpeenglvgnpnkaevgdlnecesctdsfhmnehsdendlgnntkesqkqkghkskkkkdrkrkgngdkrdpqgnnanqreirdnsatldktekesvnnveskderppstannpdgtewedipsdtipndetsndnkltpvdfdyindfvnqtpsetgdrplvhgpnsvpkidtpsdDYLVANMKACLTNDSVRVQVLMEKLDHVDASVLADWILNKHNNVAALFrsedqsnsvrigdndgtgnrsitrskqnsqsgdhtdlkdsnrpnantdpstgknvkdIQSREIKSYaslsmfspcqttlnkfdtqynssdyqsdskpygdrtkrrsrprknkentDILNTlgqdktsahgrtpsgghrtperrrsdgvrndtrderngaytgdkggrnrghsvnsrkdhsfagetprskggfdsyldqsmDSFLDKSCreesflkrshmpkrdlvvyddafdmfspaannldeyeidyveqpvdekKSRRELSQkmdsdryrpdsdgdpnrrpssqeslhhndsldiklrkklkpghrlqrnskkrHSKIStersnsnsaprekssdakqaaneeenitggndenktpvasevrnknkkvkgvkeknpsivgdekrrywwrsppgggpnaarhkvcddtdfqiswndphppklthgtgksrsksshskqskrsaenpscrrmrgqdafapggvatpsfgmnrayeenfskldlssyhdehavflpnssseddcdglshgdeanglasedadeysgsslnsscidlncdhlendfsEEEAEEYLEEtyvtdeyhecddercshddcgdldYQQYEKLrgrqantptktigdtqgkrggrvntrsnhvnsedksrvhtsedRLNFKGWIREMELYNVstnvnvsdddgldesynmiktptprkrngasgessveredvgggksLRNLLLRRALMNKQNEVNLWHRENQGWNQKAQGWNEHTevqtglnqgwhqktqgwnehselqngidygrlpighqhnhdhrhkhrfnhsssggnpnarisnrqrsvvpldhpfvsnfsnsfnfdtsfsngmsqrfsngsqparcfvethkgktrlndvsrcehqgeflpslrkrcdvghhqvyasspclskhgrigsnkrtgfqltslqvdrhtqmdqyfrnggpmmkQYLCStqglqrfkhhhssshsqsefdpkrlhskesshkrnrkandfndtcgavanetfdgedskggsddenNLIVTLSeagdsevdvegensptdededannsqndgestaqnsqsdenshdgesdshsvksneshfgnsrcqpktayqsssaqsedgtsyksiswdaysvidepesydvswrtcssesaareknsgqrsrgsgdkaarksaslpasqialrdgkgdfksprkashslkdgkrygnaqsfeaarnsnpyeapmpgawqpvlegtsvfddaekssksgpksskagpksskpgpksskpgpksskrypsrsgssglnnrtegnsvshTWENhfatgtdrrshqypaygsmsrhdlyfdesqllgnealgrgeirgsgggfasrvssvgpanesglvvagwnrcdreghdparglpmrshfhgvkrsnhcdrkprggrkrlessgnetfdivedldglslnegcqrvngfgrgrkggngngrgnserlaptcshyrentnsfryldnrvcghkdaksryqgnqirghikdakpcfhgnlnetdltydrlssdydstfscgdffldssyedgpahesegcsyehvlrahpayypsldvprLKAVLERQREFMESYASQMSVYLNVARniagnsyfdf
mahdiqkcartkdvlsniDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFiggtqverpkrpvqivvgspgrikqMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPSLRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLasldsfkrgkVRILVTTdlaargidaanVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSAESLVKFHSLMGEINLDHAFNVGLVPDNLTGDQINWTQRVQTLLAKPLDQAQEREDVEqtaeesskventkplrgapskevtkkgaskegtkwnltdgqseeesdsendgkpdengsqrgskrskefktqekcvkgagedengdrkaskdeqkidgansaeksledkhgkkitNSFEAVGEivqndtettkennqtdevpeenglvgnpNKAEVGDLNECESCTDSFHMNehsdendlgnntkesqkqkghkskkkkdrkrkgngdkrdpqgnnanqreirdnsatldktekesvnnveskderppstannpdgtewedipsdtipndetsndnkLTPVDFDYINDFVNQtpsetgdrplvhgPNSVPKIDTPSDDYLVANMKACLTNDSVRVQVLMEKLDHVDASVLADWILNKHNNVAALfrsedqsnsvrigdndgtgnrsitrskqnsqsgdhtdlkdsnrpnantdpstgknvkdiQSREIKSYASLSMFSPCQTTLNKFdtqynssdyqsdskpygdrtkrrsrprknkentdilntlgqdktsahgrtpsgghrtperrrsdgvrndtrderngaytgdkggrnrghsvnsrkdhsfagetprskggfdSYLDQSMDSFLDKSCREEsflkrshmpkrDLVVYDDAFDMFSPAANNLDEYEIDYveqpvdekksrrelsqkmdsdryrpdsdgdpnrrpssqeslhhndsldiklrkklkpghrlqrnskkrhskistersnsnsaprekssdakqaaneeenitggndenktpvasevrnknkkvkgvkeknpsivgdekrrywWRSPPGGGPNAARHKVCDDTDFQISWNDphppklthgtgksrsksshskqskrsaenpscrrmrgqdafapggvaTPSFGMNRAYEENFSKLDLSSYHDEHAVFLPNSSSEDDCDGLSHGDEANGLASEDADEYSGSSLNSSCIDLNCDHLENDFSEEEAEEYLEETYVTDEYHECDDERCSHDDCGDLDYQQYEklrgrqantptktigdtqgkrggrvntrsnhvnsedksrvhtsedrlNFKGWIREMELYNVSTnvnvsdddgldesynmiktptprkrngasgessveredvgggksLRNLLLRRALMNKQNEVNLWHRENQGWNQKAQGWNEHTEVQTGLNQGWHQKTQGWNEHSELQNGIDYGRLPIGHQHNHDHRHKHRFNHSSSGGNPNARISNRQRSVVPLDHPFVSNFSNSFNFDTSFSNGMSQRFSNGSQPARCFVETHkgktrlndvsrCEHQGEFLPSLRKRCDVGHHQVyasspclskhgrigSNKRTGFQLTSLQVDRHTQMDQYFRNGGPMMKQYLCSTQGLQRFKHHHSsshsqsefdpkrlhskesshkrnrkandfndtCGAVANETfdgedskggsddENNLIVTlseagdsevdvEGENSPTDEDEDANNSQNDGESTAQNSQSDENSHDGESDSHSVKSNESHFGNSRCQPKTAyqsssaqsedgtsyksisWDAYSVIDEPESYDVSWRTCSSesaareknsgqrsrgsgdkaarksaslpasqialrdgkgdfksprkashslkdgkrygnAQSFEAARNSNPYEAPMPGAWQPVLEGTSVFDDAEKssksgpksskagpksskpgpksskpgpksskrypsrsgssglnnrtegnsvsHTWENHFatgtdrrshQYPAYGSMSRHDLYFDESQLLGNEALGRGEIRGSGGGFASRVSSVGPANESGLVVAGWNRCDREGHDparglpmrshfhgvkrsnhcdrkprggrkrlessgnetfdivedldglslnEGCQRVNGfgrgrkggngngrgnserlapTCSHYRENTNSFRYLDNRVCGHKDAKSRYQGNQIRGHIKDAKPCFHGNLNETDLTYDRLSSDYDSTFSCGDFFLDSSYEDGPAHESEGCSYEHVLRAHPAYYPSLDVPRLKAVLERQREFMESYASQMSVYLNVARNIAGNSYFDF
MAHDIQKCARTKDVLSNIDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVERPKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPSLRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSAESLVKFHSLMGEINLDHAFNVGLVPDNLTGDQINWTQRVQTLLAKPLDQAQEREDVEQTAEESSKVENTKPLRGAPSKEVTKKGASKEGTKWNLTDGQSEEESDSENDGKPDENGSQRGSKRSKEFKTQEKCVKGAGEDENGDRKASKDEQKIDGANSAEKSLEDKHGKKITNSFEAVGEIVQNDTETTKENNQTDEVPEENGLVGNPNKAEVGDLNECESCTDSFHMNEHSDENDLGNNTKESQkqkghkskkkkdrkrkgngdkrdPQGNNANQREIRDNSATLDKTEKESVNNVESKDERPPSTANNPDGTEWEDIPSDTIPNDETSNDNKLTPVDFDYINDFVNQTPSETGDRPLVHGPNSVPKIDTPSDDYLVANMKACLTNDSVRVQVLMEKLDHVDASVLADWILNKHNNVAALFRSEDQSNSVRIGDNDGTGNRSITRSKQNSQSGDHTDLKDSNRPNANTDPSTGKNVKDIQSREIKSYASLSMFSPCQTTLNKFDTQYNSSDYQSDSKPYGDRTKRRSRPRKNKENTDILNTLGQDKTSAHGRTPSGGHRTPERRRSDGVRNDTRDERNGAYTGDKGGRNRGHSVNSRKDHSFAGETPRSKGGFDSYLDQSMDSFLDKSCREESFLKRSHMPKRDLVVYDDAFDMFSPAANNLDEYEIDYVEQPVDEKKSRRELSQKMDSDRYRPDSDGDPNRRPSSQESLHHNDSLDIKLRKKLKPGHRLQRNSKKRHSKISTERSNSNSAPREKSSDAKQAANEEENITGGNDENKTPVASEvrnknkkvkgvkeknPSIVGDEKRRYWWRSPPGGGPNAARHKVCDDTDFQISWNDPHPPKLTHGTGksrsksshskqskrsAENPSCRRMRGQDAFAPGGVATPSFGMNRAYEENFSKLDLSSYHDEHAVFLPNSSSEDDCDGLSHGDEANGLASEDADEYSGSSLNSSCIDLNCDHLENDFSeeeaeeyleeTYVTDEYHECDDERCSHDDCGDLDYQQYEKLRGRQANTPTKTIGDTQGKRGGRVNTRSNHVNSEDKSRVHTSEDRLNFKGWIREMELYNVSTNVNVSDDDGLDESYNMIKTPTPRKRNGASGESSVEREDVGGGKSlrnlllrralMNKQNEVNLWHRENQGWNQKAQGWNEHTEVQTGLNQGWHQKTQGWNEHSELQNGIDYGRLPIGhqhnhdhrhkhrfnhSSSGGNPNARISNRQRSVVPLDHPfvsnfsnsfnfdtsfsnGMSQRFSNGSQPARCFVETHKGKTRLNDVSRCEHQGEFLPSLRKRCDVGHHQVYASSPCLSKHGRIGSNKRTGFQLTSLQVDRHTQMDQYFRNGGPMMKQYLCSTQGLQRFKhhhssshsQSEFDPKRLHSKESSHKRNRKANDFNDTCGAVANETFdgedskggsddeNNLIVTLSEAGDSEVDVEGENSPTDEDEDANNSQNDGESTAQNSQSDENSHDGESDSHSVKSNESHFGNSRCQPKTAYQSSSAQSEDGTSYKSISWDAYSVIDEPESYDVSWRTCSSESAAREKNSGQRSRGSGDKAARKSASLPASQIALRDGKGDFKSPRKASHSLKDGKRYGNAQSFEAARNSNPYEAPMPGAWQPVLEGTSVFDDAEkssksgpksskagpksskpgpksskpgpksskrypsrsgssgLNNRTEGNSVSHTWENHFATGTDRRSHQYPAYGSMSRHDLYFDESQLLGNEALgrgeirgsgggFASRVSSVGPANESGLVVAGWNRCDREGHDPARGLPMRSHFHGVKRSNHCDRKPRGGRKRLESSGNETFDIVEDLDGLSLNEGCQrvngfgrgrkggngngrgnSERLAPTCSHYRENTNSFRYLDNRVCGHKDAKSRYQGNQIRGHIKDAKPCFHGNLNETDLTYDRLSSDYDSTFSCGDFFLDSSYEDGPAHESEGCSYEHVLRAHPAYYPSLDVPRLKAVLERQREFMESYASQMSVYLNVARNIAGNSYFDF
*******CARTKDVLSNIDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVERPKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPSLRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSAESLVKFHSLMGEINLDHAFNVGLVPDNLTGDQINWTQRVQTLLA*****************************************************************************************************************************************************************************************************************************************************************************************************VDFDYINDFV***************************DYLVANMKACLTNDSVRVQVLMEKLDHVDASVLADWILNKHNNVAALF*****************************************************************************************************************************************************************************************************************************RDLVVYDDAFDMFSPAANNLDEYEIDYV*****************************************************************************************************************************************RYWW***************C***DFQI**********************************************************************************************************************CIDLNCDHLE*********EYLEETYVTDEYHECDDERCSHDDCGDLDYQ*************************************************LNFKGWIREMELYNVSTNVN*******************************************NLLLRRALMNKQNEVNLWHRENQGWNQKAQGWNEHTEVQTGLNQGWHQKTQGWNEHSELQNGIDYGRLP************************************************************************CFVE*********DVSRCEHQGEFLPSLRKRCDVGHHQVYASSPCLSKHGRI*****TGFQLTSLQVDRHTQMDQYFRNGGPMMKQYLCST*************************************************************************************************************************************************************ISWDAYSVIDEPESYDVSW***********************************************************************************************************************************************************************************DLYFDESQLL******************************GLVVAGWNRC*********************************************DIVEDLDGLSLNEGCQ*****************************YRENTNSFRYLDNRVCGHKDAKSRYQGNQIRGHIKDAKPCFHGNLNETDLTYDRLSSDYDSTFSCGDFFLDSSYE*******EGCSYEHVLRAHPAYYPSLDVPRLKAVLERQREFMESYASQMSVYLNVARNIAGNSY***
*****************IDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVERPKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPSLRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSAESLVKFHSLMGEINLD********************************************************************************************************************************************************************IVQND************************************************************************************************************************************DIPSDTI********NKLTPVDFDYINDFVNQTPS*TG**PLVHGPNSVPKIDTPSDDYLVANMKACLTNDSVRVQVLMEKLDHVDASVLADWILNKHNNVAALFR**********************************************************SREIKSYASLSMFSPCQTTLNKFDT**********************************************************************************************************GFDSYLDQSMDSFLDKSCREESFLKRSHMPKRDLVVYDDAFDMFSPAANNLDEYEIDYVE*********************************************DIKLRK*******************************************************************************VGDEKRRYWWRSPP*****AARHKVCDDTDFQISWNDPHP************************************AFAPGGVATPSFGMNRAYEENFSKLDLSSYHDEHAVFLPNSS****************************SLNSSCIDLNCDHLENDFSEEEAEEYLEETYVTDEYHECDDERCSHDDCGDLDYQQYEK*******************************************DRLNFKGWIREMELYNVSTNVNVSDDDGLDESYNM***************************SLRNLLLRRALMNKQNEVNLWHRENQG*****Q**NEHTEVQTGLNQGWH**TQ*****SELQNGIDYGRLPIGHQHNH**************************SVVPLDHPFVSNFSNSFNFDTSFS**************RCFVETHKGKTRLNDVSRCEHQGEFLPSLRKRCDVGHHQVYASSPCLS********KRTGFQLTSLQVDRHTQMDQYFRNGGPMMKQYLCSTQGL**************************************DTCGAVANE****************LIVTLSEAG**********************************************************************************ISWDAYSVIDEPESYDVSW*******************************************************************************PMPGAWQPVLEGTS*********************************************************VSHTWENHFATGTDRRSHQYPAYGSMSRHDLYFDESQLLGNEALGRGEIRGSGGGFASRVSSVGPANESGLVVAGWNRCDREGHDPARGLPMRSHFHGV***********************TFDIVEDLDGLSLNEGCQRVN*********************PTCSHYRENTNSFRYLDNRVCGHKD***********GHIKDAKPCFHGNLNETDLTYDRLSSDYDSTFSCGDFFLDSSYED*****SEGCSYEHVLRAHPAYYPSLDVPRLKAVLERQREFMESYASQMSVYLNVARNIAGNS*FD*
********ARTKDVLSNIDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVERPKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPSLRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSAESLVKFHSLMGEINLDHAFNVGLVPDNLTGDQINWTQRVQTLLAKPLD********************************************************************************************************IDGANSAEKSLEDKHGKKITNSFEAVGEIVQNDT***************NGLVGNPNKAEVGDLNECESCTDSFHMNEHS***************************************NNANQREIRDNSATLDK************************GTEWEDIPSDTIPNDETSNDNKLTPVDFDYINDFVNQTPSETGDRPLVHGPNSVPKIDTPSDDYLVANMKACLTNDSVRVQVLMEKLDHVDASVLADWILNKHNNVAALFRSEDQSNSVRIGDNDGTGNRS*****************DSNRPNA***********DIQSREIKSYASLSMFSPCQTTLNKFDTQYN***********************NKENTDILNTLGQDK***********************RNDTRDERNGAYTGDKGG****************GETPRSKGGFDSYLDQSMDSFLDKSCREESFLKRSHMPKRDLVVYDDAFDMFSPAANNLDEYEIDYVEQP****************************************DSLDIKLRKKLK********************************************TGGNDENKTPVASEVRNKNKKVKGVKEKNPSIVGDEKRRYWWRSPPGGGPNAARHKVCDDTDFQISWNDPHPPK*****************************MRGQDAFAPGGVATPSFGMNRAYEENFSKLDLSSYHDEHAVFLPNSSSEDDCDGLSHGDEANGLA***********LNSSCIDLNCDHLENDFSEEEAEEYLEETYVTDEYHECDDERCSHDDCGDLDYQQYEKLRGRQANTPTKTIGDTQGKRGGRVNTRS**************EDRLNFKGWIREMELYNVSTNVNVSDDDGLDESYNMIKTPT*******************GGKSLRNLLLRRALMNKQNEVNLWHRENQGWNQKAQGWNEHTEVQTGLNQGWHQKTQGWNEHSELQNGIDYGRLPIGHQH******************PNARISNRQRSVVPLDHPFVSNFSNSFNFDTSFSNGMSQRFSNGSQPARCFVETHKGKTRLNDVSRCEHQGEFLPSLRKRCDVGHHQVYASSPCLSKHGRIGSNKRTGFQLTSLQVDRHTQMDQYFRNGGPMMKQYLCSTQGL********************************KANDFNDTCGAVANETFD********DDENNLIVTLSEAG********************************************************************************KSISWDAYSVIDEPE**************************************PASQIALRD******************KRYGNAQSFEAARNSNPYEAPMPGAWQPVLEGTSV*******************************************************SVSHTWENHFATGTDRRSHQYPAYGSMSRHDLYFDESQLLGNEALGRGEIRGSGGGFASRVSSVGPANESGLVVAGWNRCDREGHDPARGLPMRSHFHGVKRSNHCDRKPRGGRKRLESSGNETFDIVEDLDGLSLNEGCQRVNGFGRGRKGGNGNGRGNSERLAPTCSHYRENTNSFRYLDNRVCGHKDAKSRYQGNQIRGHIKDAKPCFHGNLNETDLTYDRLSSDYDSTFSCGDFFLDSSYED********CSYEHVLRAHPAYYPSLDVPRLKAVLERQREFMESYASQMSVYLNVARNIAGNSYFDF
*********************FENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVERPKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPSLRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSAESLVKFHSLMGEINLDHAFNVGLVPDNLTGDQINWTQRVQTL*****************************************************************************************************************************GKKITNSFEAVGEIVQNDTETTKENNQTDEVPEENGLVGNPNKAEVGDLNECESCTD*******************************************************************************************WEDIPSDTIPNDETSNDNKLTPVDFDYINDFVNQTPS*TGDRPLVHGPNSVPKIDTPSDDYLVANMKACLTNDSVRVQVLMEKLDHVDASVLADWILNKHNNVAALFRSEDQSNSVRIG*N**************************************KN*KDIQSREIKSYASLSMFSPCQTTLNKFD**YN*********************************L******************************************************************************MDSFLDKSCREESFLKRSHMPKRDLVVYDDAFDMFSPAANNLDEYEIDYVEQPV****************************************SLDIKLRKKLKPGH**********************************************ENKTPVASEVRNKNKKVKGVKEKNPSIVGDEKRRYWWRSPPGGGPN****KVCDDTDFQISWNDPHP******************************************VATP*****R**EENFSKLDLSSYHDEHAVFLPN******************************SLNSSCIDLNCDHLENDFSEEEAEEYLEETYVTDEYHECDDERCSHDDCGDLDYQQYEKLRGRQANTPTK*I*******************************RLNFKGWIREMELYNVSTNVNVSDDDGLDESYNMIKT***************ER*DVGGGKSLRNLLLRRALMNKQNEVNLWHRENQGWNQKAQGWNEHTEVQTGLNQGWHQKTQGWNEHSELQNGIDYGRLPIGHQHNHD*RHK**FNHS*S*GN*********RSVVPLDHPFVSNFSNSFNFDTS*****S*******QPARCFVETHKGKTRLNDVSRCEHQGEFLPSLRKRCDVGHHQVYASSPCLSK*GRIGSNKRTGFQLTSLQVDRHTQMDQYFRNGGPMMKQYLCSTQG************************************DFNDTCGAVANETFD*****GGS*DENNLIVTLSEAGDS**********************************************************CQ***************TSYKSISWDAYSVIDEPESYDVSWRTCS***************************************G*********************QSFEAARNSNPYEAPMPGAWQPVLEGT*VF*********************************************************************RRSHQYP*YGSMSRHDLYFDESQLLGNEALGRGEIRGSGGGFASRVSSVGPANESGLVVAGWNRCDRE*********************************L****NETFDIVEDLDGLSLNEGCQRVNGFGR*****************PTCSHYRENTNSFRYLDNRVCGHKDAKSRYQGNQIRGHIKDAKPCFHGNLNETDLTYDRLSSDYDSTFSCGDFFLDSSYEDGPAHESEGCSYEHVLRAHPAYYPSLDVPRLKAVLERQREFMESYASQMSVYLNVARNIAGNSYFDF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHDIQKCARTKDVLSNIDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVERPKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPSLRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSAESLVKFHSLMGEINLDHAFNVGLVPDNLTGDQINWTQRVQTLLAKPLDQAQEREDVEQTAEESSKVENTKPLRGAPSKEVTKKGASKEGTKWNLTDGQSEEESDSENDGKPDENGSQRGSKRSKEFKTQEKCVKGAGEDENGDRKASKDEQKIDGANSAEKSLEDKHGKKITNSFEAVGEIVQNDTETTKENNQTDEVPEENGLVGNPNKAEVGDLNECESCTDSFHMNEHSDENDLGNNTKESQKQKGHKSKKKKDRKRKGNGDKRDPQGNNANQREIRDNSATLDKTEKESVNNVESKDERPPSTANNPDGTEWEDIPSDTIPNDETSNDNKLTPVDFDYINDFVNQTPSETGDRPLVHGPNSVPKIDTPSDDYLVANMKACLTNDSVRVQVLMEKLDHVDASVLADWILNKHNNVAALFRSEDQSNSVRIGDNDGTGNRSITRSKQNSQSGDHTDLKDSNRPNANTDPSTGKNVKDIQSREIKSYASLSMFSPCQTTLNKFDTQYNSSDYQSDSKPYGDRTKRRSRPRKNKENTDILNTLGQDKTSAHGRTPSGGHRTPERRRSDGVRNDTRDERNGAYTGDKGGRNRGHSVNSRKDHSFAGETPRSKGGFDSYLDQSMDSFLDKSCREESFLKRSHMPKRDLVVYDDAFDMFSPAANNLDEYEIDYVEQPVDEKKSRRELSQKMDSDRYRPDSDGDPNRRPSSQESLHHNDSLDIKLRKKLKPGHRLQRNSKKRHSKISTERSNSNSAPREKSSDAKQAANEEENITGGNDENKTPVASEVRNKNKKVKGVKEKNPSIVGDEKRRYWWRSPPGGGPNAARHKVCDDTDFQISWNDPHPPKLTHGTGKSRSKSSHSKQSKRSAENPSCRRMRGQDAFAPGGVATPSFGMNRAYEENFSKLDLSSYHDEHAVFLPNSSSEDDCDGLSHGDEANGLASEDADEYSGSSLNSSCIDLNCDHLENDFSEEEAEEYLEETYVTDEYHECDDERCSHDDCGDLDYQQYEKLRGRQANTPTKTIGDTQGKRGGRVNTRSNHVNSEDKSRVHTSEDRLNFKGWIREMELYNVSTNVNVSDDDGLDESYNMIKTPTPRKRNGASGESSVEREDVGGGKSLRNLLLRRALMNKQNEVNLWHRENQGWNQKAQGWNEHTEVQTGLNQGWHQKTQGWNEHSELQNGIDYGRLPIGHQHNHDHRHKHRFNHSSSGGNPNARISNRQRSVVPLDHPFVSNFSNSFNFDTSFSNGMSQRFSNGSQPARCFVETHKGKTRLNDVSRCEHQGEFLPSLRKRCDVGHHQVYASSPCLSKHGRIGSNKRTGFQLTSLQVDRHTQMDQYFRNGGPMMKQYLCSTQGLQRFKHHHSSSHSQSEFDPKRLHSKESSHKRNRKANDFNDTCGAVANETFDGEDSKGGSDDENNLIVTLSEAGDSEVDVEGENSPTDEDEDANNSQNDGESTAQNSQSDENSHDGESDSHSVKSNESHFGNSRCQPKTAYQSSSAQSEDGTSYKSISWDAYSVIDEPESYDVSWRTCSSESAAREKNSGQRSRGSGDKAARKSASLPASQIALRDGKGDFKSPRKASHSLKDGKRYGNAQSFEAARNSNPYEAPMPGAWQPVLEGTSVFDDAEKSSKSGPKSSKAGPKSSKPGPKSSKPGPKSSKRYPSRSGSSGLNNRTEGNSVSHTWENHFATGTDRRSHQYPAYGSMSRHDLYFDESQLLGNEALGRGEIRGSGGGFASRVSSVGPANESGLVVAGWNRCDREGHDPARGLPMRSHFHGVKRSNHCDRKPRGGRKRLESSGNETFDIVEDLDGLSLNEGCQRVNGFGRGRKGGNGNGRGNSERLAPTCSHYRENTNSFRYLDNRVCGHKDAKSRYQGNQIRGHIKDAKPCFHGNLNETDLTYDRLSSDYDSTFSCGDFFLDSSYEDGPAHESEGCSYEHVLRAHPAYYPSLDVPRLKAVLERQREFMESYASQMSVYLNVARNIAGNSYFDF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query2355 2.2.26 [Sep-21-2011]
P0C218761 Probable ATP-dependent RN yes N/A 0.154 0.478 0.434 1e-82
Q9JJY4825 Probable ATP-dependent RN yes N/A 0.153 0.438 0.458 3e-82
Q9UHI6824 Probable ATP-dependent RN yes N/A 0.150 0.429 0.467 3e-81
Q54ZI9849 Probable ATP-dependent RN yes N/A 0.154 0.427 0.346 6e-63
Q7ZVA6406 Eukaryotic initiation fac no N/A 0.146 0.849 0.345 5e-56
P0CQ72396 ATP-dependent RNA helicas yes N/A 0.142 0.845 0.361 1e-55
P0CQ73396 ATP-dependent RNA helicas N/A N/A 0.142 0.845 0.361 1e-55
B5DG42406 Eukaryotic initiation fac N/A N/A 0.146 0.849 0.345 1e-55
Q5U526415 Eukaryotic initiation fac N/A N/A 0.146 0.831 0.345 1e-55
A6QSQ0450 ATP-dependent RNA helicas N/A N/A 0.170 0.891 0.325 1e-55
>sp|P0C218|DDX20_DANRE Probable ATP-dependent RNA helicase DDX20 OS=Danio rerio GN=ddx20 PE=2 SV=1 Back     alignment and function desciption
 Score =  310 bits (793), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 162/373 (43%), Positives = 237/373 (63%), Gaps = 9/373 (2%)

Query: 2   AHDIQKCARTKDVLSNIDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDA 61
           AH++Q   RT DVL +  V F + +L+ KP+ +GL  +GF + SPIQ+ A P    G D 
Sbjct: 8   AHELQSRTRTDDVLISGGVEF-SSLLLSKPVLEGLSASGFQRPSPIQLKAIPLGRCGLDL 66

Query: 62  IVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLH 121
           IVQ+KSGTGK+ VF   AL+ LI L     Q ++LAPTREIAVQI  VV ++G+ ++ L 
Sbjct: 67  IVQAKSGTGKTCVFTTIALDSLI-LENATTQVLVLAPTREIAVQIHAVVMAIGSAMEGLE 125

Query: 122 VDYFIGGTQVERPKRPVQ---IVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLI---- 174
              FIGG  + + K+ ++   I +GSPGRIKQ+I++  L + S+RLF++DEADKL+    
Sbjct: 126 CHVFIGGRPISQDKQHLKKCHIAIGSPGRIKQLIEMGALMVSSIRLFVLDEADKLLEDDS 185

Query: 175 NTGFVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQ 234
           ++ F E I WIYS LP  KQML +SATY       L +YM +P  +R       LLG+KQ
Sbjct: 186 SSSFQEQINWIYSSLPANKQMLALSATYPESLAQQLSRYMREPTFVRLNPTDPGLLGLKQ 245

Query: 235 LVALIPECKNPSLRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEY 294
              ++P    P   + ++ + L++L S+ PFNQ ++FSN   R + + + L++    A  
Sbjct: 246 YYKIVPSHSLPHKVFEEKVQSLLELFSKIPFNQALVFSNLHTRAQHLADILSSKGLPAVC 305

Query: 295 LSGAQDQKARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMG 354
           +SG   Q  RL ++   K+ + R+L++TDL +RGIDA  V+LVINL++P D  TY+HR+G
Sbjct: 306 ISGGLSQDQRLEAMWKLKQYQCRVLISTDLTSRGIDAEKVNLVINLDVPQDWETYMHRIG 365

Query: 355 RAGRYGTRGLVIT 367
           RAGR+GT G+ +T
Sbjct: 366 RAGRFGTLGVAVT 378




The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. It may also play a role in the metabolism of snoRNPs.
Danio rerio (taxid: 7955)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q9JJY4|DDX20_MOUSE Probable ATP-dependent RNA helicase DDX20 OS=Mus musculus GN=Ddx20 PE=1 SV=2 Back     alignment and function description
>sp|Q9UHI6|DDX20_HUMAN Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens GN=DDX20 PE=1 SV=2 Back     alignment and function description
>sp|Q54ZI9|DDX20_DICDI Probable ATP-dependent RNA helicase ddx20 OS=Dictyostelium discoideum GN=ddx20 PE=3 SV=2 Back     alignment and function description
>sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 Back     alignment and function description
>sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 Back     alignment and function description
>sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 Back     alignment and function description
>sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 Back     alignment and function description
>sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 Back     alignment and function description
>sp|A6QSQ0|FAL1_AJECN ATP-dependent RNA helicase FAL1 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=FAL1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query2355
3072055251226 Probable ATP-dependent RNA helicase DDX2 0.213 0.410 0.393 7e-91
2607990811005 hypothetical protein BRAFLDRAFT_87751 [B 0.155 0.364 0.459 9e-90
3227999541251 hypothetical protein SINV_07642 [Solenop 0.166 0.314 0.422 1e-89
3838532371129 PREDICTED: uncharacterized protein LOC10 0.162 0.338 0.444 8e-89
3903394931190 PREDICTED: uncharacterized protein LOC58 0.154 0.306 0.462 4e-88
3504218691079 PREDICTED: hypothetical protein LOC10074 0.162 0.354 0.434 4e-87
3287858121084 PREDICTED: hypothetical protein LOC41121 0.162 0.352 0.434 7e-87
3454955571001 PREDICTED: hypothetical protein LOC10012 0.162 0.381 0.426 3e-86
3320265661250 Putative ATP-dependent RNA helicase DDX2 0.149 0.281 0.441 4e-86
198435536779 PREDICTED: similar to Probable ATP-depen 0.162 0.490 0.427 5e-84
>gi|307205525|gb|EFN83831.1| Probable ATP-dependent RNA helicase DDX20 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  343 bits (880), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 205/521 (39%), Positives = 300/521 (57%), Gaps = 18/521 (3%)

Query: 2   AHDIQKCARTKDVLSNIDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDA 61
           AHDI K  RT D+    +V F    L EK I  GL   GF + SPIQ+ A P    G+D 
Sbjct: 6   AHDINKKLRTSDIKIQENVTFLEMGLPEK-IMDGLSFAGFERPSPIQLKAIPIGRCGFDL 64

Query: 62  IVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLH 121
           I+++KSGTGK+ VF + AL +++ + +  PQ +I+APTREIA+QI++V++++G+ +K L 
Sbjct: 65  ILRAKSGTGKTAVFGIIAL-EILDIQISSPQVLIVAPTREIAIQISNVLKTIGSEIKGLK 123

Query: 122 VDYFIGGTQVERPKRPV---QIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGF 178
           V+YF+GG  VE  K+ +    + VG+PGRIK +I  K L + +VRLF++DEADKL+ T F
Sbjct: 124 VEYFVGGLSVEDDKKRLNECHVAVGAPGRIKHLIDKKLLKVSTVRLFVLDEADKLMETNF 183

Query: 179 VEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVAL 238
            +DI +I+S+L   KQ++  SATY  D    L+ YM  P+LI P+     L+G+KQ + +
Sbjct: 184 QKDINYIFSKLSLNKQVIASSATYPGDLEKFLEMYMCSPVLISPDLDGPILVGIKQFLVV 243

Query: 239 IPECKNPSLRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGA 298
           +    N   +   +  +L ++ ++ PF Q ++FSNYQ R + +   L +  F + Y+ G+
Sbjct: 244 VSSHLNAMKQVQIKVDELQKIFTKIPFKQSLVFSNYQSRAQSVSNKLNSMGFSSTYIIGS 303

Query: 299 QDQKARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGR 358
           QD   RL  ++  +    RIL+TTDL ARGID  NV+LVINL+IP DAATYLHR+GRAGR
Sbjct: 304 QDMAKRLEIMEKLRNFNCRILMTTDLTARGIDVENVNLVINLDIPMDAATYLHRIGRAGR 363

Query: 359 YGTRGLVITIVSAESLVKFHSLMGEINLDHAFNVGLVPD---NLTGDQINWTQRVQTLLA 415
           YGT G+ ITIVS   L  F  L+  +   + +   L PD   ++  D I   ++V    +
Sbjct: 364 YGTHGISITIVSENELQSFRELLISVGGPNFYLFKLGPDYVEDVWADNITVFEKVY---S 420

Query: 416 KPLDQAQEREDVEQTAEESSKVENTKPLRGAPSKEVTKKGASKEGTKWNLTDGQSEEESD 475
           KP     E  D+++   ES   EN  P+    + E T    S   +K   T+  S E S 
Sbjct: 421 KPEANGTELSDIDKGILES---ENGTPM-AILTSENTTFSTSSYNSKHIDTNTCSLENSG 476

Query: 476 SENDGKPDENGSQRGSKRSKEFKTQEKCVKGAGEDENGDRK 516
           + N      NG+Q  SK        +KC K    +    RK
Sbjct: 477 TNNTANL-SNGNQNKSKSI--LSKDKKCDKAITNETYTKRK 514




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|260799081|ref|XP_002594528.1| hypothetical protein BRAFLDRAFT_87751 [Branchiostoma floridae] gi|229279762|gb|EEN50539.1| hypothetical protein BRAFLDRAFT_87751 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|322799954|gb|EFZ21080.1| hypothetical protein SINV_07642 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383853237|ref|XP_003702129.1| PREDICTED: uncharacterized protein LOC100882286 [Megachile rotundata] Back     alignment and taxonomy information
>gi|390339493|ref|XP_793570.2| PREDICTED: uncharacterized protein LOC588813 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|350421869|ref|XP_003492983.1| PREDICTED: hypothetical protein LOC100742995 [Bombus impatiens] Back     alignment and taxonomy information
>gi|328785812|ref|XP_394691.4| PREDICTED: hypothetical protein LOC411217 [Apis mellifera] Back     alignment and taxonomy information
>gi|345495557|ref|XP_001604556.2| PREDICTED: hypothetical protein LOC100120961 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332026566|gb|EGI66684.1| Putative ATP-dependent RNA helicase DDX20 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|198435536|ref|XP_002132135.1| PREDICTED: similar to Probable ATP-dependent RNA helicase DDX20 (DEAD box protein 20) [Ciona intestinalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query2355
UNIPROTKB|F1PXG6825 DDX20 "Uncharacterized protein 0.153 0.438 0.466 9.5e-84
UNIPROTKB|J9P828825 DDX20 "Uncharacterized protein 0.153 0.438 0.466 9.5e-84
UNIPROTKB|F1MRW7825 DDX20 "Uncharacterized protein 0.153 0.438 0.466 1.2e-81
MGI|MGI:1858415825 Ddx20 "DEAD (Asp-Glu-Ala-Asp) 0.203 0.581 0.388 2.9e-81
UNIPROTKB|F1SBP3832 DDX20 "Uncharacterized protein 0.214 0.605 0.382 1.3e-80
UNIPROTKB|F1MAM8824 Ddx20 "Protein Ddx20" [Rattus 0.153 0.439 0.458 6.1e-80
UNIPROTKB|Q9UHI6824 DDX20 "Probable ATP-dependent 0.205 0.588 0.387 7.8e-79
UNIPROTKB|E9PSX0826 Ddx20 "Protein Ddx20" [Rattus 0.153 0.438 0.456 9e-79
ZFIN|ZDB-GENE-030131-202789 ddx20 "DEAD (Asp-Glu-Ala-Asp) 0.194 0.580 0.382 1.4e-77
UNIPROTKB|F1NRN3676 DDX20 "Uncharacterized protein 0.215 0.751 0.363 7.7e-76
UNIPROTKB|F1PXG6 DDX20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 778 (278.9 bits), Expect = 9.5e-84, Sum P(3) = 9.5e-84
 Identities = 174/373 (46%), Positives = 233/373 (62%)

Query:     2 AHDIQ-KCARTKDVLSNIDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYD 60
             AHD+    ART DVL      FE+ +L+ +P+  GL+  GF + SP+Q+ A P    G D
Sbjct:    45 AHDVSGPRARTGDVLLAEPADFES-LLLSRPVLDGLRAAGFERPSPVQLKAIPLGRCGLD 103

Query:    61 AIVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNL 120
              IVQ+KSGTGK+ VF   AL+ L+ L  Q  Q +ILAPTREIAVQI  V+ ++G  ++ L
Sbjct:   104 LIVQAKSGTGKTCVFSTIALDSLV-LENQSTQILILAPTREIAVQIHSVITAIGIKMEGL 162

Query:   121 HVDYFIGGTQVERPK---RPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTG 177
                 FIGGT + + K   +   I VGSPGRIKQ+I+L YLN  S+RLFI+DEADKL+  G
Sbjct:   163 ECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEG 222

Query:   178 -FVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLV 236
              F E I WIYS LP  KQML VSATY       L KYM DP  +R   +   L+G+KQ  
Sbjct:   223 SFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRLNSSDPSLIGLKQYY 282

Query:   237 ALIPECKNPSLRYVDEEKK--LVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEY 294
              ++     P    + EEK   L +L S+ PFNQ ++FSN   R + + + L+   F AE 
Sbjct:   283 KIVNSY--PLAHKIFEEKAQHLQELFSRIPFNQALVFSNLHSRAQHLADILSAKGFPAEC 340

Query:   295 LSGAQDQKARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMG 354
             +SG  +Q  RL ++   K    R+L++TDL +RGIDA  V+LV+NL++P D  TY+HR+G
Sbjct:   341 ISGNMNQNQRLDAMAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIG 400

Query:   355 RAGRYGTRGLVIT 367
             RAGR+GT GL +T
Sbjct:   401 RAGRFGTLGLTVT 413


GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|J9P828 DDX20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MRW7 DDX20 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1858415 Ddx20 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 20" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBP3 DDX20 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAM8 Ddx20 "Protein Ddx20" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UHI6 DDX20 "Probable ATP-dependent RNA helicase DDX20" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSX0 Ddx20 "Protein Ddx20" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-202 ddx20 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 20" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NRN3 DDX20 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.737
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2355
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 5e-93
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 7e-68
cd00268203 cd00268, DEADc, DEAD-box helicases 3e-60
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-58
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 6e-54
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-50
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 2e-49
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-47
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 5e-46
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 1e-44
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 4e-43
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-41
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 2e-35
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 4e-34
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 7e-33
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-29
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-22
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-21
COG1201814 COG1201, Lhr, Lhr-like helicases [General function 1e-08
PRK11057607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 2e-07
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 3e-07
PRK13766773 PRK13766, PRK13766, Hef nuclease; Provisional 2e-06
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 1e-05
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 1e-05
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 8e-05
PRK05580679 PRK05580, PRK05580, primosome assembly protein Pri 1e-04
TIGR00595505 TIGR00595, priA, primosomal protein N' 2e-04
TIGR04121803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 2e-04
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 5e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 8e-04
COG1198730 COG1198, PriA, Primosomal protein N' (replication 0.001
COG52714600 COG5271, MDN1, AAA ATPase containing von Willebran 0.002
PRK097511490 PRK09751, PRK09751, putative ATP-dependent helicas 0.002
COG1205851 COG1205, COG1205, Distinct helicase family with a 0.003
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
 Score =  311 bits (799), Expect = 5e-93
 Identities = 142/507 (28%), Positives = 235/507 (46%), Gaps = 37/507 (7%)

Query: 28  IEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLP 87
           +   + Q L++ GF + +PIQ+AA P +L G D + Q+++GTGK+  F++  L K++K  
Sbjct: 36  LSPELLQALKDLGFEEPTPIQLAAIPLILAGRDVLGQAQTGTGKTAAFLLPLLQKILKSV 95

Query: 88  -VQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGT----QVERPKRPVQIVV 142
             +    +ILAPTRE+AVQI + +R +G ++  L V    GG     Q+E  KR V IVV
Sbjct: 96  ERKYVSALILAPTRELAVQIAEELRKLGKNLGGLRVAVVYGGVSIRKQIEALKRGVDIVV 155

Query: 143 GSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPMKQMLVVSATY 202
            +PGR+  +IK   L++  V   ++DEAD++++ GF++DI  I   LPP +Q L+ SAT 
Sbjct: 156 ATPGRLLDLIKRGKLDLSGVETLVLDEADRMLDMGFIDDIEKILKALPPDRQTLLFSATM 215

Query: 203 SHDNLATLQKYMVDPLLIR--PEDATRPLLGVKQLVALIPECKNPSLRYVDEEKKLVQLL 260
             D     ++Y+ DP+ I    E   R L  +KQ      E ++   +     + L++LL
Sbjct: 216 PDDIRELARRYLNDPVEIEVSVEKLERTLKKIKQFYL---EVESEEEK----LELLLKLL 268

Query: 261 SQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLDSFKRGKVRILV 320
                 + ++F   +   E + E+L    F    L G   Q+ R  +L+ FK G++R+LV
Sbjct: 269 KDEDEGRVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEKFKDGELRVLV 328

Query: 321 TTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSA-ESLVKFHS 379
            TD+AARG+D  +V  VIN ++P D   Y+HR+GR GR G +G+ I+ V+  E + K   
Sbjct: 329 ATDVAARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGRKGVAISFVTEEEEVKKLKR 388

Query: 380 LMGEINLDHAFNVGLVPDNLTGDQINWTQRVQTLLAKPLDQAQEREDVEQTAEESSKVEN 439
           +                      ++     +     +P D    +       EES   + 
Sbjct: 389 IE----------------KRLERKLPSAVLLPLD--EPEDAKLLKTTRPGLEEESDISDE 430

Query: 440 TKPLRGAPSKEVTKKGASKEGTKWNLTDGQSEEESDSENDGKPDENGSQRGSKRSKEFKT 499
            K L+ +    +   G     +K     G+    +       P+       S        
Sbjct: 431 IKKLKSSKKALLRGLGVRFTLSKLLANLGKEIPGAGDAVTIDPELERRSPNSAD----DI 486

Query: 500 QEKCVKGAGEDENGDRKASKDEQKIDG 526
           +      +   E    K      K+  
Sbjct: 487 EYILKGLSYRAEERTAKNEAANIKLQS 513


Length = 513

>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|235514 PRK05580, PRK05580, primosome assembly protein PriA; Validated Back     alignment and domain information
>gnl|CDD|233040 TIGR00595, priA, primosomal protein N' Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|224119 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 2355
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0330|consensus476 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0331|consensus519 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0338|consensus691 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0328|consensus400 100.0
KOG0333|consensus673 100.0
KOG0345|consensus567 100.0
KOG0326|consensus459 100.0
KOG0343|consensus758 100.0
KOG0342|consensus543 100.0
KOG0340|consensus442 100.0
KOG0335|consensus482 100.0
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG4284|consensus980 100.0
KOG0348|consensus708 100.0
KOG0346|consensus569 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0341|consensus610 100.0
KOG0332|consensus477 100.0
KOG0336|consensus629 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
KOG0384|consensus1373 100.0
KOG0385|consensus971 100.0
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0339|consensus731 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0327|consensus397 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
KOG0347|consensus731 100.0
KOG0334|consensus997 100.0
PRK13767876 ATP-dependent helicase; Provisional 100.0
KOG0350|consensus620 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
KOG0386|consensus1157 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
COG1201814 Lhr Lhr-like helicases [General function predictio 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
KOG0344|consensus593 100.0
KOG0337|consensus529 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
PLN031421033 Probable chromatin-remodeling complex ATPase chain 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
TIGR02621844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
PRK13766773 Hef nuclease; Provisional 100.0
PRK097511490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK04914956 ATP-dependent helicase HepA; Validated 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
COG1202830 Superfamily II helicase, archaea-specific [General 99.97
KOG0389|consensus941 99.97
KOG0354|consensus746 99.97
PHA02653675 RNA helicase NPH-II; Provisional 99.97
TIGR01970819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.97
KOG0387|consensus923 99.97
KOG0952|consensus1230 99.97
PRK094011176 reverse gyrase; Reviewed 99.97
PRK147011638 reverse gyrase; Provisional 99.97
COG1205851 Distinct helicase family with a unique C-terminal 99.97
PRK11664812 ATP-dependent RNA helicase HrpB; Provisional 99.97
KOG0329|consensus387 99.97
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.96
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.96
TIGR010541171 rgy reverse gyrase. Generally, these gyrases are e 99.96
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.96
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.95
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.95
KOG0947|consensus1248 99.95
KOG0351|consensus941 99.95
KOG0388|consensus1185 99.95
PRK05580679 primosome assembly protein PriA; Validated 99.95
KOG0951|consensus1674 99.95
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.95
KOG0392|consensus1549 99.95
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.94
KOG0391|consensus1958 99.94
KOG1123|consensus776 99.94
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.94
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.94
KOG0948|consensus1041 99.93
KOG0352|consensus641 99.93
COG45811041 Superfamily II RNA helicase [DNA replication, reco 99.93
PRK111311294 ATP-dependent RNA helicase HrpA; Provisional 99.93
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.93
KOG0353|consensus695 99.92
KOG0349|consensus725 99.92
PRK09694878 helicase Cas3; Provisional 99.92
KOG0390|consensus776 99.92
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.92
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.91
TIGR019671283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.91
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.9
KOG0950|consensus1008 99.89
KOG1000|consensus689 99.89
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.89
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.87
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.87
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.85
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.85
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.85
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.84
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.84
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.84
PRK12899970 secA preprotein translocase subunit SecA; Reviewed 99.84
KOG1002|consensus791 99.82
COG1643845 HrpA HrpA-like helicases [DNA replication, recombi 99.81
KOG1015|consensus1567 99.8
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.79
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.79
PRK05298652 excinuclease ABC subunit B; Provisional 99.77
KOG0949|consensus1330 99.76
COG11101187 Reverse gyrase [DNA replication, recombination, an 99.76
KOG0922|consensus674 99.75
smart00487201 DEXDc DEAD-like helicases superfamily. 99.75
KOG4439|consensus901 99.75
KOG0920|consensus924 99.74
COG4096875 HsdR Type I site-specific restriction-modification 99.74
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.69
COG48891518 Predicted helicase [General function prediction on 99.66
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.66
KOG0923|consensus902 99.65
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.65
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.64
KOG0924|consensus1042 99.64
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.63
KOG0926|consensus1172 99.62
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.6
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.6
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.59
KOG0951|consensus1674 99.58
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 99.55
KOG0953|consensus700 99.55
KOG1016|consensus1387 99.55
KOG4150|consensus1034 99.55
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.53
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.52
KOG0383|consensus696 99.5
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.5
CHL00122870 secA preprotein translocase subunit SecA; Validate 99.49
PRK14873665 primosome assembly protein PriA; Provisional 99.49
KOG0925|consensus699 99.47
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.46
PRK12902939 secA preprotein translocase subunit SecA; Reviewed 99.44
smart0049082 HELICc helicase superfamily c-terminal domain. 99.4
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 99.38
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.37
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.3
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 99.24
KOG1001|consensus674 99.19
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.16
PF02399824 Herpes_ori_bp: Origin of replication binding prote 99.1
COG0610962 Type I site-specific restriction-modification syst 98.85
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.76
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.74
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.74
PRK15483986 type III restriction-modification system StyLTI en 98.74
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 98.65
KOG0921|consensus1282 98.61
KOG2340|consensus698 98.56
KOG0952|consensus1230 98.47
TIGR00596814 rad1 DNA repair protein (rad1). This family is bas 98.21
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.15
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.14
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.11
KOG1133|consensus821 97.9
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.87
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.84
COG3587985 Restriction endonuclease [Defense mechanisms] 97.75
KOG1802|consensus935 97.57
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.52
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.44
KOG0298|consensus1394 97.43
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.4
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.31
PRK10536262 hypothetical protein; Provisional 97.3
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.27
KOG1803|consensus649 97.12
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.04
PRK13889988 conjugal transfer relaxase TraA; Provisional 96.84
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.74
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.73
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.72
PRK04296190 thymidine kinase; Provisional 96.62
PRK08181269 transposase; Validated 96.54
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.53
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.53
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.52
PF1324576 AAA_19: Part of AAA domain 96.48
PRK06526254 transposase; Provisional 96.47
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.44
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.36
KOG1132|consensus945 96.35
COG3421812 Uncharacterized protein conserved in bacteria [Fun 96.31
smart00382148 AAA ATPases associated with a variety of cellular 96.3
PRK138261102 Dtr system oriT relaxase; Provisional 96.24
PRK14974336 cell division protein FtsY; Provisional 96.13
PF13871278 Helicase_C_4: Helicase_C-like 95.98
KOG0298|consensus1394 95.95
PHA02533534 17 large terminase protein; Provisional 95.87
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.54
TIGR00376637 DNA helicase, putative. The gene product may repre 95.51
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 95.44
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 95.34
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.27
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.23
KOG1131|consensus755 95.2
KOG1513|consensus1300 95.18
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 95.18
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.08
KOG1805|consensus1100 94.83
TIGR01075715 uvrD DNA helicase II. Designed to identify uvrD me 94.74
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.72
PRK137091747 conjugal transfer nickase/helicase TraI; Provision 94.63
PRK147121623 conjugal transfer nickase/helicase TraI; Provision 94.62
PRK08116268 hypothetical protein; Validated 94.58
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 94.5
PRK05707328 DNA polymerase III subunit delta'; Validated 94.49
TIGR027601960 TraI_TIGR conjugative transfer relaxase protein Tr 94.47
PRK11773721 uvrD DNA-dependent helicase II; Provisional 94.41
PRK07952244 DNA replication protein DnaC; Validated 94.35
PRK00149450 dnaA chromosomal replication initiation protein; R 94.24
PHA03333752 putative ATPase subunit of terminase; Provisional 94.22
PRK09183259 transposase/IS protein; Provisional 94.19
PTZ001121164 origin recognition complex 1 protein; Provisional 94.13
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 94.12
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.08
PRK06835329 DNA replication protein DnaC; Validated 93.95
PHA03368738 DNA packaging terminase subunit 1; Provisional 93.94
PRK06921266 hypothetical protein; Provisional 93.92
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.87
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 93.78
PRK12377248 putative replication protein; Provisional 93.69
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 93.65
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 93.64
PTZ00293211 thymidine kinase; Provisional 93.64
PRK11054684 helD DNA helicase IV; Provisional 93.62
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.52
PF00004132 AAA: ATPase family associated with various cellula 93.3
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.18
PRK05642234 DNA replication initiation factor; Validated 93.14
TIGR027601960 TraI_TIGR conjugative transfer relaxase protein Tr 93.14
PRK00771437 signal recognition particle protein Srp54; Provisi 93.07
PRK06893229 DNA replication initiation factor; Validated 93.07
COG4626546 Phage terminase-like protein, large subunit [Gener 92.8
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 92.79
PRK12402337 replication factor C small subunit 2; Reviewed 92.75
PRK08769319 DNA polymerase III subunit delta'; Validated 92.72
TIGR02928365 orc1/cdc6 family replication initiation protein. M 92.71
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 92.68
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 92.55
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 92.52
PRK14087450 dnaA chromosomal replication initiation protein; P 92.43
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 92.43
PRK08727233 hypothetical protein; Validated 92.36
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 92.35
PHA02544316 44 clamp loader, small subunit; Provisional 92.31
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 92.29
PRK12422445 chromosomal replication initiation protein; Provis 92.27
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 92.09
KOG0989|consensus346 92.08
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 92.07
PRK14088440 dnaA chromosomal replication initiation protein; P 91.97
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 91.96
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 91.94
PRK08084235 DNA replication initiation factor; Provisional 91.9
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 91.82
PRK13342413 recombination factor protein RarA; Reviewed 91.81
PRK14949944 DNA polymerase III subunits gamma and tau; Provisi 91.8
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 91.61
PRK08699325 DNA polymerase III subunit delta'; Validated 91.49
PRK09112351 DNA polymerase III subunit delta'; Validated 91.45
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 91.4
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 91.32
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 91.16
COG2256436 MGS1 ATPase related to the helicase subunit of the 91.1
PLN03025319 replication factor C subunit; Provisional 91.03
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 90.98
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 90.97
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 90.94
TIGR027851232 addA_Gpos recombination helicase AddA, Firmicutes 90.84
COG3973747 Superfamily I DNA and RNA helicases [General funct 90.73
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 90.7
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 90.67
TIGR01073726 pcrA ATP-dependent DNA helicase PcrA. Designed to 90.64
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 90.58
PRK08903227 DnaA regulatory inactivator Hda; Validated 90.53
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 90.51
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 90.47
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 90.46
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 90.38
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 90.31
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 90.26
COG0470325 HolB ATPase involved in DNA replication [DNA repli 90.22
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 90.19
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 90.15
PRK14086617 dnaA chromosomal replication initiation protein; P 90.13
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 90.09
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 89.96
PRK13341725 recombination factor protein RarA/unknown domain f 89.93
PF13173128 AAA_14: AAA domain 89.78
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 89.73
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 89.72
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 89.71
CHL00181287 cbbX CbbX; Provisional 89.62
PRK06871325 DNA polymerase III subunit delta'; Validated 89.57
PRK08533230 flagellar accessory protein FlaH; Reviewed 89.46
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 89.44
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 89.43
PRK08939306 primosomal protein DnaI; Reviewed 89.41
PRK07940394 DNA polymerase III subunit delta'; Validated 89.35
PRK07471365 DNA polymerase III subunit delta'; Validated 89.28
TIGR00064272 ftsY signal recognition particle-docking protein F 89.25
PF05729166 NACHT: NACHT domain 89.23
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 89.23
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 89.21
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 89.12
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 89.01
PRK05580679 primosome assembly protein PriA; Validated 88.92
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 88.89
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 88.81
PRK00440319 rfc replication factor C small subunit; Reviewed 88.81
cd03115173 SRP The signal recognition particle (SRP) mediates 88.7
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 88.59
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 88.23
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 88.15
TIGR00595505 priA primosomal protein N'. All proteins in this f 88.04
PRK10867433 signal recognition particle protein; Provisional 87.92
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 87.82
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 87.73
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 87.67
COG0552340 FtsY Signal recognition particle GTPase [Intracell 87.57
PRK13833323 conjugal transfer protein TrbB; Provisional 87.54
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 87.39
PRK06067234 flagellar accessory protein FlaH; Validated 87.37
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 87.37
PRK07993334 DNA polymerase III subunit delta'; Validated 87.34
KOG0738|consensus491 87.27
PRK06964342 DNA polymerase III subunit delta'; Validated 87.19
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 87.18
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 87.17
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 87.07
PRK11331459 5-methylcytosine-specific restriction enzyme subun 86.92
TIGR00643630 recG ATP-dependent DNA helicase RecG. 86.85
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 86.74
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 86.64
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 86.63
PRK11823446 DNA repair protein RadA; Provisional 86.62
PRK04195482 replication factor C large subunit; Provisional 86.58
PRK04328249 hypothetical protein; Provisional 86.54
KOG2028|consensus554 86.52
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 86.44
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 86.39
COG2109198 BtuR ATP:corrinoid adenosyltransferase [Coenzyme m 86.02
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 85.9
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 85.87
PRK13894319 conjugal transfer ATPase TrbB; Provisional 85.85
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 85.78
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 85.61
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 85.54
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 85.47
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 85.46
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 85.39
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 85.32
TIGR00959428 ffh signal recognition particle protein. This mode 85.27
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 85.23
PRK10416318 signal recognition particle-docking protein FtsY; 85.19
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 85.02
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 84.62
COG0593408 DnaA ATPase involved in DNA replication initiation 84.59
PRK06090319 DNA polymerase III subunit delta'; Validated 84.52
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 84.51
KOG0739|consensus439 84.22
COG2255332 RuvB Holliday junction resolvasome, helicase subun 84.09
PRK14873665 primosome assembly protein PriA; Provisional 84.04
COG11101187 Reverse gyrase [DNA replication, recombination, an 83.97
PRK10865857 protein disaggregation chaperone; Provisional 83.6
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 83.54
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 83.46
PRK04841903 transcriptional regulator MalT; Provisional 83.24
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 83.21
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 83.2
KOG0701|consensus1606 82.99
CHL00095821 clpC Clp protease ATP binding subunit 82.88
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 82.44
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 82.4
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 82.29
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 82.12
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 81.63
PHA00729226 NTP-binding motif containing protein 81.56
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 81.55
PRK07399314 DNA polymerase III subunit delta'; Validated 81.51
PRK07413382 hypothetical protein; Validated 81.06
PRK05973237 replicative DNA helicase; Provisional 80.91
PRK09354349 recA recombinase A; Provisional 80.72
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 80.62
PRK08058329 DNA polymerase III subunit delta'; Validated 80.55
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 80.54
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 80.37
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 80.33
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.3e-48  Score=457.74  Aligned_cols=357  Identities=31%  Similarity=0.525  Sum_probs=307.2

Q ss_pred             ccCcccCCcHH-HHHHHHHCCCCCCcHHHHHHHHHHHcCCcEEEEccCCchHHHHHHHHHHHHHHhcC------CCCCeE
Q psy8497          21 LFENDVLIEKP-IRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLP------VQQPQT   93 (2355)
Q Consensus        21 V~SFEeLlLkp-LLK~Lqa~GF~eLRPYQeEALn~LLSGRNVILAAPTGSGKTLVALIAILerL~ekr------~qggRV   93 (2355)
                      ..+|+++++++ +++.|...||..|+|+|.++|+.++.++++|+++|||+|||++|+++++..+....      ..++++
T Consensus         7 ~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~aip~il~g~dvi~~ApTGsGKTla~llp~l~~l~~~~~~~~~~~~~~~~   86 (423)
T PRK04837          7 EQKFSDFALHPQVVEALEKKGFHNCTPIQALALPLTLAGRDVAGQAQTGTGKTMAFLTATFHYLLSHPAPEDRKVNQPRA   86 (423)
T ss_pred             CCCHhhCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHhCCCcEEEECCCCchHHHHHHHHHHHHHHhcccccccccCCceE
Confidence            46899999998 99999999999999999999999999999999999999999999999998886422      235789


Q ss_pred             EEEcccHHHHHHHHHHHHHHhcccCCcEEEEEECCccccC----CCCCCcEEEECHHHHHHHHHhhcccCcCceEEEecc
Q psy8497          94 IILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVER----PKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDE  169 (2355)
Q Consensus        94 LILVPTRALAqQ~anwLREFgk~APgLrVVvytGGkq~rk----qirq~DILVTTPErLLDLLdrr~LdLSkIdLLIVDE  169 (2355)
                      |||+|+++|+.|+.+.+..+.... ++.+.+++|+.....    ....++|||+||++|.+++....+.+..+.+|||||
T Consensus        87 lil~PtreLa~Qi~~~~~~l~~~~-~~~v~~~~gg~~~~~~~~~l~~~~~IlV~TP~~l~~~l~~~~~~l~~v~~lViDE  165 (423)
T PRK04837         87 LIMAPTRELAVQIHADAEPLAQAT-GLKLGLAYGGDGYDKQLKVLESGVDILIGTTGRLIDYAKQNHINLGAIQVVVLDE  165 (423)
T ss_pred             EEECCcHHHHHHHHHHHHHHhccC-CceEEEEECCCCHHHHHHHhcCCCCEEEECHHHHHHHHHcCCcccccccEEEEec
Confidence            999999999999999999998777 789999998865332    223489999999999999988888899999999999


Q ss_pred             cchhcccChHHHHHHHHHhCCC--CceEEEEEeccChhHHHHHHHhccCCeeeccCCCccccccceEEEEeccCCCCCcc
Q psy8497         170 ADKLINTGFVEDITWIYSQLPP--MKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPSL  247 (2355)
Q Consensus       170 AHRLkN~GF~SrLeeILs~Lpp--nrQILLLSATLS~EILElLkKfLrdPvIIrVesee~~~seVrQvVvqVpe~kn~sL  247 (2355)
                      ||++.+.+|...+..++..++.  ..+.+++|||++......+..++..+..+.+.........+.+.+....       
T Consensus       166 ad~l~~~~f~~~i~~i~~~~~~~~~~~~~l~SAT~~~~~~~~~~~~~~~p~~i~v~~~~~~~~~i~~~~~~~~-------  238 (423)
T PRK04837        166 ADRMFDLGFIKDIRWLFRRMPPANQRLNMLFSATLSYRVRELAFEHMNNPEYVEVEPEQKTGHRIKEELFYPS-------  238 (423)
T ss_pred             HHHHhhcccHHHHHHHHHhCCCccceeEEEEeccCCHHHHHHHHHHCCCCEEEEEcCCCcCCCceeEEEEeCC-------
Confidence            9999999999999999998874  4567999999998888888888888877766544433333433332211       


Q ss_pred             hhhhHHHHHHHHHhcCCCCeEEEEEcccccHHHHHHHHHhcCCccEEeeCCCCHHHHHHHHHHHhCCCccEEEEeccccc
Q psy8497         248 RYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLDSFKRGKVRILVTTDLAAR  327 (2355)
Q Consensus       248 t~lsKkeaLLqLLerl~kgRVLVFSQTRKmAEiLADyLrErGIKVarLHGgMSqEERqeILErFRSGEIdVLVSTSALGE  327 (2355)
                       ...+...|..++......++||||+++..++.|+..|...++.+..+||+|++.+|..+++.|++|+++|||||+++++
T Consensus       239 -~~~k~~~l~~ll~~~~~~~~lVF~~t~~~~~~l~~~L~~~g~~v~~lhg~~~~~~R~~~l~~F~~g~~~vLVaTdv~~r  317 (423)
T PRK04837        239 -NEEKMRLLQTLIEEEWPDRAIIFANTKHRCEEIWGHLAADGHRVGLLTGDVAQKKRLRILEEFTRGDLDILVATDVAAR  317 (423)
T ss_pred             -HHHHHHHHHHHHHhcCCCeEEEEECCHHHHHHHHHHHHhCCCcEEEecCCCChhHHHHHHHHHHcCCCcEEEEechhhc
Confidence             1234566777776666679999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCccEEEEecCCCCHhHHHHHhhccCCCCCccEEEEEEcccCHHHHHHHHHhhcc
Q psy8497         328 GIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSAESLVKFHSLMGEINL  386 (2355)
Q Consensus       328 GLDLPaVDTVIIyDSP~SPqSYIQRIGRAGRiGQkGkVIVLVSsdDVEeIEsLrReLKL  386 (2355)
                      |||+|++++||+||+|.++..|+||+||+||.|+.|.+|+|+...+...+..+.+.+..
T Consensus       318 GiDip~v~~VI~~d~P~s~~~yiqR~GR~gR~G~~G~ai~~~~~~~~~~~~~i~~~~~~  376 (423)
T PRK04837        318 GLHIPAVTHVFNYDLPDDCEDYVHRIGRTGRAGASGHSISLACEEYALNLPAIETYIGH  376 (423)
T ss_pred             CCCccccCEEEEeCCCCchhheEeccccccCCCCCeeEEEEeCHHHHHHHHHHHHHhCC
Confidence            99999999999999999999999999999999999999999998877777776554443



>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07413 hypothetical protein; Validated Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2355
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 1e-56
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 2e-56
2hyi_C413 Structure Of The Human Exon Junction Complex With A 2e-56
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 3e-56
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 9e-54
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-53
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 8e-52
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 6e-51
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 1e-50
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-50
2vso_A395 Crystal Structure Of A Translation Initiation Compl 2e-49
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 2e-49
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 2e-47
1fuu_A394 Yeast Initiation Factor 4a Length = 394 3e-46
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 2e-45
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 8e-42
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 2e-41
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 2e-41
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 2e-41
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 7e-38
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 2e-36
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 6e-34
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 1e-33
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 1e-33
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 4e-32
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 8e-32
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 9e-32
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 4e-30
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 1e-28
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 7e-27
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 5e-26
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 1e-25
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 5e-25
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 4e-24
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 3e-23
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 2e-22
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 7e-22
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 2e-21
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 5e-21
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 2e-19
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 3e-18
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 4e-18
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 7e-18
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 7e-17
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-16
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 1e-16
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 6e-16
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 2e-15
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 3e-15
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 4e-15
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 6e-15
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 1e-14
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 4e-14
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 2e-13
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 6e-13
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 3e-12
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 3e-12
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 4e-12
2jgn_A185 Ddx3 Helicase Domain Length = 185 3e-11
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 3e-09
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 4e-09
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 6e-09
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 7e-09
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 8e-08
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 8e-08
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 8e-08
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 9e-07
1wp9_A494 Crystal Structure Of Pyrococcus Furiosus Hef Helica 7e-06
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure

Iteration: 1

Score = 219 bits (559), Expect = 1e-56, Method: Composition-based stats. Identities = 125/365 (34%), Positives = 203/365 (55%), Gaps = 20/365 (5%) Query: 18 IDVLFENDVL-IEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFV 76 +DV D + + + + +G+ GF K S IQ A ++ G D I QS+SGTGK+ F Sbjct: 12 VDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFS 71 Query: 77 VAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVERPKR 136 ++ L + + + V++ Q +ILAPTRE+AVQI + ++G ++ N+ IGGT V R Sbjct: 72 ISVL-QCLDIQVRETQALILAPTRELAVQIQKGLLALGDYM-NVQCHACIGGTNVGEDIR 129 Query: 137 PV----QIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPM 192 + +V G+PGR+ MI+ + L ++++ ++DEAD+++N GF E I +Y LPP Sbjct: 130 KLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPA 189 Query: 193 KQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPSLRYVDE 252 Q++++SAT H+ L K+M DP+ I + L G+KQ + E Sbjct: 190 TQVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVER----------E 239 Query: 253 EKK---LVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLD 309 E K L L Q VIF N + + + + E + ANF + G QK R + + Sbjct: 240 EWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMK 299 Query: 310 SFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIV 369 F+ G R+L++TD+ ARG+D V L+IN ++P++ Y+HR+GR+GRYG +G+ I V Sbjct: 300 EFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFV 359 Query: 370 SAESL 374 + + Sbjct: 360 KNDDI 364
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query2355
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-107
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-103
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-102
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-102
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-101
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 1e-101
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 3e-99
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 1e-96
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-96
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 5e-82
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 3e-80
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 4e-74
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 2e-72
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 4e-69
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 2e-64
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 9e-63
3bor_A237 Human initiation factor 4A-II; translation initiat 9e-63
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 3e-62
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 9e-61
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 3e-59
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 5e-59
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 6e-56
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 7e-56
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 3e-50
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-42
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 3e-41
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 3e-41
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 2e-37
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 2e-37
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 3e-37
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 3e-36
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-35
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 3e-35
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 4e-35
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 6e-35
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 2e-33
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 1e-27
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 1e-26
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 1e-25
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 2e-25
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-15
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 1e-11
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 4e-11
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 1e-10
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 1e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 2e-08
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 4e-07
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 5e-07
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 1e-06
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 2e-06
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 3e-06
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 4e-06
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 6e-04
1yks_A440 Genome polyprotein [contains: flavivirin protease 5e-06
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 1e-05
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
 Score =  347 bits (892), Expect = e-107
 Identities = 131/370 (35%), Positives = 197/370 (53%), Gaps = 22/370 (5%)

Query: 10  RTKDVLSNIDVLFENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGT 69
           +T DVL+     FE D  +++ +  G+ E GF K SPIQ  A P  + G D + ++K+GT
Sbjct: 11  QTDDVLNTKGNTFE-DFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGT 69

Query: 70  GKSIVFVVAALNKLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGT 129
           GK+  FV+  L K +K  + + Q +I+ PTRE+A+Q + VVR++G H   +      GGT
Sbjct: 70  GKTAAFVIPTLEK-VKPKLNKIQALIMVPTRELALQTSQVVRTLGKH-CGISCMVTTGGT 127

Query: 130 ----QVERPKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWI 185
                + R    V I+VG+PGR+  +   K  ++    LFIMDEADK+++  F   I  I
Sbjct: 128 NLRDDILRLNETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQI 187

Query: 186 YSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNP 245
            S LPP  Q L+ SAT+       + K++  P  I   +    L G+ Q  A        
Sbjct: 188 LSFLPPTHQSLLFSATFPLTVKEFMVKHLHKPYEINLME-ELTLKGITQYYA-------- 238

Query: 246 SLRYVDEEKK---LVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQK 302
              +V+E +K   L  L S+   NQ +IF N   R E++ + + +  +   Y      Q+
Sbjct: 239 ---FVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQ 295

Query: 303 ARLASLDSFKRGKVRILVTTDLAARGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTR 362
            R      F++GKVR LV +DL  RGID   V++VIN + P  A TYLHR+GR+GR+G  
Sbjct: 296 ERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHL 355

Query: 363 GLVITIVSAE 372
           GL I +++  
Sbjct: 356 GLAINLINWN 365


>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query2355
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
3l9o_A1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2xgj_A1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4a4z_A997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4f92_B1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4ddu_A1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
1gku_B1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.97
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.97
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 99.97
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.97
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.97
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.97
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.97
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.97
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.97
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.96
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.96
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.96
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.96
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.96
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.96
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.96
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.96
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.95
3bor_A237 Human initiation factor 4A-II; translation initiat 99.95
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.95
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.95
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.95
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.95
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.95
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.95
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.94
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.93
3jux_A822 Protein translocase subunit SECA; protein transloc 99.93
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.92
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.89
2ipc_A997 Preprotein translocase SECA subunit; nucleotide bi 99.87
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.86
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.86
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.85
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.85
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.85
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.84
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.83
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.83
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.83
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.8
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.79
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.79
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.65
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.73
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.72
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.7
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.66
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 98.84
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.35
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.82
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.75
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.74
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.71
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.66
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.66
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.53
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.18
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.97
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.59
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.58
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.48
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.46
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 95.43
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.11
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.1
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.07
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 94.93
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 94.6
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.51
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 94.4
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.24
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.21
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.12
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.96
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 93.72
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.7
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 93.58
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 93.54
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.45
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 93.44
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.04
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 92.9
2kjq_A149 DNAA-related protein; solution structure, NESG, st 92.71
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 92.48
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 92.41
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 92.4
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 92.28
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 91.82
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 91.77
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 91.63
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.62
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 91.57
3co5_A143 Putative two-component system transcriptional RES 91.54
3bos_A242 Putative DNA replication factor; P-loop containing 91.49
3u4q_A1232 ATP-dependent helicase/nuclease subunit A; helicas 91.41
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 91.19
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 91.18
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 90.64
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 90.52
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 90.29
2qgz_A308 Helicase loader, putative primosome component; str 89.79
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 89.65
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 89.54
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 89.33
2gno_A305 DNA polymerase III, gamma subunit-related protein; 89.05
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 88.86
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 88.72
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 87.79
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 87.12
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 87.0
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 86.8
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 86.73
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 86.57
2fna_A357 Conserved hypothetical protein; structural genomic 86.49
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 86.42
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 84.99
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 84.77
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 84.66
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 84.28
3pvs_A447 Replication-associated recombination protein A; ma 84.07
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 84.05
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 83.96
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 83.79
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 83.03
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 82.54
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 82.14
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 82.07
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 80.77
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 80.61
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 80.42
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=4.3e-49  Score=460.04  Aligned_cols=355  Identities=26%  Similarity=0.491  Sum_probs=309.6

Q ss_pred             cccccCcccCCcHH-HHHHHHHCCCCCCcHHHHHHHHHHHcCCcEEEEccCCchHHHHHHHHHHHHHHhcC----CCCCe
Q psy8497          18 IDVLFENDVLIEKP-IRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLP----VQQPQ   92 (2355)
Q Consensus        18 iDkV~SFEeLlLkp-LLK~Lqa~GF~eLRPYQeEALn~LLSGRNVILAAPTGSGKTLVALIAILerL~ekr----~qggR   92 (2355)
                      +.++.+|+++.+.+ +++.|...||..|+|+|.++++.++.++++|+++|||+|||++|+++++..+....    ..+++
T Consensus        52 p~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~~~~~~~~~~  131 (434)
T 2db3_A           52 PQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRPQ  131 (434)
T ss_dssp             CCCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSCCCCCTTCCS
T ss_pred             CCCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhcccccccCCcc
Confidence            35678999999998 99999999999999999999999999999999999999999999999998887532    23678


Q ss_pred             EEEEcccHHHHHHHHHHHHHHhcccCCcEEEEEECCccccC----CCCCCcEEEECHHHHHHHHHhhcccCcCceEEEec
Q psy8497          93 TIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVER----PKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMD  168 (2355)
Q Consensus        93 VLILVPTRALAqQ~anwLREFgk~APgLrVVvytGGkq~rk----qirq~DILVTTPErLLDLLdrr~LdLSkIdLLIVD  168 (2355)
                      +|||+|+++|+.|+.+.++++.... ++++.+++|+.....    ....++|+|+||++|.+++....+.+..+++||||
T Consensus       132 ~lil~PtreLa~Q~~~~~~~~~~~~-~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlD  210 (434)
T 2db3_A          132 VVIVSPTRELAIQIFNEARKFAFES-YLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLD  210 (434)
T ss_dssp             EEEECSSHHHHHHHHHHHHHHTTTS-SCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSCCCTTCCEEEEE
T ss_pred             EEEEecCHHHHHHHHHHHHHHhccC-CcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCcccccCCeEEEc
Confidence            9999999999999999999997665 688888888865431    22458999999999999998888888999999999


Q ss_pred             ccchhcccChHHHHHHHHHhC--CCCceEEEEEeccChhHHHHHHHhccCCeeeccCCCccccccceEEEEeccCCCCCc
Q psy8497         169 EADKLINTGFVEDITWIYSQL--PPMKQMLVVSATYSHDNLATLQKYMVDPLLIRPEDATRPLLGVKQLVALIPECKNPS  246 (2355)
Q Consensus       169 EAHRLkN~GF~SrLeeILs~L--ppnrQILLLSATLS~EILElLkKfLrdPvIIrVesee~~~seVrQvVvqVpe~kn~s  246 (2355)
                      |||++.+.+|...+..++..+  +...|+|++|||++..+...+..++.++..+.+.........+.+.+..+...    
T Consensus       211 Eah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~~~~~~i~~~~~~~~~~----  286 (434)
T 2db3_A          211 EADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKY----  286 (434)
T ss_dssp             THHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTTCCCTTEEEEEEECCGG----
T ss_pred             cHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEeccccccccccceEEEEeCcH----
Confidence            999999999999999999885  56789999999999998888888888888877766555556666666655432    


Q ss_pred             chhhhHHHHHHHHHhcCCCCeEEEEEcccccHHHHHHHHHhcCCccEEeeCCCCHHHHHHHHHHHhCCCccEEEEecccc
Q psy8497         247 LRYVDEEKKLVQLLSQTPFNQCVIFSNYQLRPEVICENLANANFGAEYLSGAQDQKARLASLDSFKRGKVRILVTTDLAA  326 (2355)
Q Consensus       247 Lt~lsKkeaLLqLLerl~kgRVLVFSQTRKmAEiLADyLrErGIKVarLHGgMSqEERqeILErFRSGEIdVLVSTSALG  326 (2355)
                          .+...|..++..... ++||||++++.++.|++.|...++.+..+||++++.+|..+++.|++|+++|||||++++
T Consensus       287 ----~k~~~l~~~l~~~~~-~~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~  361 (434)
T 2db3_A          287 ----AKRSKLIEILSEQAD-GTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVAS  361 (434)
T ss_dssp             ----GHHHHHHHHHHHCCT-TEEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGT
T ss_pred             ----HHHHHHHHHHHhCCC-CEEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhh
Confidence                355667777776554 599999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCccEEEEecCCCCHhHHHHHhhccCCCCCccEEEEEEccc-CHHHHHHHHH
Q psy8497         327 RGIDAANVDLVINLEIPHDAATYLHRMGRAGRYGTRGLVITIVSAE-SLVKFHSLMG  382 (2355)
Q Consensus       327 EGLDLPaVDTVIIyDSP~SPqSYIQRIGRAGRiGQkGkVIVLVSsd-DVEeIEsLrR  382 (2355)
                      +|||+|.+++||+||.|+++..|+||+||+||.|+.|.+++|+... +......+.+
T Consensus       362 rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g~~G~a~~~~~~~~~~~~~~~l~~  418 (434)
T 2db3_A          362 RGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVK  418 (434)
T ss_dssp             SSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTTCCEEEEEEECTTTCGGGHHHHHH
T ss_pred             CCCCcccCCEEEEECCCCCHHHHHHHhcccccCCCCCEEEEEEeccccHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999843 4444444443



>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 2355
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 1e-33
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 5e-32
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 6e-31
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-29
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 4e-28
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-26
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 4e-25
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 9e-25
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 1e-23
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 3e-22
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 4e-19
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 4e-19
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 7e-19
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 8e-19
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 4e-17
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-15
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 2e-13
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 2e-12
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 2e-12
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 3e-12
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 3e-11
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 5e-10
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 4e-09
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 8e-09
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 1e-08
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 3e-08
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-06
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 8e-06
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score =  127 bits (320), Expect = 1e-33
 Identities = 66/205 (32%), Positives = 105/205 (51%), Gaps = 6/205 (2%)

Query: 22  FENDVLIEKPIRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALN 81
           F  ++ +   I   ++  GF K + IQM   P  LN    IV  ++ TG       A   
Sbjct: 6   FN-ELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVA-QARTGSGKTASFAIPL 63

Query: 82  KLIKLPVQQPQTIILAPTREIAVQITDVVRSVGAHVKNLHVDYFIGGTQVE---RPKRPV 138
             +       + IIL PTRE+A+Q+ D + S+  + KNL +    GG  +    +  +  
Sbjct: 64  IELVNENNGIEAIILTPTRELAIQVADEIESLKGN-KNLKIAKIYGGKAIYPQIKALKNA 122

Query: 139 QIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLINTGFVEDITWIYSQLPPMKQMLVV 198
            IVVG+PGRI   I    LN+ +V+ FI+DEAD+++N GF++D+  I +     K++L+ 
Sbjct: 123 NIVVGTPGRILDHINRGTLNLKNVKYFILDEADEMLNMGFIKDVEKILNACNKDKRILLF 182

Query: 199 SATYSHDNLATLQKYMVDPLLIRPE 223
           SAT   + L   +KYM D   I+ +
Sbjct: 183 SATMPREILNLAKKYMGDYSFIKAK 207


>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query2355
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.96
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.96
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.96
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.96
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.96
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.96
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.95
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.95
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.95
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.94
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.89
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.88
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.88
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.88
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.87
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.86
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.85
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.84
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.84
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.83
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.83
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.79
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.76
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.73
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.71
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.68
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.64
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.61
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.6
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.6
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.6
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.58
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.56
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.55
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.54
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.5
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.47
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.41
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.37
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.37
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.34
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 98.77
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.47
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.09
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 97.96
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.83
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.61
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.14
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.6
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.59
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.49
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 95.38
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.05
d2qy9a2211 GTPase domain of the signal recognition particle r 94.83
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.46
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.99
d1okkd2207 GTPase domain of the signal recognition particle r 93.77
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 93.29
d1vmaa2213 GTPase domain of the signal recognition particle r 92.99
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 92.93
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 92.88
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.72
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 92.64
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.46
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 92.42
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.12
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 91.59
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 90.46
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 90.02
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 89.8
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.58
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 88.05
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 86.63
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 85.61
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 85.05
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 85.04
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.61
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 83.12
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 81.87
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 81.05
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 80.06
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: DEAD box RNA helicase rck/p54
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=4.6e-29  Score=266.27  Aligned_cols=199  Identities=32%  Similarity=0.482  Sum_probs=181.0

Q ss_pred             ccCcccCCcHH-HHHHHHHCCCCCCcHHHHHHHHHHHcCCcEEEEccCCchHHHHHHHHHHHHHHhcCCCCCeEEEEccc
Q psy8497          21 LFENDVLIEKP-IRQGLQENGFVKESPIQMAAFPYVLNGYDAIVQSKSGTGKSIVFVVAALNKLIKLPVQQPQTIILAPT   99 (2355)
Q Consensus        21 V~SFEeLlLkp-LLK~Lqa~GF~eLRPYQeEALn~LLSGRNVILAAPTGSGKTLVALIAILerL~ekr~qggRVLILVPT   99 (2355)
                      ..+|+++++++ |++.|.+.||..|+|+|.++++.+++|+|+|+++|||+|||++|+++++..+.. .....++|||+|+
T Consensus         2 ~~~F~~l~L~~~l~~~l~~~g~~~pt~iQ~~aip~il~g~dvl~~a~TGsGKTlayllP~l~~~~~-~~~~~~~lil~pt   80 (206)
T d1veca_           2 GNEFEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDL-KKDNIQAMVIVPT   80 (206)
T ss_dssp             CSSGGGSCCCHHHHHHHHTTTCCSCCHHHHHHHHHHHTTCCEEEECCSSSTTHHHHHHHHHHHCCT-TSCSCCEEEECSC
T ss_pred             CCChhccCcCHHHHHHHHHCCCCCCCHHHHHHHHHHHcCCCEEeeccCccccccccccchhhcccc-cccCcceEEEeec
Confidence            46899999999 999999999999999999999999999999999999999999999999988763 3567789999999


Q ss_pred             HHHHHHHHHHHHHHhcccCCcEEEEEECCccccC----CCCCCcEEEECHHHHHHHHHhhcccCcCceEEEecccchhcc
Q psy8497         100 REIAVQITDVVRSVGAHVKNLHVDYFIGGTQVER----PKRPVQIVVGSPGRIKQMIKLKYLNMDSVRLFIMDEADKLIN  175 (2355)
Q Consensus       100 RALAqQ~anwLREFgk~APgLrVVvytGGkq~rk----qirq~DILVTTPErLLDLLdrr~LdLSkIdLLIVDEAHRLkN  175 (2355)
                      ++|+.|+.+.+..+......+.+....|+.....    ....++|||+||++|.+++....+.+..+.+|||||||+|.+
T Consensus        81 ~el~~q~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~l~~~~~ivv~TPgrl~~~~~~~~~~~~~l~~lVlDEaD~ll~  160 (206)
T d1veca_          81 RELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLS  160 (206)
T ss_dssp             HHHHHHHHHHHHHHTTTSSSCCEEEECSSSCHHHHHHHTTSCCSEEEECHHHHHHHHHTTCSCCTTCCEEEEETHHHHTS
T ss_pred             chhhHHHHHHHHHHhhcccCcccccccCCccHHHHHHHHHhccCeEEeCCccccccccchhccccccceEEEeccccccc
Confidence            9999999999999987777788888877764432    234589999999999999999888999999999999999999


Q ss_pred             cChHHHHHHHHHhCCCCceEEEEEeccChhHHHHHHHhccCCeee
Q psy8497         176 TGFVEDITWIYSQLPPMKQMLVVSATYSHDNLATLQKYMVDPLLI  220 (2355)
Q Consensus       176 ~GF~SrLeeILs~LppnrQILLLSATLS~EILElLkKfLrdPvII  220 (2355)
                      .+|...+..++..++...|++++|||++.++..++..+|.+|+.+
T Consensus       161 ~~f~~~i~~I~~~~~~~~Q~~l~SAT~~~~v~~l~~~~l~~P~~I  205 (206)
T d1veca_         161 QDFVQIMEDIILTLPKNRQILLYSATFPLSVQKFMNSHLEKPYEI  205 (206)
T ss_dssp             TTTHHHHHHHHHHSCTTCEEEEEESCCCHHHHHHHHHHCSSCEEE
T ss_pred             cchHHHHHHHHHhCCCCCEEEEEEecCCHHHHHHHHHHCCCCEEE
Confidence            999999999999999999999999999999999999999998765



>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure