Psyllid ID: psy8617

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
MVPCLFQILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSIEENLPRGTVVGSVKATDEDLASNAALRYSLIPSNTSFQINPFSGKKSILYLHSVIHMY
cccccEEcEEEEEEEEEccccccccEEEEEEEEEEccccccccEEEEEEEcccccccccEEEcccccEEEEccccccccccEEEEEEEEEEccccccccEEEEEEEEEEcccccccccccEEEEEEEcccccccEEEEEEEEEcccccccEEEEEEccccccEEEcccccEEEEEEEccccccc
cccccccEEEEEEEEEEcccccccccEEEEEEEEEccccccccEEEEEEccccEcccccEEEcccccEEEEccccccccccEEEEEEEEEEccccEccccEEEEEEEEcccccccEEcccEEEEEEEcccccccEEEEccEEccccccccEEEEEEEcccccEEEcccccEEEEEEccHHHccc
MVPCLFQILQVTAvdldtgnnarITYKLIqddtavdldtgnnaRITYKLIqddklvhdtfhimpntgwlslkqpmdreTRDKFLLKIAacdngtpvsTAYATVAINVldandndpkfskqdyefsieenlprgtvvgsvkatdedlASNAALRyslipsntsfqinpfsgkksILYLHSVIHMY
MVPCLFQILQVTAVDLDTGNNARITYkliqddtavdldtgNNARITYKLIQDDKLVHDTFHIMpntgwlslkqpMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFsieenlprgtvVGSVKATDEDLASNAALRYSLIPsntsfqinpfsgkKSILYLHSVIHMY
MVPCLFQILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSIEENLPRGTVVGSVKATDEDLASNAALRYSLIPSNTSFQINPFSGKKSILYLHSVIHMY
**PCLFQILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDAN**********YEFSI***L*RGTVVGSVKAT**DLASNAALRYSLIPSNTSFQINPFSGKKSILYLHSVIH**
MVPCLFQILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSIEENLPRGTVVGSVKATDEDLASNAALRYSLIPSNTSFQINPFSGKKSILYLHS*****
MVPCLFQILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSIEENLPRGTVVGSVKATDEDLASNAALRYSLIPSNTSFQINPFSGKKSILYLHSVIHMY
****LFQILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSIEENLPRGTVVGSVKATDEDLASNAALRYSLIPSNTSFQINPFSGKKSILYLHS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVPCLFQILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSIEENLPRGTVVGSVKATDEDLASNAALRYSLIPSNTSFQINPFSGKKSILYLHSVIHMY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
4887715 3503 adherin [Drosophila melanogaster] 0.847 0.044 0.550 1e-43
194853658 3556 GG24633 [Drosophila erecta] gi|190660069 0.847 0.043 0.544 2e-43
24580686 3556 dachsous [Drosophila melanogaster] gi|22 0.847 0.043 0.544 2e-43
25090185 3503 RecName: Full=Protein dachsous; AltName: 0.847 0.044 0.544 2e-43
195470324 3556 GE15963 [Drosophila yakuba] gi|194173559 0.847 0.043 0.544 2e-43
195350165 2943 GM16650 [Drosophila sechellia] gi|194123 0.847 0.053 0.544 5e-43
195575605 3038 GD22944 [Drosophila simulans] gi|1941896 0.847 0.051 0.538 6e-43
195118208 2980 GI18019 [Drosophila mojavensis] gi|19391 0.896 0.055 0.514 6e-43
195388388 3639 GJ19658 [Drosophila virilis] gi|19414931 0.885 0.044 0.514 8e-43
270006362 3474 dachsous [Tribolium castaneum] 0.788 0.041 0.556 1e-42
>gi|4887715|gb|AAA79329.2| adherin [Drosophila melanogaster] Back     alignment and taxonomy information
 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 115/167 (68%), Gaps = 11/167 (6%)

Query: 7    QILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNT 66
            QI+QV A DLDTGNNARITY+++  D  VD        +T  +   D   H  F I PN+
Sbjct: 1001 QIIQVNASDLDTGNNARITYRIV--DAGVD-------NVTNSISSSDVSQH--FGIFPNS 1049

Query: 67   GWLSLKQPMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSI 126
            GW+ L+ P+DRETRD++ L I A DNGTP + A   V + VLDANDNDPKF K  YEF I
Sbjct: 1050 GWIYLRAPLDRETRDRYQLTILATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRI 1109

Query: 127  EENLPRGTVVGSVKATDEDLASNAALRYSLIPSNTSFQINPFSGKKS 173
            EENL RG+VVG V A+D DL  NAA+RYSL+P N+SFQ++P +G+ S
Sbjct: 1110 EENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEIS 1156

Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194853658|ref|XP_001968202.1| GG24633 [Drosophila erecta] gi|190660069|gb|EDV57261.1| GG24633 [Drosophila erecta] Back     alignment and taxonomy information
>gi|24580686|ref|NP_523446.2| dachsous [Drosophila melanogaster] gi|22945533|gb|AAF51468.3| dachsous [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|25090185|sp|Q24292.3|DS_DROME RecName: Full=Protein dachsous; AltName: Full=Adherin; Flags: Precursor Back     alignment and taxonomy information
>gi|195470324|ref|XP_002087458.1| GE15963 [Drosophila yakuba] gi|194173559|gb|EDW87170.1| GE15963 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195350165|ref|XP_002041612.1| GM16650 [Drosophila sechellia] gi|194123385|gb|EDW45428.1| GM16650 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195575605|ref|XP_002077668.1| GD22944 [Drosophila simulans] gi|194189677|gb|EDX03253.1| GD22944 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195118208|ref|XP_002003632.1| GI18019 [Drosophila mojavensis] gi|193914207|gb|EDW13074.1| GI18019 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195388388|ref|XP_002052862.1| GJ19658 [Drosophila virilis] gi|194149319|gb|EDW65017.1| GJ19658 [Drosophila virilis] Back     alignment and taxonomy information
>gi|270006362|gb|EFA02810.1| dachsous [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
FB|FBgn0000497 3503 ds "dachsous" [Drosophila mela 0.847 0.044 0.544 5.7e-40
ZFIN|ZDB-GENE-091015-2 1093 pcdh1b "protocadherin 1b" [Dan 0.782 0.131 0.401 2.9e-25
UNIPROTKB|F5H3L5 1038 PCDH1 "Protocadherin-1" [Homo 0.777 0.137 0.402 1e-24
UNIPROTKB|Q08174 1060 PCDH1 "Protocadherin-1" [Homo 0.777 0.134 0.402 1.1e-24
UNIPROTKB|H0Y2Z9 1071 PCDH1 "Protocadherin-1" [Homo 0.777 0.133 0.402 1.2e-24
UNIPROTKB|E2QX93 1232 PCDH1 "Uncharacterized protein 0.777 0.116 0.395 1.7e-24
UNIPROTKB|F1M8K1 1013 Pcdh1 "Protein Pcdh1" [Rattus 0.777 0.141 0.395 2e-24
UNIPROTKB|I3L7J4 1050 PCDH1 "Uncharacterized protein 0.777 0.136 0.388 3.7e-24
UNIPROTKB|F6Q0C0 1059 PCDH1 "Uncharacterized protein 0.777 0.135 0.388 3.8e-24
UNIPROTKB|F1NLP0 4964 FAT4 "Uncharacterized protein" 0.728 0.026 0.408 1.1e-23
FB|FBgn0000497 ds "dachsous" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 444 (161.4 bits), Expect = 5.7e-40, P = 5.7e-40
 Identities = 91/167 (54%), Positives = 115/167 (68%)

Query:     7 QILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNT 66
             QI+QV A DLDTGNNARITY+++  D  VD        +T  +   D   H  F I PN+
Sbjct:  1001 QIIQVNASDLDTGNNARITYRIV--DAGVD-------NVTNSISSSDVSQH--FGIFPNS 1049

Query:    67 GWLSLKQPMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSI 126
             GW+ L+ P+DRETRD++ L + A DNGTP + A   V + VLDANDNDPKF K  YEF I
Sbjct:  1050 GWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRI 1109

Query:   127 EENLPRGTVVGSVKATDEDLASNAALRYSLIPSNTSFQINPFSGKKS 173
             EENL RG+VVG V A+D DL  NAA+RYSL+P N+SFQ++P +G+ S
Sbjct:  1110 EENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEIS 1156
GO:0000904 "cell morphogenesis involved in differentiation" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
GO:0005886 "plasma membrane" evidence=ISS
GO:0018149 "peptide cross-linking" evidence=IPI
GO:0016021 "integral to membrane" evidence=TAS
GO:0004872 "receptor activity" evidence=ISS
GO:0007156 "homophilic cell adhesion" evidence=IEA;ISS
GO:0050839 "cell adhesion molecule binding" evidence=ISS;IDA
GO:0016339 "calcium-dependent cell-cell adhesion" evidence=ISS
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0004871 "signal transducer activity" evidence=NAS
GO:0042067 "establishment of ommatidial planar polarity" evidence=IMP;TAS
GO:0016318 "ommatidial rotation" evidence=TAS
GO:0001737 "establishment of imaginal disc-derived wing hair orientation" evidence=IMP;TAS
GO:0045317 "equator specification" evidence=IMP
GO:0045198 "establishment of epithelial cell apical/basal polarity" evidence=IMP
GO:0007164 "establishment of tissue polarity" evidence=NAS
GO:0001736 "establishment of planar polarity" evidence=IGI;IMP;TAS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0035222 "wing disc pattern formation" evidence=IMP
GO:0030010 "establishment of cell polarity" evidence=IMP
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0048592 "eye morphogenesis" evidence=IMP
GO:0016337 "cell-cell adhesion" evidence=IMP
GO:0035159 "regulation of tube length, open tracheal system" evidence=IMP
GO:0090176 "microtubule cytoskeleton organization involved in establishment of planar polarity" evidence=IMP
GO:0090175 "regulation of establishment of planar polarity" evidence=IGI
ZFIN|ZDB-GENE-091015-2 pcdh1b "protocadherin 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F5H3L5 PCDH1 "Protocadherin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q08174 PCDH1 "Protocadherin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y2Z9 PCDH1 "Protocadherin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QX93 PCDH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1M8K1 Pcdh1 "Protein Pcdh1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3L7J4 PCDH1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6Q0C0 PCDH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLP0 FAT4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 1e-22
smart0011281 smart00112, CA, Cadherin repeats 1e-22
pfam0002892 pfam00028, Cadherin, Cadherin domain 2e-16
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 3e-12
pfam0002892 pfam00028, Cadherin, Cadherin domain 7e-10
cd0003198 cd00031, CA_like, Cadherin repeat-like domain 6e-05
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information 
 Score = 86.2 bits (214), Expect = 1e-22
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 33  TAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRETRDKFLLKIAACDN 92
           +A D D+G N  +TY ++  +      F I P+TG ++  +P+DRE +  + L + A D 
Sbjct: 20  SATDPDSGENGEVTYSIVSGN--EDGLFSIDPSTGEITTAKPLDREEQSSYTLTVTATDG 77

Query: 93  GTPVSTAYATVAINVLDANDN 113
           G P  ++ ATV I VLD NDN
Sbjct: 78  GGPPLSSTATVTITVLDVNDN 98

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|206635 cd00031, CA_like, Cadherin repeat-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 100.0
KOG4289|consensus 2531 100.0
KOG4289|consensus 2531 99.97
KOG1219|consensus 4289 99.96
KOG1219|consensus 4289 99.95
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.82
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.81
KOG1834|consensus 952 99.61
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.49
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.42
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 98.08
KOG1834|consensus 952 98.07
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.74
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.23
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 96.7
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 96.48
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 95.04
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 95.04
PF0534549 He_PIG: Putative Ig domain; InterPro: IPR008009 Th 86.1
TIGR00845 928 caca sodium/calcium exchanger 1. This model is spe 81.35
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 81.31
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information 
Probab=100.00  E-value=1.4e-31  Score=202.72  Aligned_cols=159  Identities=39%  Similarity=0.612  Sum_probs=149.2

Q ss_pred             CcCCCeEEEEEEEEeCCCCCCcEEEEEEecCCCcccccCCCcceEEEEEeeCCcccccceEEeCcccEEEECCCCCcccc
Q psy8617           1 MVPCLFQILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRETR   80 (184)
Q Consensus         1 ~~p~Gt~v~~v~A~D~D~g~n~~i~Y~i~~~~~~~d~d~~~~~~~~~~~~~~~~~~~~~F~I~~~tG~i~~~~~lD~E~~   80 (184)
                      .+++|+.|+++.|+|+|.+.++.++|+|.++..                       ..+|.|++.+|.|++++.||||..
T Consensus         9 n~~~g~~v~~~~a~D~D~~~~~~~~y~i~~~~~-----------------------~~~F~i~~~tG~l~~~~~lD~e~~   65 (199)
T cd00031           9 NAPPGTVVGTVSATDPDSGENGRVTYSILGGNE-----------------------DGLFSIDPNTGVITTTKPLDREEQ   65 (199)
T ss_pred             CCCCCCEEEEEEEECCCCCCCceEEEEEeCCCC-----------------------cccEEEeCCCCEEEECCCCCCcCC
Confidence            367899999999999999888999999999875                       469999999999999999999999


Q ss_pred             cEEEEEEEEEeCCCCcccceEEEEEEEecCCCCCCccCCCceEEEEeCCCCCCcEEEEEEEEeCCCCCCceEEEEEecCC
Q psy8617          81 DKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSIEENLPRGTVVGSVKATDEDLASNAALRYSLIPSN  160 (184)
Q Consensus        81 ~~~~l~v~a~d~~~p~~~~~~~v~I~v~d~Nd~~P~f~~~~~~~~v~E~~~~gt~v~~v~a~D~D~~~n~~i~y~i~~~~  160 (184)
                      ..|.|.|.|+|.+.|.++....++|.|.|+||++|.|....|.+.|.|+.++|+.++++.|+|+|.+.++.++|+|.++.
T Consensus        66 ~~~~l~v~a~D~g~~~~~~~~~v~I~V~d~Nd~~P~~~~~~~~~~v~e~~~~~~~i~~~~a~D~D~~~~~~~~y~l~~~~  145 (199)
T cd00031          66 SEYTLTVVASDGGGPPLSSTATVTVTVLDVNDNPPVFEQSSYEASVPENAPPGTVVGTVTATDADSGENAKLTYSILSGN  145 (199)
T ss_pred             ceEEEEEEEEECCcCcceeEEEEEEEEccCCCCCCcccccceEEEEeCCCCCCCEEEEEEEEcCCCCCCccEEEEEeCCC
Confidence            99999999999888877789999999999999999999999999999999999999999999999988999999999987


Q ss_pred             --CcEEEEcCccEEEEcccccccc
Q psy8617         161 --TSFQINPFSGKKSILYLHSVIH  182 (184)
Q Consensus       161 --~~F~Id~~tG~i~~~~~~~~~~  182 (184)
                        .+|.|++.+|.|++.+.++.|.
T Consensus       146 ~~~~f~i~~~~G~i~~~~~ld~e~  169 (199)
T cd00031         146 DKELFSIDPNTGIITLAKPLDREE  169 (199)
T ss_pred             CCCEEEEeCCceEEEeCCccCCcc
Confidence              7999999999999998887664

>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information
>PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins Back     alignment and domain information
>TIGR00845 caca sodium/calcium exchanger 1 Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
4aqe_A214 Crystal Structure Of Deafness Associated Mutant Mou 3e-16
2wcp_A214 Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length 3e-16
3mvs_A210 Structure Of The N-Terminus Of Cadherin 23 Length = 3e-16
2wd0_A214 Crystal Structure Of Nonsyndromic Deafness (Dfnb12) 1e-15
1l3w_A 546 C-Cadherin Ectodomain Length = 546 1e-14
1q55_A 880 W-Shaped Trans Interactions Of Cadherins Model Base 2e-14
2a62_A322 Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length 1e-13
3lni_A213 Crystal Structure Of E-Cadherin Ec12 E89a Length = 3e-12
3qrb_A213 Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt 4e-12
3lnh_A213 Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 4e-12
1ff5_A219 Structure Of E-Cadherin Double Domain Length = 219 4e-12
3lnf_A213 Crystal Structure Of E-Cadherin Ec12 K14ew2a Length 4e-12
2qvf_B213 Mouse E-cadherin Domains 1,2 Length = 213 4e-12
1q1p_A212 E-Cadherin Activation Length = 212 4e-12
3lng_A215 Crystal Structure Of E-Cadherin Ec12 Aa Extension L 4e-12
3lne_A213 Crystal Structure Of E-Cadherin Ec12 K14e Length = 4e-12
1edh_A226 E-Cadherin Domains 1 And 2 In Complex With Calcium 5e-12
3q2v_A 550 Crystal Structure Of Mouse E-Cadherin Ectodomain Le 8e-12
3q2l_A213 Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 9e-12
3q2n_A213 Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 2e-11
1ncj_A215 N-Cadherin, Two-Domain Fragment Length = 215 7e-11
2qvi_A215 Crystal Structure Of N-Cadherin Domains Ec12 Length 9e-11
3q2w_A 559 Crystal Structure Of Mouse N-Cadherin Ectodomain Le 1e-10
1suh_A146 Amino-Terminal Domain Of Epithelial Cadherin In The 5e-10
3k5r_A218 Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt 3e-09
2o72_A213 Crystal Structure Analysis Of Human E-Cadherin (1-2 4e-09
3k5s_A217 Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len 5e-09
3ubh_A419 Crystal Structure Of Drosophila N-cadherin Ec1-4 Le 1e-08
2yst_A119 Solution Structure Of The Third Cadherin Domain Fro 1e-08
3lnd_A207 Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 2e-07
2ee0_A114 Solution Structures Of The Ca Domain Of Human Proto 2e-05
1nch_A110 Structural Basis Of Cell-Cell Adhesion By Cadherins 5e-05
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 6e-05
>pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 81/162 (50%), Gaps = 20/162 (12%)
Query: 25  TYKLIQDDTAVDLDTGNNARITYKLIQD---DKLVHDT--------FHIMPNTGWLSLKQ 73
           TY LI +DT V       + +T  L +D   D LV           F + P+TG + L+Q
Sbjct: 16  TYLLISEDTPV------GSSVTQLLARDMDNDPLVFGVPGEEASRFFAVEPDTGVVWLRQ 69
Query: 74  PMDRETRDKFLLKIAACDNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSIEENLPRG 133
           P+DRET+ +F ++ +  D+   ++     V I V D NDN P F  Q Y   I EN P G
Sbjct: 70  PLDRETKSEFTVEFSVSDHQGVITRK---VNIQVGDVNDNAPTFHNQPYSVRIPENTPVG 126
Query: 134 TVVGSVKATDEDLASNAALRYSLIPSNTSFQINPFSGKKSIL 175
           T +  V ATD DL +  ++ YS  P +  F I+   G  +++
Sbjct: 127 TPIFIVNATDPDLGAGGSVLYSFQPPSPFFAIDSARGIVTVI 168
>pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 Back     alignment and structure
>pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 Back     alignment and structure
>pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 Back     alignment and structure
>pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 Back     alignment and structure
>pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 Back     alignment and structure
>pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 Back     alignment and structure
>pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 Back     alignment and structure
>pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 Back     alignment and structure
>pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 Back     alignment and structure
>pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 Back     alignment and structure
>pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 Back     alignment and structure
>pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 Back     alignment and structure
>pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 Back     alignment and structure
>pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 Back     alignment and structure
>pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 Back     alignment and structure
>pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 Back     alignment and structure
>pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 Back     alignment and structure
>pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 Back     alignment and structure
>pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 Back     alignment and structure
>pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 Back     alignment and structure
>pdb|1SUH|A Chain A, Amino-Terminal Domain Of Epithelial Cadherin In The Calcium Bound State, Nmr, 20 Structures Length = 146 Back     alignment and structure
>pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 Back     alignment and structure
>pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 Back     alignment and structure
>pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 Back     alignment and structure
>pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-cadherin Ec1-4 Length = 419 Back     alignment and structure
>pdb|2YST|A Chain A, Solution Structure Of The Third Cadherin Domain From Human Protocadherin 7 Length = 119 Back     alignment and structure
>pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 Back     alignment and structure
>pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 Back     alignment and structure
>pdb|1NCH|A Chain A, Structural Basis Of Cell-Cell Adhesion By Cadherins Length = 110 Back     alignment and structure
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 3e-45
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 2e-14
2qvi_A 215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 8e-07
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 2e-44
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 9e-17
3qrb_A 213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 2e-06
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 2e-44
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 1e-19
3mvs_A 210 Cadherin-23, otocadherin; adhesion, extracellular 6e-12
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 2e-43
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 2e-12
3k5r_A 218 Cadherin 13; mouse, structural protein; 2.00A {Mus 1e-05
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 1e-42
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 2e-16
3lnd_A 207 CDH6 protein, cadherin 6; cell adhesion, cell memb 3e-06
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 1e-42
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 2e-21
2a4e_A 215 Cadherin-11; dimer, calcium binding, cell adhesion 3e-06
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 7e-42
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 9e-18
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 4e-38
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 4e-34
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-33
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-28
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 9e-15
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 5e-04
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 5e-38
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-35
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 1e-31
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 4e-28
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 4e-16
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-04
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 5e-38
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 1e-35
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 6e-15
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 5e-38
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 4e-37
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 1e-12
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 6e-06
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 1e-37
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 1e-33
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-32
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-28
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 3e-11
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 4e-04
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-36
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-34
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 5e-33
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-28
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-16
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-12
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-09
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-36
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-32
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 3e-31
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-13
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 2e-32
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 3e-23
2x2u_A 246 Proto-oncogene tyrosine-protein kinase receptor RE 2e-08
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 4e-26
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 8e-07
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 1e-24
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 1e-04
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 3e-24
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 7e-20
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 5e-20
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 1e-07
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 7e-20
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 2e-06
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 7e-20
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 1e-06
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 2e-19
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 4e-17
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 2e-17
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 6e-06
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 3e-15
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 1e-04
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 2e-14
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 2e-04
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 3e-04
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
 Score =  147 bits (373), Expect = 3e-45
 Identities = 47/148 (31%), Positives = 67/148 (45%), Gaps = 10/148 (6%)

Query: 33  TAVDLDTGNNARITYKLIQD--DKLVHDTFHIMPNTGWLSLKQPMDRETRDKFLLKIAAC 90
             +  D   N  + Y +     D+     F I P +G LS+ +P+DRE   +F L+  A 
Sbjct: 22  VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAV 81

Query: 91  DNGTPVSTAYATVAINVLDANDNDPKFSKQDYEFSIEENLPRGTVVGSVKATDEDLAS-- 148
           D           + INV+D NDN P+F  Q +  S+ E    GT V +V A D D  +  
Sbjct: 82  DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNAL 141

Query: 149 NAALRYSLI------PSNTSFQINPFSG 170
           N  LRY ++      PS   F IN  +G
Sbjct: 142 NGMLRYRILSQAPSTPSPNMFTINNETG 169
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 100.0
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 100.0
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 100.0
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 100.0
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 100.0
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 100.0
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 100.0
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 100.0
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 100.0
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 100.0
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.98
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.97
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.97
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.97
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.97
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.97
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.97
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.97
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.97
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.97
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.96
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.96
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.91
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.91
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.89
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.88
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.85
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.85
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.85
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.85
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.85
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.83
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.82
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.81
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.8
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.8
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.79
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.79
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.72
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.72
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.71
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.7
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.69
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.65
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.6
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.31
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.27
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.27
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.1
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.05
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.05
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 98.99
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 98.98
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 98.93
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 98.91
2yhg_A437 SDE_182CT, cellulose-binding protein; hydrolase, g 89.77
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 87.41
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=1.6e-37  Score=238.05  Aligned_cols=156  Identities=26%  Similarity=0.337  Sum_probs=145.1

Q ss_pred             cCCCeEEEEEEEEeCCCCCCcEEEEEEecCCCcccccCCCcceEEEEEeeCCcccccceEEeCcccEEEECCCCCccccc
Q psy8617           2 VPCLFQILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRETRD   81 (184)
Q Consensus         2 ~p~Gt~v~~v~A~D~D~g~n~~i~Y~i~~~~~~~d~d~~~~~~~~~~~~~~~~~~~~~F~I~~~tG~i~~~~~lD~E~~~   81 (184)
                      .|.|+.|+++ |+|+|.| |+.++|+|.++..                       ..+|.|++.+|.|++++.||||...
T Consensus        16 ~p~~~~v~~v-a~D~D~g-n~~i~Y~l~~~~~-----------------------~~~F~Id~~tG~i~~~~~LDrE~~~   70 (215)
T 2a4e_A           16 GPDPVLVGRL-HSDIDSG-DGNIKYILSGEGA-----------------------GTIFVIDDKSGNIHATKTLDREERA   70 (215)
T ss_dssp             SSSCEEEEEC-CCTTCCS-SSCEEEEEEETTB-----------------------TTTEEECTTTCEEEECSCCCTTTCS
T ss_pred             CCCCEEEEEE-EECCCCC-CCeEEEEEECCCC-----------------------CCeEEEECCceEEEECCccCCccCC
Confidence            4789999998 8999998 7899999987654                       4699999999999999999999999


Q ss_pred             EEEEEEEEEeCCC-CcccceEEEEEEEecCCCCCCccCCCceEEEEeCCCCCCcEEEEEEEEeCCC---CCCceEEEEEe
Q psy8617          82 KFLLKIAACDNGT-PVSTAYATVAINVLDANDNDPKFSKQDYEFSIEENLPRGTVVGSVKATDEDL---ASNAALRYSLI  157 (184)
Q Consensus        82 ~~~l~v~a~d~~~-p~~~~~~~v~I~v~d~Nd~~P~f~~~~~~~~v~E~~~~gt~v~~v~a~D~D~---~~n~~i~y~i~  157 (184)
                      .|.|.|.|+|.+. +++++.+.|.|.|.|+|||+|.|.+..|.+.|+|++++|+.|++|.|+|+|.   |.|+.++|+|.
T Consensus        71 ~y~l~v~a~D~~~~~~~~~~~~v~I~V~DvNDn~P~F~~~~y~~~v~E~~~~Gt~v~~v~A~D~D~~~~G~n~~i~Y~i~  150 (215)
T 2a4e_A           71 QYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHEIYHANVPERSNVGTSVIQVTASDADDPTYGNSAKLVYSIL  150 (215)
T ss_dssp             EEEEEEEEEETTTCCEEEEEEEEEEEEECCCCCCCEESSSSEEEEEETTCCTTCEEEECCEECSSCTTTCSSSCCEEEEE
T ss_pred             EEEEEEEEEECCCCCcccccEEEEEEEeeCCCCCCCccCCceEEEEECCCCCCCEEEEEEEEECCCCCCCCceEEEEEEe
Confidence            9999999999875 6688899999999999999999999999999999999999999999999997   78999999999


Q ss_pred             cCCCcEEEEcCccEEEEc-ccccccc
Q psy8617         158 PSNTSFQINPFSGKKSIL-YLHSVIH  182 (184)
Q Consensus       158 ~~~~~F~Id~~tG~i~~~-~~~~~~~  182 (184)
                      +++..|.|++.||+|+++ +.+++|.
T Consensus       151 ~~~~~F~Id~~tG~I~~~~~~LD~E~  176 (215)
T 2a4e_A          151 EGQPYFSVEAQTGIIRTALPNMDREA  176 (215)
T ss_dssp             ESTTTEEECTTTCEEEECSSCCCSSS
T ss_pred             CCCCcEEEeCCccEEEEcccCCCccc
Confidence            998999999999999999 8888775
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 5e-14
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 8e-06
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 3e-13
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 7e-06
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 7e-12
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 5e-04
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 5e-10
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 5e-06
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 5e-08
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 4e-07
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 4e-04
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 2e-06
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 0.002
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 2e-06
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 5e-06
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 3e-06
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 5e-06
d1l3wa5107 b.1.6.1 (A:434-540) C-cadherin ectodomain {African 1e-04
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: E-cadherin (epithelial)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 62.8 bits (152), Expect = 5e-14
 Identities = 17/79 (21%), Positives = 28/79 (35%), Gaps = 2/79 (2%)

Query: 33  TAVDLDTGNNARITYKLIQD--DKLVHDTFHIMPNTGWLSLKQPMDRETRDKFLLKIAAC 90
             +  +     ++ Y +     D      F I   TGWL + +P+DRE    + L   A 
Sbjct: 25  VQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAV 84

Query: 91  DNGTPVSTAYATVAINVLD 109
            +          + I V D
Sbjct: 85  SSNGNAVEDPMEILITVTD 103
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.79
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.75
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.75
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.73
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.7
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.7
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.69
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.68
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.65
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.64
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.6
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.59
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.5
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.47
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.28
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.28
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 98.75
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 98.75
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 98.68
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 98.65
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 88.79
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=99.79  E-value=1.5e-19  Score=121.90  Aligned_cols=85  Identities=21%  Similarity=0.344  Sum_probs=77.8

Q ss_pred             cCCCeEEEEEEEEeCCCCCCcEEEEEEecCCCcccccCCCcceEEEEEeeCCcccccceEEeCcccEEEECCCCCccc--
Q psy8617           2 VPCLFQILQVTAVDLDTGNNARITYKLIQDDTAVDLDTGNNARITYKLIQDDKLVHDTFHIMPNTGWLSLKQPMDRET--   79 (184)
Q Consensus         2 ~p~Gt~v~~v~A~D~D~g~n~~i~Y~i~~~~~~~d~d~~~~~~~~~~~~~~~~~~~~~F~I~~~tG~i~~~~~lD~E~--   79 (184)
                      +|+|+.|+++.|+|+|.+.|+.++|+|.+..                        .++|.|++.+|.|++++.||||.  
T Consensus        19 ~~~g~~v~~v~A~D~D~~~~~~i~y~i~~~~------------------------~~~F~id~~tG~i~~~~~lD~E~~~   74 (107)
T d1l3wa4          19 LSRGEKIISLVAQDPDKQQIQKLSYFIGNDP------------------------ARWLTVNKDNGIVTGNGNLDRESEY   74 (107)
T ss_dssp             CCSSEEEEECCEECCCTTCCCCEEEEECCCS------------------------SCCCEEETTTTEEEECSCCCTTSSS
T ss_pred             CCCCCEEEEeEEecCCcCcCCceeEEecCCC------------------------cccceeccccceEEEccccChhhcc
Confidence            6899999999999999999999999997643                        46999999999999999999995  


Q ss_pred             --ccEEEEEEEEEeCCCCcccceEEEEEEEecC
Q psy8617          80 --RDKFLLKIAACDNGTPVSTAYATVAINVLDA  110 (184)
Q Consensus        80 --~~~~~l~v~a~d~~~p~~~~~~~v~I~v~d~  110 (184)
                        ...|.+.|.|+|.|.|++++++.|.|+|.|+
T Consensus        75 ~~~~~y~l~v~a~D~g~p~~~~t~~v~V~V~DV  107 (107)
T d1l3wa4          75 VKNNTYTVIMLVTDDGVSVGTGTGTLILHVLDV  107 (107)
T ss_dssp             CCSSCCEEEEEEEECSSSCCCCCEEEECCBCCC
T ss_pred             ccCCeEEEEEEEEECCcCCcEEEEEEEEEEEeC
Confidence              4679999999999999999999999999986
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure