Psyllid ID: psy8622
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| 322795670 | 316 | hypothetical protein SINV_04512 [Solenop | 0.534 | 0.170 | 0.685 | 6e-18 | |
| 307199729 | 324 | RING finger protein 126 [Harpegnathos sa | 0.633 | 0.197 | 0.594 | 7e-18 | |
| 270000781 | 306 | hypothetical protein TcasGA2_TC011026 [T | 0.702 | 0.232 | 0.544 | 9e-18 | |
| 91091942 | 295 | PREDICTED: similar to CG11982 CG11982-PA | 0.702 | 0.240 | 0.544 | 9e-18 | |
| 289742067 | 352 | zinc finger protein 364 [Glossina morsit | 0.623 | 0.178 | 0.6 | 1e-17 | |
| 321468766 | 431 | hypothetical protein DAPPUDRAFT_304341 [ | 0.564 | 0.132 | 0.666 | 2e-17 | |
| 156539061 | 150 | PREDICTED: E3 ubiquitin-protein ligase R | 0.633 | 0.426 | 0.594 | 2e-17 | |
| 350417770 | 310 | PREDICTED: E3 ubiquitin-protein ligase R | 0.574 | 0.187 | 0.672 | 5e-17 | |
| 340729326 | 310 | PREDICTED: e3 ubiquitin-protein ligase R | 0.574 | 0.187 | 0.672 | 5e-17 | |
| 242006631 | 346 | RING finger protein, putative [Pediculus | 0.554 | 0.161 | 0.701 | 5e-17 |
| >gi|322795670|gb|EFZ18349.1| hypothetical protein SINV_04512 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 94.7 bits (234), Expect = 6e-18, Method: Composition-based stats.
Identities = 37/54 (68%), Positives = 41/54 (75%)
Query: 37 DSNLQCSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWLQLHGTCPICRQTLHSES 90
D LQCSVCWE F L E VR+LPC H YH PCI PWL+LHGTCPICRQ L ++
Sbjct: 235 DCKLQCSVCWEDFKLSEPVRQLPCQHVYHAPCIVPWLELHGTCPICRQNLGDQN 288
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307199729|gb|EFN80208.1| RING finger protein 126 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|270000781|gb|EEZ97228.1| hypothetical protein TcasGA2_TC011026 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91091942|ref|XP_975905.1| PREDICTED: similar to CG11982 CG11982-PA isoform 2 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|289742067|gb|ADD19781.1| zinc finger protein 364 [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|321468766|gb|EFX79749.1| hypothetical protein DAPPUDRAFT_304341 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|156539061|ref|XP_001599771.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like, partial [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|350417770|ref|XP_003491586.1| PREDICTED: E3 ubiquitin-protein ligase RNF115-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340729326|ref|XP_003402955.1| PREDICTED: e3 ubiquitin-protein ligase RNF115-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|242006631|ref|XP_002424152.1| RING finger protein, putative [Pediculus humanus corporis] gi|212507477|gb|EEB11414.1| RING finger protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| FB|FBgn0037653 | 380 | CG11982 [Drosophila melanogast | 0.623 | 0.165 | 0.523 | 1.9e-17 | |
| UNIPROTKB|Q9Y4L5 | 304 | RNF115 "E3 ubiquitin-protein l | 0.544 | 0.180 | 0.545 | 2.9e-16 | |
| UNIPROTKB|E2QY59 | 319 | RNF115 "Uncharacterized protei | 0.544 | 0.172 | 0.545 | 3.9e-16 | |
| ZFIN|ZDB-GENE-061215-82 | 310 | rnf115 "ring finger protein 11 | 0.603 | 0.196 | 0.5 | 4.1e-16 | |
| UNIPROTKB|F1SDD6 | 231 | F1SDD6 "Uncharacterized protei | 0.623 | 0.272 | 0.5 | 6e-16 | |
| UNIPROTKB|I3LDQ5 | 293 | LOC100739432 "Uncharacterized | 0.623 | 0.215 | 0.5 | 6e-16 | |
| MGI|MGI:1915095 | 305 | Rnf115 "ring finger protein 11 | 0.544 | 0.180 | 0.527 | 6.3e-16 | |
| UNIPROTKB|F6RQU6 | 293 | RNF115 "Uncharacterized protei | 0.623 | 0.215 | 0.484 | 9.8e-16 | |
| ZFIN|ZDB-GENE-060503-608 | 301 | si:ch211-81a5.1 "si:ch211-81a5 | 0.495 | 0.166 | 0.58 | 9.1e-15 | |
| TAIR|locus:2050522 | 180 | AT2G44330 [Arabidopsis thalian | 0.623 | 0.35 | 0.476 | 4.9e-14 |
| FB|FBgn0037653 CG11982 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 217 (81.4 bits), Expect = 1.9e-17, P = 1.9e-17
Identities = 34/65 (52%), Positives = 46/65 (70%)
Query: 31 VQVRTDDSN--LQCSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWLQLHGTCPICRQTLHS 88
VQ+ ++ N +QCS+CW+ F +DE VRKLPC H YH CI PWL LH TCPICR++L
Sbjct: 240 VQINAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLAD 299
Query: 89 ESAES 93
+ ++
Sbjct: 300 DGNDA 304
|
|
| UNIPROTKB|Q9Y4L5 RNF115 "E3 ubiquitin-protein ligase RNF115" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QY59 RNF115 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061215-82 rnf115 "ring finger protein 115" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SDD6 F1SDD6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LDQ5 LOC100739432 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915095 Rnf115 "ring finger protein 115" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6RQU6 RNF115 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-608 si:ch211-81a5.1 "si:ch211-81a5.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2050522 AT2G44330 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 1e-13 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 3e-12 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 4e-09 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-07 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 5e-07 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 1e-05 | |
| COG5219 | 1525 | COG5219, COG5219, Uncharacterized conserved protei | 3e-05 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 3e-05 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 2e-04 | |
| COG5194 | 88 | COG5194, APC11, Component of SCF ubiquitin ligase | 3e-04 | |
| smart00504 | 63 | smart00504, Ubox, Modified RING finger domain | 5e-04 | |
| COG5432 | 391 | COG5432, RAD18, RING-finger-containing E3 ubiquiti | 7e-04 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 0.001 |
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
Score = 59.3 bits (144), Expect = 1e-13
Identities = 18/44 (40%), Positives = 27/44 (61%)
Query: 41 QCSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWLQLHGTCPICRQ 84
+C +C ++F E V LPC H +H C++ WL+ TCP+CR
Sbjct: 2 ECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRA 45
|
Length = 46 |
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.73 | |
| KOG4628|consensus | 348 | 99.62 | ||
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.54 | |
| KOG0317|consensus | 293 | 99.53 | ||
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.49 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.49 | |
| KOG0823|consensus | 230 | 99.47 | ||
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 99.44 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.44 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 99.42 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 99.41 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.34 | |
| KOG0320|consensus | 187 | 99.3 | ||
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 99.3 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 99.28 | |
| KOG0802|consensus | 543 | 99.26 | ||
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.23 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 99.22 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 99.2 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 99.19 | |
| KOG2164|consensus | 513 | 99.16 | ||
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.15 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 99.12 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 99.09 | |
| KOG0287|consensus | 442 | 99.01 | ||
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.96 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.9 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.88 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.81 | |
| KOG1734|consensus | 328 | 98.81 | ||
| KOG1493|consensus | 84 | 98.74 | ||
| KOG4265|consensus | 349 | 98.72 | ||
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.72 | |
| KOG0828|consensus | 636 | 98.71 | ||
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 98.7 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 98.69 | |
| KOG2177|consensus | 386 | 98.67 | ||
| KOG0804|consensus | 493 | 98.66 | ||
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 98.53 | |
| KOG0311|consensus | 381 | 98.49 | ||
| KOG2930|consensus | 114 | 98.46 | ||
| KOG0824|consensus | 324 | 98.41 | ||
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.4 | |
| KOG0827|consensus | 465 | 98.38 | ||
| KOG0978|consensus | 698 | 98.28 | ||
| KOG4172|consensus | 62 | 98.28 | ||
| KOG1941|consensus | 518 | 98.26 | ||
| KOG1039|consensus | 344 | 98.2 | ||
| KOG0825|consensus | 1134 | 98.12 | ||
| KOG3039|consensus | 303 | 98.07 | ||
| KOG1785|consensus | 563 | 98.07 | ||
| KOG4159|consensus | 398 | 98.05 | ||
| KOG2660|consensus | 331 | 98.04 | ||
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.98 | |
| KOG1645|consensus | 463 | 97.97 | ||
| KOG4445|consensus | 368 | 97.96 | ||
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.94 | |
| KOG2879|consensus | 298 | 97.93 | ||
| KOG0297|consensus | 391 | 97.88 | ||
| KOG1813|consensus | 313 | 97.74 | ||
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 97.7 | |
| KOG1428|consensus | 3738 | 97.67 | ||
| KOG3970|consensus | 299 | 97.58 | ||
| KOG4692|consensus | 489 | 97.58 | ||
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 97.56 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 97.45 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 97.42 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 97.4 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 97.39 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 97.31 | |
| KOG4739|consensus | 233 | 97.25 | ||
| KOG1002|consensus | 791 | 97.19 | ||
| KOG1814|consensus | 445 | 97.18 | ||
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 97.14 | |
| KOG1952|consensus | 950 | 97.14 | ||
| KOG4275|consensus | 350 | 97.12 | ||
| KOG4185|consensus | 296 | 97.07 | ||
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 97.06 | |
| KOG1571|consensus | 355 | 97.02 | ||
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 97.01 | |
| PHA02862 | 156 | 5L protein; Provisional | 96.95 | |
| PHA03096 | 284 | p28-like protein; Provisional | 96.79 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 96.77 | |
| KOG1940|consensus | 276 | 96.71 | ||
| KOG3268|consensus | 234 | 96.67 | ||
| KOG0826|consensus | 357 | 96.66 | ||
| KOG2114|consensus | 933 | 96.52 | ||
| KOG0801|consensus | 205 | 96.48 | ||
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 96.45 | |
| KOG1001|consensus | 674 | 96.45 | ||
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 96.21 | |
| KOG4367|consensus | 699 | 96.13 | ||
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 96.1 | |
| KOG2932|consensus | 389 | 96.08 | ||
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 96.01 | |
| KOG3800|consensus | 300 | 95.78 | ||
| KOG2817|consensus | 394 | 95.64 | ||
| KOG0827|consensus | 465 | 95.51 | ||
| KOG2034|consensus | 911 | 95.48 | ||
| KOG1100|consensus | 207 | 94.73 | ||
| KOG3053|consensus | 293 | 94.64 | ||
| KOG3899|consensus | 381 | 94.52 | ||
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 94.34 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 94.2 | |
| KOG3002|consensus | 299 | 94.15 | ||
| KOG0298|consensus | 1394 | 93.99 | ||
| KOG0309|consensus | 1081 | 93.78 | ||
| KOG3113|consensus | 293 | 93.38 | ||
| KOG1609|consensus | 323 | 93.08 | ||
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 93.08 | |
| KOG1812|consensus | 384 | 93.01 | ||
| KOG0802|consensus | 543 | 93.0 | ||
| KOG4362|consensus | 684 | 91.96 | ||
| KOG1815|consensus | 444 | 90.85 | ||
| KOG1812|consensus | 384 | 89.19 | ||
| COG5183 | 1175 | SSM4 Protein involved in mRNA turnover and stabili | 88.91 | |
| KOG3161|consensus | 861 | 88.17 | ||
| KOG4718|consensus | 235 | 87.98 | ||
| PF14569 | 80 | zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. | 87.85 | |
| KOG1829|consensus | 580 | 87.62 | ||
| KOG3579|consensus | 352 | 86.62 | ||
| PF06906 | 57 | DUF1272: Protein of unknown function (DUF1272); In | 86.33 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 85.93 | |
| KOG0269|consensus | 839 | 85.62 | ||
| KOG0825|consensus | 1134 | 85.51 | ||
| KOG2807|consensus | 378 | 85.07 | ||
| PLN02400 | 1085 | cellulose synthase | 84.74 | |
| KOG2068|consensus | 327 | 84.51 | ||
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 84.46 | |
| PF01363 | 69 | FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f | 84.42 | |
| PF13901 | 202 | DUF4206: Domain of unknown function (DUF4206) | 84.4 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 84.24 | |
| PF06844 | 68 | DUF1244: Protein of unknown function (DUF1244); In | 82.25 | |
| PF07975 | 51 | C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al | 81.88 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 81.48 | |
| PF10497 | 105 | zf-4CXXC_R1: Zinc-finger domain of monoamine-oxida | 81.4 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 80.84 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 80.06 |
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
Probab=99.73 E-value=2.3e-18 Score=86.79 Aligned_cols=43 Identities=47% Similarity=1.234 Sum_probs=39.8
Q ss_pred ccccccccccCCCceEEeCCCCcccHhHHHHHHhcCCcccccc
Q psy8622 41 QCSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWLQLHGTCPICR 83 (101)
Q Consensus 41 ~C~IC~~~~~~~~~~~~l~C~H~f~~~Ci~~w~~~~~~CP~Cr 83 (101)
.|+||++.+..++.++.++|+|.||.+||..|++.+.+||+||
T Consensus 2 ~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~~~~~~~~~CP~CR 44 (44)
T PF13639_consen 2 ECPICLEEFEDGEKVVKLPCGHVFHRSCIKEWLKRNNSCPVCR 44 (44)
T ss_dssp CETTTTCBHHTTSCEEEETTSEEEEHHHHHHHHHHSSB-TTTH
T ss_pred CCcCCChhhcCCCeEEEccCCCeeCHHHHHHHHHhCCcCCccC
Confidence 6999999998888889999999999999999999999999997
|
... |
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >KOG4445|consensus | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG1428|consensus | Back alignment and domain information |
|---|
| >KOG3970|consensus | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG1952|consensus | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1940|consensus | Back alignment and domain information |
|---|
| >KOG3268|consensus | Back alignment and domain information |
|---|
| >KOG0826|consensus | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >KOG0801|consensus | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG2932|consensus | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG3800|consensus | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >KOG2034|consensus | Back alignment and domain information |
|---|
| >KOG1100|consensus | Back alignment and domain information |
|---|
| >KOG3053|consensus | Back alignment and domain information |
|---|
| >KOG3899|consensus | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3002|consensus | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >KOG0309|consensus | Back alignment and domain information |
|---|
| >KOG3113|consensus | Back alignment and domain information |
|---|
| >KOG1609|consensus | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >KOG4362|consensus | Back alignment and domain information |
|---|
| >KOG1815|consensus | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3161|consensus | Back alignment and domain information |
|---|
| >KOG4718|consensus | Back alignment and domain information |
|---|
| >PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A | Back alignment and domain information |
|---|
| >KOG1829|consensus | Back alignment and domain information |
|---|
| >KOG3579|consensus | Back alignment and domain information |
|---|
| >PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG2807|consensus | Back alignment and domain information |
|---|
| >PLN02400 cellulose synthase | Back alignment and domain information |
|---|
| >KOG2068|consensus | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13901 DUF4206: Domain of unknown function (DUF4206) | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >PF06844 DUF1244: Protein of unknown function (DUF1244); InterPro: IPR009654 This family consists of several short bacterial proteins of around 100 residues in length | Back alignment and domain information |
|---|
| >PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >PF10497 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxidase A repressor R1; InterPro: IPR018866 R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 101 | ||||
| 2ect_A | 78 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 4e-13 | ||
| 2l0b_A | 91 | Solution Nmr Structure Of Zinc Finger Domain Of E3 | 1e-07 | ||
| 1iym_A | 55 | Ring-H2 Finger Domain Of El5 Length = 55 | 6e-07 | ||
| 1x4j_A | 75 | Solution Structure Of Ring Finger In Ring Finger Pr | 9e-07 | ||
| 2kiz_A | 69 | Solution Structure Of Arkadia Ring-H2 Finger Domain | 2e-06 | ||
| 4ayc_B | 138 | Rnf8 Ring Domain Structure Length = 138 | 5e-05 | ||
| 4ayc_A | 138 | Rnf8 Ring Domain Structure Length = 138 | 6e-05 | ||
| 4epo_C | 149 | Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE | 1e-04 | ||
| 2ep4_A | 74 | Solution Structure Of Ring Finger From Human Ring F | 2e-04 |
| >pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 | Back alignment and structure |
|
| >pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 | Back alignment and structure |
| >pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 | Back alignment and structure |
| >pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 | Back alignment and structure |
| >pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 | Back alignment and structure |
| >pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
| >pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
| >pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 | Back alignment and structure |
| >pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 1e-25 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 1e-23 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 7e-22 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 2e-21 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 1e-19 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 4e-17 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 5e-17 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 5e-15 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 7e-14 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 1e-12 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 2e-11 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 2e-11 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 3e-11 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 5e-10 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 4e-09 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 7e-09 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 2e-08 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 3e-08 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 3e-08 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 4e-08 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 7e-08 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 2e-07 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 3e-07 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 6e-07 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 7e-07 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 1e-06 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 3e-06 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 6e-06 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 2e-05 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 2e-05 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 2e-05 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 3e-05 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 5e-05 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 8e-05 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 9e-05 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 1e-04 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 1e-04 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 1e-04 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 2e-04 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 2e-04 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 3e-04 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 3e-04 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 6e-04 |
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
Score = 89.8 bits (223), Expect = 1e-25
Identities = 28/66 (42%), Positives = 42/66 (63%)
Query: 35 TDDSNLQCSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWLQLHGTCPICRQTLHSESAESL 94
S L+C VC E + L E+VR+LPC+H +H CI PWL+ H +CP+CR++L ++ +
Sbjct: 11 HVGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNTATN 70
Query: 95 GPAGAG 100
P G
Sbjct: 71 PPGLTG 76
|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.77 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.77 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.74 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.74 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.71 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.71 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.7 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.69 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.68 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.66 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.66 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.66 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.65 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.64 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.64 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.64 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.64 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.64 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.63 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.61 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.61 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.6 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.59 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.58 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.58 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.57 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.57 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.56 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.56 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.56 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.54 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.54 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.53 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.51 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.51 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.51 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.5 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.49 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.47 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 99.47 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.46 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.46 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.45 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.45 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.45 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.45 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.44 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.44 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.43 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.42 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.4 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.37 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.36 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 99.35 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.34 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.33 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.31 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.3 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.25 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.24 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.19 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 99.18 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.15 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 99.08 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.07 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 99.05 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 99.05 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 99.04 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.98 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.91 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.75 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 98.42 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 97.32 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 96.91 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 96.06 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 95.82 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 94.39 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 93.86 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 93.75 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 92.8 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 92.03 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 91.52 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 91.39 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 91.12 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 90.7 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 90.4 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 90.27 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 90.05 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 89.97 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 89.4 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 89.27 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 89.21 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 88.09 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 88.07 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 87.68 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 87.26 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 87.23 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 86.73 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 86.7 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 86.48 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 86.26 | |
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 86.23 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 86.12 | |
| 2d8v_A | 67 | Zinc finger FYVE domain-containing protein 19; zfy | 86.01 | |
| 3t7l_A | 90 | Zinc finger FYVE domain-containing protein 16; str | 85.9 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 85.9 | |
| 1z60_A | 59 | TFIIH basal transcription factor complex P44 subun | 85.76 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 85.44 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 85.22 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 85.15 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 84.98 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 84.92 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 84.88 | |
| 1vfy_A | 73 | Phosphatidylinositol-3-phosphate binding FYVE doma | 84.79 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 84.16 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 82.99 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 82.64 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 80.88 | |
| 3zyq_A | 226 | Hepatocyte growth factor-regulated tyrosine kinas | 80.79 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 80.78 | |
| 2a20_A | 62 | Regulating synaptic membrane exocytosis protein 2; | 80.64 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 80.25 | |
| 1dvp_A | 220 | HRS, hepatocyte growth factor-regulated tyrosine k | 80.14 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 80.07 |
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=99.77 E-value=4.7e-19 Score=98.37 Aligned_cols=65 Identities=42% Similarity=1.019 Sum_probs=54.4
Q ss_pred CCCCccccccccccccCCCceEEeCCCCcccHhHHHHHHhcCCcccccccccccCCcccCCCCCC
Q psy8622 35 TDDSNLQCSVCWEQFTLDEAVRKLPCDHFYHTPCIEPWLQLHGTCPICRQTLHSESAESLGPAGA 99 (101)
Q Consensus 35 ~~~~~~~C~IC~~~~~~~~~~~~l~C~H~f~~~Ci~~w~~~~~~CP~Cr~~~~~~~~~~~~~~~~ 99 (101)
.......|+||++.+..+..+..++|+|.||..||.+|+..+..||+||..+...+.....+...
T Consensus 11 ~~~~~~~C~IC~~~~~~~~~~~~~~C~H~fc~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~~~~~ 75 (78)
T 2ect_A 11 HVGSGLECPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLTGQNTATNPPGLT 75 (78)
T ss_dssp TSSSSCCCTTTTSCCCTTSCEEECTTSCEEETTTTHHHHTTTCSCTTTCCCCCCSCSCCCCSSCT
T ss_pred cCCCCCCCeeCCccccCCCCEEEeCCCCeecHHHHHHHHHcCCcCcCcCCccCCcccCCCCCCCC
Confidence 34556789999999987777788899999999999999999999999999998777665554443
|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >2d8v_A Zinc finger FYVE domain-containing protein 19; zfyve19, ZF- B_BOX, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a20_A Regulating synaptic membrane exocytosis protein 2; zinc-finger domain, metal binding protein; NMR {Rattus norvegicus} PDB: 2cjs_C | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 101 | ||||
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 4e-15 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-12 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 3e-10 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 6e-10 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 3e-08 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 1e-07 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 2e-07 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 3e-07 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 7e-07 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 1e-05 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 1e-05 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 3e-05 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 4e-05 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Score = 61.8 bits (150), Expect = 4e-15
Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
Query: 37 DSNLQCSVCWEQFTLDEAVRKLP-CDHFYHTPCIEPWLQLHGTCPICRQTL 86
D ++C+VC + E R LP C H +H C++ WL H TCP+CR T+
Sbjct: 3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV 53
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.79 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.73 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.67 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.65 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.65 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.62 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.61 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.6 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.54 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.54 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.45 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 99.44 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.44 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.39 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.28 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.96 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 96.14 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 94.8 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 94.57 | |
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 93.65 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 93.61 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 93.54 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 93.08 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 92.91 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 92.77 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 92.13 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 91.5 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 91.32 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 90.06 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 89.91 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 86.95 | |
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 86.76 | |
| d1dvpa2 | 72 | Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 | 83.85 | |
| d1vfya_ | 67 | vps27p protein {Baker's yeast (Saccharomyces cerev | 83.12 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 82.68 | |
| d2o35a1 | 79 | Hypothetical protein SMc04008 {Rhizobium meliloti | 80.17 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.79 E-value=2.6e-20 Score=96.09 Aligned_cols=51 Identities=41% Similarity=1.003 Sum_probs=44.7
Q ss_pred CCccccccccccccCCCceEEeC-CCCcccHhHHHHHHhcCCcccccccccc
Q psy8622 37 DSNLQCSVCWEQFTLDEAVRKLP-CDHFYHTPCIEPWLQLHGTCPICRQTLH 87 (101)
Q Consensus 37 ~~~~~C~IC~~~~~~~~~~~~l~-C~H~f~~~Ci~~w~~~~~~CP~Cr~~~~ 87 (101)
+++..|+||++.|..++.+..++ |+|.||..|+.+|++.+.+||+||+++.
T Consensus 3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~ 54 (55)
T d1iyma_ 3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54 (55)
T ss_dssp CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence 44567999999998877777765 9999999999999999999999999874
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2o35a1 a.293.1.1 (A:2-80) Hypothetical protein SMc04008 {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|