Psyllid ID: psy8629
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 483 | ||||||
| 157108475 | 605 | protocadherin [Aedes aegypti] gi|1088840 | 0.884 | 0.705 | 0.526 | 1e-136 | |
| 312384516 | 741 | hypothetical protein AND_02014 [Anophele | 0.886 | 0.577 | 0.525 | 1e-135 | |
| 270006362 | 3474 | dachsous [Tribolium castaneum] | 0.863 | 0.120 | 0.556 | 1e-135 | |
| 170031841 | 955 | protocadherin [Culex quinquefasciatus] g | 0.894 | 0.452 | 0.524 | 1e-135 | |
| 328701666 | 3383 | PREDICTED: protein dachsous-like [Acyrth | 0.900 | 0.128 | 0.544 | 1e-133 | |
| 195388388 | 3639 | GJ19658 [Drosophila virilis] gi|19414931 | 0.890 | 0.118 | 0.500 | 1e-124 | |
| 198475184 | 3586 | GA26057 [Drosophila pseudoobscura pseudo | 0.877 | 0.118 | 0.515 | 1e-124 | |
| 195159445 | 1812 | GL15349 [Drosophila persimilis] gi|19411 | 0.877 | 0.233 | 0.515 | 1e-123 | |
| 158297319 | 361 | AGAP007909-PA [Anopheles gambiae str. PE | 0.633 | 0.847 | 0.631 | 1e-122 | |
| 195470324 | 3556 | GE15963 [Drosophila yakuba] gi|194173559 | 0.877 | 0.119 | 0.507 | 1e-121 |
| >gi|157108475|ref|XP_001650242.1| protocadherin [Aedes aegypti] gi|108884002|gb|EAT48227.1| AAEL000717-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 492 bits (1266), Expect = e-136, Method: Compositional matrix adjust.
Identities = 277/526 (52%), Positives = 332/526 (63%), Gaps = 99/526 (18%)
Query: 2 RLWRLLWLLAAVAA---------------------DEHLRDLEISEGVPVGTRVGFIGDG 40
R LLWLL + A EH+R+LE+SEGVP+G ++GFIG+
Sbjct: 10 RKMSLLWLLLMICAFAGDSGGGSDGGGLGFLRLARAEHVRELEVSEGVPIGHQIGFIGEF 69
Query: 41 FVG-DSGPPYLIVPVPGSAVDTDLSIEQNTGEIRTKVPLDRETRSSYSLVAIPLSGENVR 99
G DSGPPYLIVPVPGSAVDTDL+I+ TG
Sbjct: 70 LHGVDSGPPYLIVPVPGSAVDTDLAIDHTTG----------------------------- 100
Query: 100 VVSFYEPGEIRTKVPLDRETRSSYSLVAIPLSGENVRVVVRVIDENDNAPTFPSPFMSIE 159
EIRTKV LDRE R+SYSLVAIPLSGENVRVV+RV+DENDNAPTFP+ M+IE
Sbjct: 101 --------EIRTKVLLDREKRASYSLVAIPLSGENVRVVIRVLDENDNAPTFPTALMNIE 152
Query: 160 FPENTPRDVKRTLNAAKDRDLGIYNTQRYNIVSGNTNNAFRLSSHREKDGVLYLDLQING 219
FPENTPRDVKRTLN A+D DLG YNTQRYNIVSGN NNAFRLSSHRE+DGVLYLDLQING
Sbjct: 153 FPENTPRDVKRTLNPARDLDLGRYNTQRYNIVSGNVNNAFRLSSHRERDGVLYLDLQING 212
Query: 220 VLDRETIPEYSLVIEALDGGSPPLRGSMIVNVTIQDVNDNQPIFNQSRYFATVPENATVG 279
LDRET P YSLV+EALDGG+PPLRG M VN+TIQDVNDNQPIFNQSRYFATVPENAT+G
Sbjct: 213 FLDRETTPAYSLVVEALDGGNPPLRGQMTVNITIQDVNDNQPIFNQSRYFATVPENATIG 272
Query: 280 TSIFQVFATDADAGSNGEVEYSINRRQSDKDGLFNIDSKSGLIFVNKALDFETKEVHDLV 339
T++ QV+ATD DAG NG VEY+INRRQSDKD +F ID +GLI VNK LDFETKE+H+LV
Sbjct: 273 TTVLQVYATDQDAGENGMVEYAINRRQSDKDQMFRIDPNTGLISVNKPLDFETKELHELV 332
Query: 340 PRFA------VEISSF----------------------------DEIAEPGTSVFQISAF 365
+E ++F E A+PG V +IS
Sbjct: 333 VVAKDRGLQPLETTAFVSIRVTDVNDNQPIINVIFLSDDATPKISESAQPGEFVARISVN 392
Query: 366 DQD---EGINSVITYSLRENTDDHPSWFQIDSKSGLITMKSNVDCETDPVPKLTVIATDN 422
D D E N +T S E H D+ L+ + +D E P L+V+ATD
Sbjct: 393 DPDSKTEYSNVNVTLSGGEG---HFGLTTRDNIIYLVIVSLPLDREIKPNYTLSVVATDT 449
Query: 423 GVPALSSSATVLVTIHDVNDNEPIFDQSFYNVTIPENKPKGSCILK 468
G P L ++ T+ +T+ D+NDN P F++ Y+ + E G+ +++
Sbjct: 450 GNPPLHAAKTIFLTVTDINDNAPEFEKEIYHANVMEVADPGTSVIQ 495
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|312384516|gb|EFR29227.1| hypothetical protein AND_02014 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|270006362|gb|EFA02810.1| dachsous [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|170031841|ref|XP_001843792.1| protocadherin [Culex quinquefasciatus] gi|167871191|gb|EDS34574.1| protocadherin [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|328701666|ref|XP_003241675.1| PREDICTED: protein dachsous-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|195388388|ref|XP_002052862.1| GJ19658 [Drosophila virilis] gi|194149319|gb|EDW65017.1| GJ19658 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|198475184|ref|XP_002132853.1| GA26057 [Drosophila pseudoobscura pseudoobscura] gi|198138709|gb|EDY70255.1| GA26057 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195159445|ref|XP_002020589.1| GL15349 [Drosophila persimilis] gi|194117539|gb|EDW39582.1| GL15349 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|158297319|ref|XP_555589.3| AGAP007909-PA [Anopheles gambiae str. PEST] gi|157015138|gb|EAL39705.3| AGAP007909-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|195470324|ref|XP_002087458.1| GE15963 [Drosophila yakuba] gi|194173559|gb|EDW87170.1| GE15963 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 483 | ||||||
| FB|FBgn0000497 | 3503 | ds "dachsous" [Drosophila mela | 0.757 | 0.104 | 0.551 | 7.4e-117 | |
| UNIPROTKB|F1NB81 | 2475 | F1NB81 "Uncharacterized protei | 0.587 | 0.114 | 0.467 | 5.6e-90 | |
| UNIPROTKB|E1C566 | 2926 | E1C566 "Uncharacterized protei | 0.587 | 0.097 | 0.467 | 9e-90 | |
| ZFIN|ZDB-GENE-090313-302 | 1204 | si:dkey-30k22.7 "si:dkey-30k22 | 0.579 | 0.232 | 0.409 | 7.7e-74 | |
| ZFIN|ZDB-GENE-050208-41 | 3286 | dchs1b "dachsous 1b (Drosophil | 0.559 | 0.082 | 0.455 | 3.2e-68 | |
| UNIPROTKB|I3LUS1 | 3297 | DCHS1 "Uncharacterized protein | 0.587 | 0.086 | 0.403 | 1.3e-64 | |
| UNIPROTKB|E1B969 | 3296 | DCHS1 "Uncharacterized protein | 0.587 | 0.086 | 0.403 | 2.1e-64 | |
| UNIPROTKB|Q96JQ0 | 3298 | DCHS1 "Protocadherin-16" [Homo | 0.587 | 0.086 | 0.406 | 1.5e-63 | |
| RGD|1309878 | 3278 | Dchs1 "dachsous 1 (Drosophila) | 0.596 | 0.087 | 0.4 | 3.1e-61 | |
| MGI|MGI:3045256 | 4981 | Fat4 "FAT tumor suppressor hom | 0.467 | 0.045 | 0.412 | 5.7e-56 |
| FB|FBgn0000497 ds "dachsous" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 950 (339.5 bits), Expect = 7.4e-117, Sum P(2) = 7.4e-117
Identities = 209/379 (55%), Positives = 260/379 (68%)
Query: 107 GEIRTKVPLDRETRSSYSLVAIPLSGENVRVVVRVIDENDNAPTFPSPFMSIEFPENTPR 166
GEIRTKV LDRETR+SYSLVAIPLSG N+RV+V V DENDNAPTFP M IEFPENTPR
Sbjct: 77 GEIRTKVKLDRETRASYSLVAIPLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPR 136
Query: 167 DVKRTLNAAKDRDLGIYNTQRYNIVSGNTNNAFRLSSHREKDGVLYLDLQINGVLDRETI 226
+VKRTL A+D DL YNTQRYNIVSGN N+AFRLSSHRE+DGVLYLDLQI+G LDRET
Sbjct: 137 EVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETT 196
Query: 227 PEYSLVIEALDGGSPPLRGSMIVNVTIQDVNDNQPIFNQSRYFATVPENATVGTSIFQVF 286
P YSL+IEALDGG+PPLRG M VN+TIQDVNDNQPIFNQSRYFATVPENATVGTS+ QV+
Sbjct: 197 PGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVY 256
Query: 287 ATDADAGSNGEVEYSINRRQSDKDGLFNIDSKSGLIFVNKALDFETKEVHDLVPRFAVEI 346
A+D DA NG VEY+INRRQSDK+ +F ID ++G I++NKALDFETKE+H+LV V
Sbjct: 257 ASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELV----VVA 312
Query: 347 SSFDEIAEPGTSVFQISAFDQDEGINSVITYSLRENTDDHPSWFQIDSKSGLITMKSNV- 405
E T+ I D ++ ++ L +DD ++ G + +V
Sbjct: 313 KDHGEQPLETTAFVSIRVTDVNDNQPTINVIFL---SDDASPKISESAQPGEFVARISVH 369
Query: 406 --DCETDPVPKLTVIATDNGVPALSS--SATVLVTIHDVNDNEPIFDQSFYNVTIPENKP 461
D +T+ + +G AL++ ++ LV +H D E + + + V + P
Sbjct: 370 DPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTP 429
Query: 462 KGSCILKSIFYDIFNISEH 480
KSIF I +++++
Sbjct: 430 PLHAS-KSIFLRITDVNDN 447
|
|
| UNIPROTKB|F1NB81 F1NB81 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C566 E1C566 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090313-302 si:dkey-30k22.7 "si:dkey-30k22.7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-41 dchs1b "dachsous 1b (Drosophila)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LUS1 DCHS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B969 DCHS1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96JQ0 DCHS1 "Protocadherin-16" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1309878 Dchs1 "dachsous 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:3045256 Fat4 "FAT tumor suppressor homolog 4 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 483 | |||
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 4e-25 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 3e-21 | |
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 4e-21 | |
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 3e-20 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 3e-18 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 8e-16 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 7e-15 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 8e-14 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 4e-11 | |
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 5e-08 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 5e-08 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 6e-05 |
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
Score = 98.9 bits (247), Expect = 4e-25
Identities = 43/91 (47%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
Query: 353 AEPGTSVFQISAFDQDEGINSVITYSLRENTDDHPSWFQIDSKSGLITMKSNVDCETDPV 412
A PGT V +SA D D G N +TYS+ +D F ID +G IT +D E
Sbjct: 10 APPGTVVLTVSATDPDSGENGEVTYSIVSGNEDG--LFSIDPSTGEITTAKPLDREEQSS 67
Query: 413 PKLTVIATDNGVPALSSSATVLVTIHDVNDN 443
LTV ATD G P LSS+ATV +T+ DVNDN
Sbjct: 68 YTLTVTATDGGGPPLSSTATVTITVLDVNDN 98
|
Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98 |
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 483 | |||
| KOG4289|consensus | 2531 | 100.0 | ||
| KOG4289|consensus | 2531 | 100.0 | ||
| KOG1219|consensus | 4289 | 100.0 | ||
| KOG1219|consensus | 4289 | 100.0 | ||
| cd00031 | 199 | CA Cadherin repeat domain; Cadherins are glycoprot | 99.97 | |
| cd00031 | 199 | CA Cadherin repeat domain; Cadherins are glycoprot | 99.96 | |
| PF00028 | 93 | Cadherin: Cadherin domain; InterPro: IPR002126 Cad | 99.7 | |
| PF00028 | 93 | Cadherin: Cadherin domain; InterPro: IPR002126 Cad | 99.7 | |
| KOG1834|consensus | 952 | 99.67 | ||
| smart00112 | 79 | CA Cadherin repeats. Cadherins are glycoproteins i | 99.65 | |
| smart00112 | 79 | CA Cadherin repeats. Cadherins are glycoproteins i | 99.57 | |
| KOG1834|consensus | 952 | 99.52 | ||
| PF08266 | 84 | Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad | 98.35 | |
| PF08758 | 90 | Cadherin_pro: Cadherin prodomain like; InterPro: I | 97.36 | |
| smart00736 | 97 | CADG Dystroglycan-type cadherin-like domains. Cadh | 96.58 | |
| PF08266 | 84 | Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad | 96.51 | |
| TIGR01965 | 99 | VCBS_repeat VCBS repeat. This domain of about 100 | 96.31 | |
| TIGR01965 | 99 | VCBS_repeat VCBS repeat. This domain of about 100 | 96.08 | |
| PF08758 | 90 | Cadherin_pro: Cadherin prodomain like; InterPro: I | 95.95 | |
| smart00736 | 97 | CADG Dystroglycan-type cadherin-like domains. Cadh | 95.27 | |
| PF13750 | 158 | Big_3_3: Bacterial Ig-like domain (group 3) | 94.29 | |
| KOG3597|consensus | 442 | 93.79 | ||
| TIGR00845 | 928 | caca sodium/calcium exchanger 1. This model is spe | 91.94 | |
| PF05345 | 49 | He_PIG: Putative Ig domain; InterPro: IPR008009 Th | 89.08 | |
| TIGR00845 | 928 | caca sodium/calcium exchanger 1. This model is spe | 83.46 | |
| TIGR03660 | 137 | T1SS_rpt_143 T1SS-143 repeat domain. This model re | 81.87 |
| >KOG4289|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-70 Score=573.77 Aligned_cols=426 Identities=34% Similarity=0.464 Sum_probs=398.2
Q ss_pred HhhhcCceEEEEEeCCCCCCeEEEEEEccCCCCCCCCEEEEecCCCCCcccEEEeCCccEEEeCccCCccCCceeeEEEE
Q psy8629 12 AVAADEHLRDLEISEGVPVGTRVGFIGDGFVGDSGPPYLIVPVPGSAVDTDLSIEQNTGEIRTKVPLDRETRSSYSLVAI 91 (483)
Q Consensus 12 ~~~~~~~~~~~~v~En~~~gt~V~~v~a~d~d~~~~~y~i~~~~~~~~~~~F~Id~~tG~i~~~~~LD~E~~~~y~l~v~ 91 (483)
++.|.+..|...++||.|+||.|.+++|.|++..++.|++.....+...++|+||+.+|.|++++.||||....+-|+|.
T Consensus 161 ~~~Fqq~~Yq~~lpEn~pagT~iasv~A~~~~a~rl~Ysm~al~dsRS~~lFslD~~sG~irta~~lDREt~e~HvlrVt 240 (2531)
T KOG4289|consen 161 AVQFQQPNYQKELPENEPAGTIIASVKASDPDAGRLYYSMVALFDSRSQNLFSLDPMSGAIRTAKSLDRETKETHVLRVT 240 (2531)
T ss_pred CccCCCcchhccCcCCCCCCceeEEEEecCCCcCceEEEeeeccchhccccEeeccccccchhhhhhhhhhhheeEEEEE
Confidence 45899999999999999999999999999999888999998766666778999999999999999999999998989888
Q ss_pred ecCCcceeEEEeecCcEEEEcccCCccccceEEEEEEeCCCCeEEEEEEEecCCCCCCccCCCceEEEEeCCCCCCeEEE
Q psy8629 92 PLSGENVRVVSFYEPGEIRTKVPLDRETRSSYSLVAIPLSGENVRVVVRVIDENDNAPTFPSPFMSIEFPENTPRDVKRT 171 (483)
Q Consensus 92 a~d~~~~~~~~~~~~g~l~~~~~ld~e~~~~~~~~~~~~~~~~~~v~I~V~DvND~~P~f~~~~~~~~V~E~~~~gt~v~ 171 (483)
|.|.+. +.-+.+++|+|.|.|+|||.|+|.+.+|...+.||.++|..|.
T Consensus 241 A~d~~~-------------------------------P~~SAtttv~V~V~D~nDhsPvFEq~~Y~e~lREn~evGy~vL 289 (2531)
T KOG4289|consen 241 AQDHGD-------------------------------PRRSATTTVTVLVLDTNDHSPVFEQDEYREELRENLEVGYEVL 289 (2531)
T ss_pred eeecCC-------------------------------CcccceeEEEEEEeecCCCCcccchhHHHHHHhhccccCceEE
Confidence 877543 3334588999999999999999999999999999999999999
Q ss_pred EEEEEeCCCCCCceEEEEEEeCCCCCceEEecccCCCceEEEEEEeccCCCCCCCCEEEEEEEEEECCCCCeeeEEEEEE
Q psy8629 172 LNAAKDRDLGIYNTQRYNIVSGNTNNAFRLSSHREKDGVLYLDLQINGVLDRETIPEYSLVIEALDGGSPPLRGSMIVNV 251 (483)
Q Consensus 172 ~v~a~D~D~~~~~~~~y~l~~~~~~~~F~i~~~~~~~g~~~~~l~~~~~LD~E~~~~~~l~v~a~D~g~p~~~~~~~v~I 251 (483)
+++|+|.|.++|+.+.|++..|++.+.|.|++. +|. |++.++||||+...|+|.|.|+|.|.|+...++.|.|
T Consensus 290 tvrAtD~Dsp~Nani~Yrl~eg~~~~~f~in~r---SGv----I~T~a~lDRE~~~~y~L~VeAsDqG~~pgp~Ta~V~i 362 (2531)
T KOG4289|consen 290 TVRATDGDSPPNANIRYRLLEGNAKNVFEINPR---SGV----ISTRAPLDREELESYQLDVEASDQGRPPGPRTAMVEI 362 (2531)
T ss_pred EEEeccCCCCCCCceEEEecCCCccceeEEcCc---cce----eeccCccCHHhhhheEEEEEeccCCCCCCCceEEEEE
Confidence 999999999999999999999988999999994 567 8899999999999999999999999998888999999
Q ss_pred EEEecCCCCCeecCCceEEEecCCCCCCcEEEEEEEEeCCCCCccEEEEEEEecCCCCCcceEEeCCccEEEEcccCCCc
Q psy8629 252 TIQDVNDNQPIFNQSRYFATVPENATVGTSIFQVFATDADAGSNGEVEYSINRRQSDKDGLFNIDSKSGLIFVNKALDFE 331 (483)
Q Consensus 252 ~V~dvNd~~P~f~~~~~~~~v~E~~~~gt~v~~v~a~D~D~~~~~~i~y~i~~~~~~~~~~F~Id~~tG~l~~~~~LD~E 331 (483)
+|.|+|||+|+|....|...|.|+..++++|++|+|+|.|.|.|+.+.|+|. +++..+.|.||..||+|.+..+||||
T Consensus 363 tV~D~NDNaPqFse~~Yvvqv~Edvt~~avvlrV~AtDrD~g~Ng~VHYsi~--Sgn~~G~f~id~~tGel~vv~plD~e 440 (2531)
T KOG4289|consen 363 TVEDENDNAPQFSEKRYVVQVREDVTPPAVVLRVTATDRDKGTNGKVHYSIA--SGNGRGQFYIDSLTGELDVVEPLDFE 440 (2531)
T ss_pred EEEecCCCCccccccceEEEecccCCCCceEEEEEecccCCCcCceEEEEee--ccCccccEEEecccceEEEecccccc
Confidence 9999999999999999999999999999999999999999999999999995 57889999999999999999999999
Q ss_pred ccceeeeEeE--------------EEE---Eee-------------eeeccCCCCeEEEEEEEEeCCCCCCceEEEEEee
Q psy8629 332 TKEVHDLVPR--------------FAV---EIS-------------SFDEIAEPGTSVFQISAFDQDEGINSVITYSLRE 381 (483)
Q Consensus 332 ~~~~~~l~v~--------------~~~---~v~-------------~v~E~~~~gt~v~~v~a~D~D~~~~~~v~y~l~~ 381 (483)
.. .|.+.|+ +++ .|+ ++.||.+.|..++.+.|.|.|.|.|+.++|++.
T Consensus 441 ~~-~ytl~IrAqDggrPpLsn~sgl~iqVlDINDhaPifvstpfq~tvlEnv~lg~~v~~vqaidadsg~na~l~y~la- 518 (2531)
T KOG4289|consen 441 NS-EYTLRIRAQDGGRPPLSNTSGLVIQVLDINDHAPIFVSTPFQATVLENVPLGYLVCHVQAIDADSGENARLHYSLA- 518 (2531)
T ss_pred CC-eeEEEEEcccCCCCCccCCCceEEEEEecCCCCceeEechhhhhhhhcccccceEEEEecccCCCCcccceeeeec-
Confidence 98 9999988 222 222 688999999999999999999999999999997
Q ss_pred CCCCCCCcEEEeCCCcEEEEcccCCCCCCCeeEEEEEEEECCcCCceEEEEEEEEEEecCCCCCeecCCceEEEEcCCCC
Q psy8629 382 NTDDHPSWFQIDSKSGLITMKSNVDCETDPVPKLTVIATDNGVPALSSSATVLVTIHDVNDNEPIFDQSFYNVTIPENKP 461 (483)
Q Consensus 382 ~~~~~~~~F~id~~tG~i~~~~~lD~E~~~~y~l~V~a~D~g~p~~s~~~~v~I~V~dvNd~~P~f~~~~~~~~V~E~~~ 461 (483)
..+.|.|+..+|.|++.+.||||+.+.|.|-|.|+|.|.|++++.+.|.|.+.|+|||.|.|.+..|+..+.|++|
T Consensus 519 ----G~~pf~I~~~SG~Itvtk~ldrEt~~~ysl~V~ard~gtp~l~tstsI~Vtv~dvndndP~Ft~~eytl~inED~p 594 (2531)
T KOG4289|consen 519 ----GVGPFQINNGSGWITVTKELDRETVEHYSLGVEARDHGTPPLSTSTSISVTVLDVNDNDPTFTQKEYTLRINEDAP 594 (2531)
T ss_pred ----cCCCeeEecCCceEEEeecccccccceEEEEEEEcCCCCCcccccceEEEEecccCCCCCccccCceEEEecCCcc
Confidence 3458999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCcEEEEEEEEeCCCCCCCcCC
Q psy8629 462 KGSCILKSIFYDIFNISEHSFK 483 (483)
Q Consensus 462 ~g~~v~~v~a~D~D~~~~~~~~ 483 (483)
.|+.|.+|+|.|.|.++.++|.
T Consensus 595 vgsSI~tvtAvD~d~~s~ityq 616 (2531)
T KOG4289|consen 595 VGSSIVTVTAVDRDANSVITYQ 616 (2531)
T ss_pred ccceEEEEEEeccccccceEEE
Confidence 9999999999999999988873
|
|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here | Back alignment and domain information |
|---|
| >cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here | Back alignment and domain information |
|---|
| >PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >smart00112 CA Cadherin repeats | Back alignment and domain information |
|---|
| >smart00112 CA Cadherin repeats | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion | Back alignment and domain information |
|---|
| >smart00736 CADG Dystroglycan-type cadherin-like domains | Back alignment and domain information |
|---|
| >PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >TIGR01965 VCBS_repeat VCBS repeat | Back alignment and domain information |
|---|
| >TIGR01965 VCBS_repeat VCBS repeat | Back alignment and domain information |
|---|
| >PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion | Back alignment and domain information |
|---|
| >smart00736 CADG Dystroglycan-type cadherin-like domains | Back alignment and domain information |
|---|
| >PF13750 Big_3_3: Bacterial Ig-like domain (group 3) | Back alignment and domain information |
|---|
| >KOG3597|consensus | Back alignment and domain information |
|---|
| >TIGR00845 caca sodium/calcium exchanger 1 | Back alignment and domain information |
|---|
| >PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins | Back alignment and domain information |
|---|
| >TIGR00845 caca sodium/calcium exchanger 1 | Back alignment and domain information |
|---|
| >TIGR03660 T1SS_rpt_143 T1SS-143 repeat domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 483 | ||||
| 1q55_A | 880 | W-Shaped Trans Interactions Of Cadherins Model Base | 2e-22 | ||
| 1q55_A | 880 | W-Shaped Trans Interactions Of Cadherins Model Base | 9e-14 | ||
| 1l3w_A | 546 | C-Cadherin Ectodomain Length = 546 | 2e-22 | ||
| 1l3w_A | 546 | C-Cadherin Ectodomain Length = 546 | 1e-13 | ||
| 3q2w_A | 559 | Crystal Structure Of Mouse N-Cadherin Ectodomain Le | 2e-21 | ||
| 3q2w_A | 559 | Crystal Structure Of Mouse N-Cadherin Ectodomain Le | 6e-09 | ||
| 3q2v_A | 550 | Crystal Structure Of Mouse E-Cadherin Ectodomain Le | 2e-18 | ||
| 3q2v_A | 550 | Crystal Structure Of Mouse E-Cadherin Ectodomain Le | 3e-13 | ||
| 2a62_A | 322 | Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length | 2e-18 | ||
| 2a62_A | 322 | Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length | 6e-13 | ||
| 2a62_A | 322 | Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length | 1e-05 | ||
| 2wcp_A | 214 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length | 3e-13 | ||
| 2wcp_A | 214 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length | 2e-06 | ||
| 2wcp_A | 214 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length | 9e-04 | ||
| 4aqe_A | 214 | Crystal Structure Of Deafness Associated Mutant Mou | 5e-13 | ||
| 4aqe_A | 214 | Crystal Structure Of Deafness Associated Mutant Mou | 4e-06 | ||
| 3mvs_A | 210 | Structure Of The N-Terminus Of Cadherin 23 Length = | 5e-13 | ||
| 3mvs_A | 210 | Structure Of The N-Terminus Of Cadherin 23 Length = | 5e-07 | ||
| 2wd0_A | 214 | Crystal Structure Of Nonsyndromic Deafness (Dfnb12) | 2e-12 | ||
| 2wd0_A | 214 | Crystal Structure Of Nonsyndromic Deafness (Dfnb12) | 3e-06 | ||
| 3lnd_A | 207 | Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 | 3e-12 | ||
| 3lnd_A | 207 | Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 | 8e-06 | ||
| 2ee0_A | 114 | Solution Structures Of The Ca Domain Of Human Proto | 4e-12 | ||
| 2ee0_A | 114 | Solution Structures Of The Ca Domain Of Human Proto | 6e-05 | ||
| 3k5r_A | 218 | Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt | 6e-12 | ||
| 3k5r_A | 218 | Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt | 6e-04 | ||
| 2a4e_A | 215 | Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length | 1e-11 | ||
| 3ubh_A | 419 | Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le | 2e-11 | ||
| 1edh_A | 226 | E-Cadherin Domains 1 And 2 In Complex With Calcium | 3e-11 | ||
| 1edh_A | 226 | E-Cadherin Domains 1 And 2 In Complex With Calcium | 6e-11 | ||
| 3q2n_A | 213 | Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | 7e-10 | ||
| 3q2n_A | 213 | Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | 2e-06 | ||
| 2yst_A | 119 | Solution Structure Of The Third Cadherin Domain Fro | 7e-10 | ||
| 1q1p_A | 212 | E-Cadherin Activation Length = 212 | 9e-10 | ||
| 1q1p_A | 212 | E-Cadherin Activation Length = 212 | 1e-06 | ||
| 3lng_A | 215 | Crystal Structure Of E-Cadherin Ec12 Aa Extension L | 9e-10 | ||
| 3lng_A | 215 | Crystal Structure Of E-Cadherin Ec12 Aa Extension L | 1e-06 | ||
| 1ff5_A | 219 | Structure Of E-Cadherin Double Domain Length = 219 | 9e-10 | ||
| 1ff5_A | 219 | Structure Of E-Cadherin Double Domain Length = 219 | 9e-09 | ||
| 3lne_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14e Length = | 1e-09 | ||
| 3lne_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14e Length = | 2e-06 | ||
| 3lnf_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14ew2a Length | 1e-09 | ||
| 3lnf_A | 213 | Crystal Structure Of E-Cadherin Ec12 K14ew2a Length | 1e-06 | ||
| 3qrb_A | 213 | Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt | 1e-09 | ||
| 3qrb_A | 213 | Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt | 1e-06 | ||
| 3lnh_A | 213 | Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 | 1e-09 | ||
| 3lnh_A | 213 | Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 | 1e-06 | ||
| 2qvf_B | 213 | Mouse E-cadherin Domains 1,2 Length = 213 | 1e-09 | ||
| 2qvf_B | 213 | Mouse E-cadherin Domains 1,2 Length = 213 | 2e-06 | ||
| 3lni_A | 213 | Crystal Structure Of E-Cadherin Ec12 E89a Length = | 1e-09 | ||
| 3lni_A | 213 | Crystal Structure Of E-Cadherin Ec12 E89a Length = | 1e-06 | ||
| 3k5s_A | 217 | Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len | 2e-09 | ||
| 2o72_A | 213 | Crystal Structure Analysis Of Human E-Cadherin (1-2 | 2e-09 | ||
| 3q2l_A | 213 | Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | 4e-09 | ||
| 3q2l_A | 213 | Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | 1e-06 | ||
| 3ppe_A | 203 | Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng | 4e-08 | ||
| 1suh_A | 146 | Amino-Terminal Domain Of Epithelial Cadherin In The | 5e-08 | ||
| 4apx_B | 242 | Crystal Structure Of Mouse Cadherin-23 Ec1-2 And Pr | 7e-08 | ||
| 1ncj_A | 215 | N-Cadherin, Two-Domain Fragment Length = 215 | 7e-07 | ||
| 1ncj_A | 215 | N-Cadherin, Two-Domain Fragment Length = 215 | 3e-04 | ||
| 2qvi_A | 215 | Crystal Structure Of N-Cadherin Domains Ec12 Length | 8e-07 | ||
| 2qvi_A | 215 | Crystal Structure Of N-Cadherin Domains Ec12 Length | 2e-04 | ||
| 3ubf_A | 316 | Crystal Structure Of Drosophila N-Cadherin Ec1-3, I | 1e-04 |
| >pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 | Back alignment and structure |
|
| >pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 | Back alignment and structure |
| >pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 | Back alignment and structure |
| >pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 | Back alignment and structure |
| >pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 | Back alignment and structure |
| >pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 | Back alignment and structure |
| >pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 | Back alignment and structure |
| >pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 | Back alignment and structure |
| >pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 | Back alignment and structure |
| >pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 | Back alignment and structure |
| >pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 | Back alignment and structure |
| >pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 | Back alignment and structure |
| >pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 | Back alignment and structure |
| >pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 | Back alignment and structure |
| >pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 | Back alignment and structure |
| >pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 | Back alignment and structure |
| >pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 | Back alignment and structure |
| >pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 | Back alignment and structure |
| >pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 | Back alignment and structure |
| >pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 | Back alignment and structure |
| >pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 | Back alignment and structure |
| >pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 | Back alignment and structure |
| >pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 | Back alignment and structure |
| >pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 | Back alignment and structure |
| >pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 | Back alignment and structure |
| >pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 | Back alignment and structure |
| >pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | Back alignment and structure |
| >pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 | Back alignment and structure |
| >pdb|2YST|A Chain A, Solution Structure Of The Third Cadherin Domain From Human Protocadherin 7 Length = 119 | Back alignment and structure |
| >pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 | Back alignment and structure |
| >pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 | Back alignment and structure |
| >pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 | Back alignment and structure |
| >pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 | Back alignment and structure |
| >pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 | Back alignment and structure |
| >pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 | Back alignment and structure |
| >pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 | Back alignment and structure |
| >pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 | Back alignment and structure |
| >pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 | Back alignment and structure |
| >pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 | Back alignment and structure |
| >pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 | Back alignment and structure |
| >pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 | Back alignment and structure |
| >pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 | Back alignment and structure |
| >pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 | Back alignment and structure |
| >pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 | Back alignment and structure |
| >pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 | Back alignment and structure |
| >pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 | Back alignment and structure |
| >pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 | Back alignment and structure |
| >pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 | Back alignment and structure |
| >pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 | Back alignment and structure |
| >pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | Back alignment and structure |
| >pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 | Back alignment and structure |
| >pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 | Back alignment and structure |
| >pdb|1SUH|A Chain A, Amino-Terminal Domain Of Epithelial Cadherin In The Calcium Bound State, Nmr, 20 Structures Length = 146 | Back alignment and structure |
| >pdb|4APX|B Chain B, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And Protocadherin-15 Ec1-2 Form I Length = 242 | Back alignment and structure |
| >pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 | Back alignment and structure |
| >pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 | Back alignment and structure |
| >pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 | Back alignment and structure |
| >pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 | Back alignment and structure |
| >pdb|3UBF|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-3, I Length = 316 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 483 | |||
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 9e-87 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 2e-72 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 3e-70 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 8e-24 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 7e-84 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 4e-72 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 1e-69 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 4e-82 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 2e-71 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 1e-68 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 1e-59 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 4e-44 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 6e-09 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 1e-81 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 1e-79 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 1e-67 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 2e-25 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 2e-74 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 1e-72 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 5e-64 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 8e-59 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 4e-40 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 1e-25 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 2e-22 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 3e-06 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 2e-59 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 5e-55 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 2e-48 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 4e-23 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 8e-55 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 5e-51 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 9e-30 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 7e-27 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 3e-48 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 3e-40 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 5e-31 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 1e-28 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 6e-05 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 6e-48 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 2e-36 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 9e-28 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 6e-27 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 3e-04 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 4e-47 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 6e-34 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 6e-29 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 1e-24 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 1e-46 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 3e-41 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 4e-32 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 6e-28 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 3e-07 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 3e-46 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 1e-38 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 2e-31 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 2e-25 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 8e-05 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 3e-45 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 1e-33 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 2e-26 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 2e-23 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 4e-44 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 2e-33 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 3e-32 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 4e-19 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 2e-10 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 5e-34 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 3e-21 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 1e-15 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 5e-10 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 3e-33 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 1e-31 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 5e-21 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 7e-10 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 6e-08 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 4e-25 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 3e-18 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 2e-15 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 2e-10 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 2e-23 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 2e-16 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 7e-14 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 9e-11 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 5e-17 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 8e-15 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 6e-14 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 3e-06 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 4e-04 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 1e-16 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 8e-16 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 5e-12 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 1e-04 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 2e-04 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 1e-15 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 3e-13 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 7e-13 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 7e-05 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 2e-15 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 7e-15 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 2e-14 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 4e-05 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 8e-04 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 2e-14 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 2e-12 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 1e-10 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 1e-05 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 4e-04 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 5e-12 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 6e-11 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 1e-10 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-12 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 6e-04 |
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
Score = 275 bits (706), Expect = 9e-87
Identities = 106/412 (25%), Positives = 169/412 (41%), Gaps = 71/412 (17%)
Query: 107 GEIRTKVPLDRETRSSYSLVAI-------PLSGENVRVVVRVIDENDNAPTFPSPFMSIE 159
G ++ PLDRE + Y L + + + +V+ V D+NDN P F
Sbjct: 58 GWLKVTQPLDREAIAKYILYSHAVSSNGEAVEDP-MEIVITVTDQNDNRPEFTQEVFEGS 116
Query: 160 FPENTPRDVKRTLNAAKDRDLGIY--NTQ-RYNIVSGN----TNNAFRLSSHREKDGVLY 212
E +A D D + N Y IVS + N F ++ GV+
Sbjct: 117 VAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNR---DTGVIS 173
Query: 213 LDLQINGVLDRETIPEYSLVIEALDGGSPPLRGSMIVNVTIQDVNDNQPIFNQSRYFATV 272
+ + LDRE+ P Y+LV++A D L + +T++D+NDN P+FN S Y V
Sbjct: 174 V---LTSGLDRESYPTYTLVVQAADLQGEGLSTTAKAVITVKDINDNAPVFNPSTYQGQV 230
Query: 273 PENATVGTSIFQVFATDADAGSNGEVE--YSINRRQSDKDGLFNI----DSKSGLIFVNK 326
PEN V I + TD DA + + Y++ +D D F + + G++ K
Sbjct: 231 PENE-VNARIATLKVTDDDAPNTPAWKAVYTV---VNDPDQQFVVVTDPTTNDGILKTAK 286
Query: 327 ALDFETKEVHDLV------------------------------PRF--AVEISSFDEIAE 354
LDFE K+ + L P F A E
Sbjct: 287 GLDFEAKQQYILHVRVENEEPFEGSLVPSTATVTVDVVDVNEAPIFMPAERRVEVPEDFG 346
Query: 355 PGTSVFQISAFDQDEGINSVITYSLRENTDDHPSWFQIDSKSGLITMKSNVDCETDPVPK 414
G + +A + D ++ ITY + +T +W +I+ ++G I ++ +D E K
Sbjct: 347 VGQEITSYTAREPDTFMDQKITYRIWRDTA---NWLEINPETGAIFTRAEMDREDAEHVK 403
Query: 415 -----LTVIATDNGVPALSSSATVLVTIHDVNDNEPIFDQSFYNVTIPENKP 461
+IATD+G P + + T+L+ + DVNDN PI + +P
Sbjct: 404 NSTYVALIIATDDGSPIATGTGTLLLVLLDVNDNAPIPEPRNMQFCQRNPQP 455
|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Length = 125 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 483 | |||
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 100.0 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 100.0 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 100.0 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 100.0 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 100.0 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 100.0 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 100.0 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 100.0 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 100.0 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 100.0 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 100.0 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 100.0 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 100.0 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 100.0 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 100.0 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 100.0 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 100.0 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 100.0 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 100.0 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 100.0 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 100.0 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 100.0 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 100.0 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 100.0 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 100.0 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 100.0 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 100.0 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 100.0 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 100.0 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 100.0 | |
| 4apx_B | 242 | Protocadherin-15, otocadherin; cell adhesion, hear | 99.97 | |
| 4apx_B | 242 | Protocadherin-15, otocadherin; cell adhesion, hear | 99.97 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 99.94 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 99.93 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 99.91 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 99.89 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 99.85 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 99.83 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 99.82 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 99.8 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 99.77 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 99.73 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 99.73 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 99.73 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 99.71 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 99.7 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 99.7 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 99.69 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 99.69 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 99.67 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 99.65 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 99.63 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 99.63 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 99.61 | |
| 1wuz_A | 103 | Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p | 99.51 | |
| 1wuz_A | 103 | Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p | 99.35 | |
| 3rb5_A | 298 | Na/Ca exchange protein; CBD12, calcium binding and | 91.03 | |
| 2yhg_A | 437 | SDE_182CT, cellulose-binding protein; hydrolase, g | 89.24 | |
| 2yhg_A | 437 | SDE_182CT, cellulose-binding protein; hydrolase, g | 87.92 | |
| 3gin_A | 160 | Sodium/calcium exchanger 1; CBD1, CBD2, NCX, calci | 84.41 | |
| 1op4_A | 159 | Neural-cadherin; beta sandwich, cadherin-like doma | 82.42 |
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.8e-71 Score=611.85 Aligned_cols=452 Identities=23% Similarity=0.365 Sum_probs=324.9
Q ss_pred hhhHHHHHHH--------------HhhhcCceEEEEEe-CCCCCCeEEEEEEccCCCCC-CCCEEEEecCCCCCcccEEE
Q psy8629 2 RLWRLLWLLA--------------AVAADEHLRDLEIS-EGVPVGTRVGFIGDGFVGDS-GPPYLIVPVPGSAVDTDLSI 65 (483)
Q Consensus 2 ~~~~~~~~~~--------------~~~~~~~~~~~~v~-En~~~gt~V~~v~a~d~d~~-~~~y~i~~~~~~~~~~~F~I 65 (483)
.+|.+++|++ ++.|.+..|.++|+ |++++|+.|++++|+|.|.+ .+.|++.. ..|+|
T Consensus 10 ~~~~~~~~~~~q~~~~~~~d~ndn~P~F~~~~y~~~v~~e~~~~Gt~V~~v~a~D~D~n~~i~Y~~~~-------~~F~I 82 (880)
T 1q55_A 10 SVWLCGLLCLLQVVPSINADVSGCKPGFSSAEYIFSVNRRELERGRKLGKVNFSDCTTRKHGLYDVGD-------SRFRV 82 (880)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred hHHHHHHHHHhhheeeecccccCCCCccCCCeEEEEechhhCCCCCEEEEEEEEeCCCCceEEEEeCC-------CCEEE
Confidence 4788876553 45799999999999 99999999999999998844 46888742 28999
Q ss_pred eCCccEEEeCccCCccCCceeeEEEEecCCcc-----------ee-----------------------------------
Q psy8629 66 EQNTGEIRTKVPLDRETRSSYSLVAIPLSGEN-----------VR----------------------------------- 99 (483)
Q Consensus 66 d~~tG~i~~~~~LD~E~~~~y~l~v~a~d~~~-----------~~----------------------------------- 99 (483)
++ +|.|+++++||||.. |.|.|.|.|++. +.
T Consensus 83 d~-~G~i~~~~~Ld~e~~--~~l~V~A~D~~~~~~~~~v~v~~v~~~~~~~~~~~~~~~~~p~f~~~~~~~~r~~r~~~~ 159 (880)
T 1q55_A 83 LP-DGTVLVKRHVKLHKD--TKFTISTWDARGIKHSTNIAVASKRHRSGEEAHSRSSKLPVLTFPETHTGLKRKKRDWVI 159 (880)
T ss_dssp ----------------------------------------------------------------------------CCCC
T ss_pred CC-CceEEECCccccccc--eEEEEEEEcCCCCeEEEEEEEEEecccccccccccccccCcccccccccccceeeccccc
Confidence 98 799999999999987 777777766421 00
Q ss_pred ----------------E-----------------------------EEee-cCcEEEEcccCCccccceEEEEEEeCCCC
Q psy8629 100 ----------------V-----------------------------VSFY-EPGEIRTKVPLDRETRSSYSLVAIPLSGE 133 (483)
Q Consensus 100 ----------------~-----------------------------~~~~-~~g~l~~~~~ld~e~~~~~~~~~~~~~~~ 133 (483)
+ |.+. ++|.|+++++||||.+..|.|.+.+.|++
T Consensus 160 ~~~~v~En~~~~~~~~v~~v~~d~d~~~~v~Ysi~~~~~~~~~~~~F~Id~~tG~l~~~~~LDrE~~~~y~l~v~A~D~g 239 (880)
T 1q55_A 160 PPIKVSENERGPFPKRLVQIKSNKDRFNKVYYSITGQGADNPPQGVFRIEWETGWMLVTRPLDREEYDKYVLSSHAVSEN 239 (880)
T ss_dssp CCEEEESSCCSSSCEEEEECCCSGGGSSCEEEEEEEBTTTBSSTTSEEECTTTCEEEECSCCCTTTCCEEEEEEEEEESS
T ss_pred cceEEeCCCCCCCCeEEEEEeeCCCCCceEEEEEECCCCCCCcCCEEEEECCcCEEEECCccCccccCccEEEEEEEECC
Confidence 0 0000 26889999999999999999999988753
Q ss_pred ------eEEEEEEEecCCCCCCccCCCceEEEEeCCCCCCeEEEEEEEEeCCCC---CCceEEEEEEeCC----CCCceE
Q psy8629 134 ------NVRVVVRVIDENDNAPTFPSPFMSIEFPENTPRDVKRTLNAAKDRDLG---IYNTQRYNIVSGN----TNNAFR 200 (483)
Q Consensus 134 ------~~~v~I~V~DvND~~P~f~~~~~~~~V~E~~~~gt~v~~v~a~D~D~~---~~~~~~y~l~~~~----~~~~F~ 200 (483)
++.|.|+|.|+|||+|.|.+..|.+.|+|++++|+.|+++.|+|+|.| .|+.++|+|.++. ..+.|.
T Consensus 240 ~~~~~~~~~v~I~V~DvNDn~P~F~~~~y~~~V~En~~~Gt~V~~v~AtD~D~g~~~~N~~v~Ysi~~~~~~~~~~~~F~ 319 (880)
T 1q55_A 240 GSPVEEPMEITINVIDQNDNRPKFTQDVFRGSVREGVQPGTQVMAVSATDEDDNIDSLNGVLSYSILKQDPEEPIPNLFT 319 (880)
T ss_dssp SCBCSCCEEEEEEEECCSCCCCEESSSCEEEEEETTCCSSEEEEECCEECCSCCSSSSTTCCEEEEEEESSCCSCSCSEE
T ss_pred CCceeeeEEEEEEEEecCCCCCCccCCcEEEEEeCCCCCCceeEEEEEEcCCCCCCCcCcEEEEEEcCCCCCcccCCeEE
Confidence 589999999999999999999999999999999999999999999998 6899999999876 347999
Q ss_pred EecccCCCceEEEEEEe-ccCCCCCCCCEEEEEEEEEECCCCCeeeEEEEEEEEEecCCCCCeecCCceEEEecCCCCCC
Q psy8629 201 LSSHREKDGVLYLDLQI-NGVLDRETIPEYSLVIEALDGGSPPLRGSMIVNVTIQDVNDNQPIFNQSRYFATVPENATVG 279 (483)
Q Consensus 201 i~~~~~~~g~~~~~l~~-~~~LD~E~~~~~~l~v~a~D~g~p~~~~~~~v~I~V~dvNd~~P~f~~~~~~~~v~E~~~~g 279 (483)
|++. +|. |.+ .+.||||....|.|+|+|+|+|+|+++++++|+|+|.|+|||+|.|....|.++|+|| ++|
T Consensus 320 Id~~---tG~----I~~~~~~LDrE~~~~y~l~V~A~D~g~~~~s~~~~v~I~V~DvNDn~P~F~~~~y~~~V~En-~~g 391 (880)
T 1q55_A 320 INRE---TGV----ISLIGTGLDREKFPEYTLTVQATDLEGAGLSVEGKAIIQITDANDNAPIFDPKTYTALVPEN-EIG 391 (880)
T ss_dssp ECTT---TCE----EEECSCCCCTTTCCEEEEEEEEEHHHHTSCEEECCEEEEEECCCCCCCCBSCSEEEEEEESS-SCC
T ss_pred EccC---Ccc----EEEecccCCHHHcceeEEEEEEEECCCCCccceeEEEEEEEeccCCCCCccccceEEEeecC-CCC
Confidence 9984 566 555 4789999999999999999999999999999999999999999999999999999999 999
Q ss_pred cEEEEEEEEeCC--CCCccEEEEEEEecCCCCCcceEEe--C--CccEEEEcccCCCcccceeeeEeEE-----------
Q psy8629 280 TSIFQVFATDAD--AGSNGEVEYSINRRQSDKDGLFNID--S--KSGLIFVNKALDFETKEVHDLVPRF----------- 342 (483)
Q Consensus 280 t~v~~v~a~D~D--~~~~~~i~y~i~~~~~~~~~~F~Id--~--~tG~l~~~~~LD~E~~~~~~l~v~~----------- 342 (483)
+.|+++.|+|+| .+.|+.++|+|.. +..+.|.|+ + .+|.|++.++||||....|.|+|+.
T Consensus 392 t~V~~v~A~D~D~~~g~n~~v~Ysi~~---~~~~~F~I~~d~~~~~G~i~~~~~LD~E~~~~y~l~V~A~D~~~~~~~~~ 468 (880)
T 1q55_A 392 FEVQRLSVTDLDMPGTPAWQAVYKIRV---NEGGFFNITTDPESNQGILTTAKGLDFELRKQYVLQITVENAEPFSVPLP 468 (880)
T ss_dssp CEEEEECBCCCSCTTSTTSCEECCBSC---CTTSCEEEEECTTTCCEEEEESSCCCCSSCCCEEEEECCEESSCCSSCCC
T ss_pred cEEEEEEEECCCCCCCCCceEEEEEec---CCCceEEEEecCCCceEEEecccCCCcccCCcEEEEEEEEECCCCCCCCc
Confidence 999999999999 6789999999953 567899995 3 6899999999999999999998872
Q ss_pred ------EEEee---------------eeeccCCCCeEEEEEEEEeCCCCCCceEEEEEeeCCCCCCCcEEEeCCCcEEEE
Q psy8629 343 ------AVEIS---------------SFDEIAEPGTSVFQISAFDQDEGINSVITYSLRENTDDHPSWFQIDSKSGLITM 401 (483)
Q Consensus 343 ------~~~v~---------------~v~E~~~~gt~v~~v~a~D~D~~~~~~v~y~l~~~~~~~~~~F~id~~tG~i~~ 401 (483)
.+.|. .|.|++++|+.|+++.|+|+|.|.|+.++|+|.. +..++|.|++.+|.|++
T Consensus 469 sst~tV~I~V~DvND~P~f~~~~y~~~V~En~~~Gt~V~~v~A~D~D~g~n~~v~Ysi~~---~~~~~F~Id~~tG~I~~ 545 (880)
T 1q55_A 469 TSTATVTVTVEDVNEAPFFVPAVSRVDVSEDLSRGEKIISLVAQDPDKQQIQKLSYFIGN---DPARWLTVNKDNGIVTG 545 (880)
T ss_dssp CCCEEEEEEEECCCCCCEESSCEECCCBCTTCCSSEEEEECCEECCCTTCCCCEEEEECC---CSSCCCEEETTTTEEEE
T ss_pred ceeEEEEEEEEeCCCCCEEecCceEEEEeCCCCCCCEEEEEEEEeCCCCCCCcEEEEECC---CCCCCEEEeCCccEEEE
Confidence 22221 5789999999999999999999999999999983 45689999999999999
Q ss_pred cccCCCCCC----CeeEEEEEEEECCcCCceEEEEEEEEEEecCCCCCeecCCceEEEEcCCCCCCcEEEEEEEEeCCCC
Q psy8629 402 KSNVDCETD----PVPKLTVIATDNGVPALSSSATVLVTIHDVNDNEPIFDQSFYNVTIPENKPKGSCILKSIFYDIFNI 477 (483)
Q Consensus 402 ~~~lD~E~~----~~y~l~V~a~D~g~p~~s~~~~v~I~V~dvNd~~P~f~~~~~~~~V~E~~~~g~~v~~v~a~D~D~~ 477 (483)
.+.||||.. ..|+|+|+|+|+|.|+++++++|+|+|.|+|||+|.|.+. ...|+|+.++|+ + |.|+|+|.+
T Consensus 546 ~~~LDrE~~~~~~~~y~l~V~A~D~g~p~~sst~tv~I~V~DvNDn~P~f~~~--~~~v~E~~~~g~-v--v~A~D~D~~ 620 (880)
T 1q55_A 546 NGNLDRESEYVKNNTYTVIMLVTDDGVSVGTGTGTLILHVLDVNDNGPVPSPR--VFTMCDQNPEPQ-V--LTISDADIP 620 (880)
T ss_dssp CSCCCTTSSSCCSSCCEEEEEEEECSSSCCCCCEEEECCBCCCCCSCCCBSCC--CEEECSSSCCCE-E--EEBCCSSCT
T ss_pred CCccCcccccCCCCEEEEEEEEEECCCCCcEeEEEEEEEEEeCCCCCCCccCc--ceEEecCCCCCe-E--EEEecCCCC
Confidence 999999997 8999999999999999999999999999999999999854 678999999998 3 999999966
Q ss_pred CC---CcC
Q psy8629 478 SE---HSF 482 (483)
Q Consensus 478 ~~---~~~ 482 (483)
.+ ++|
T Consensus 621 ~n~~~~~y 628 (880)
T 1q55_A 621 PNTYPYKV 628 (880)
T ss_dssp TTTCCCCC
T ss_pred CCCceEEE
Confidence 53 555
|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} | Back alignment and structure |
|---|
| >4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* | Back alignment and structure |
|---|
| >4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B | Back alignment and structure |
|---|
| >1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3rb5_A Na/Ca exchange protein; CBD12, calcium binding and regulation, metal binding protein; 2.35A {Drosophila melanogaster} PDB: 3rb7_A 3e9u_A | Back alignment and structure |
|---|
| >2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} | Back alignment and structure |
|---|
| >2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} | Back alignment and structure |
|---|
| >3gin_A Sodium/calcium exchanger 1; CBD1, CBD2, NCX, calcium binding domain 1, antiport, calcium transport, calmodulin-binding, cell membrane; 2.40A {Canis lupus familiaris} PDB: 2dpk_A* 2fws_A | Back alignment and structure |
|---|
| >1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 483 | ||||
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 2e-16 | |
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 2e-08 | |
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 3e-06 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 8e-16 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 5e-09 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 3e-07 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 6e-15 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 1e-07 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 1e-06 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 8e-14 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 4e-09 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 1e-07 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 5e-05 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 2e-13 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 1e-08 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 1e-07 | |
| d1l3wa3 | 113 | b.1.6.1 (A:214-326) C-cadherin ectodomain {African | 5e-04 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 4e-13 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 5e-13 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 2e-12 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 3e-04 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 3e-12 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 1e-09 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 8e-08 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 6e-05 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 2e-11 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 8e-09 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 3e-07 | |
| d1ncja2 | 114 | b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu | 4e-05 | |
| d1op4a_ | 136 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 2e-09 | |
| d1op4a_ | 136 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 2e-08 | |
| d1op4a_ | 136 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 9e-08 | |
| d1op4a_ | 136 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 1e-06 | |
| d1l3wa5 | 107 | b.1.6.1 (A:434-540) C-cadherin ectodomain {African | 3e-09 | |
| d1l3wa5 | 107 | b.1.6.1 (A:434-540) C-cadherin ectodomain {African | 4e-05 |
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cadherin-like family: Cadherin domain: C-cadherin ectodomain species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Score = 72.1 bits (176), Expect = 2e-16
Identities = 14/88 (15%), Positives = 34/88 (38%), Gaps = 2/88 (2%)
Query: 354 EPGTSVFQISAFDQDEGINSVITYSLRENTDDHP--SWFQIDSKSGLITMKSNVDCETDP 411
E G ++ ++ + + YS+ D+P F+I+ ++G + + +D E
Sbjct: 13 ERGPFPKRLVQIKSNKDRFNKVYYSITGQGADNPPQGVFRIEWETGWMLVTRPLDREEYD 72
Query: 412 VPKLTVIATDNGVPALSSSATVLVTIHD 439
L+ A + + + + D
Sbjct: 73 KYVLSSHAVSENGSPVEEPMEITINVID 100
|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 483 | |||
| d1l3wa2 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.81 | |
| d1edha2 | 112 | E-cadherin (epithelial) {Mouse (Mus musculus) [Tax | 99.81 | |
| d1edha2 | 112 | E-cadherin (epithelial) {Mouse (Mus musculus) [Tax | 99.8 | |
| d1l3wa2 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.79 | |
| d1ncja2 | 114 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.78 | |
| d1l3wa4 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.77 | |
| d1l3wa4 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.77 | |
| d1op4a_ | 136 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.74 | |
| d1ncja2 | 114 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.73 | |
| d1op4a_ | 136 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.72 | |
| d1l3wa3 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.7 | |
| d1l3wa3 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.65 | |
| d1l3wa5 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.61 | |
| d1l3wa5 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.55 | |
| d1l3wa1 | 100 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.55 | |
| d1ncia_ | 102 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.53 | |
| d2omzb1 | 104 | E-cadherin (epithelial) {Human (Homo sapiens) [Tax | 99.51 | |
| d1l3wa1 | 100 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.45 | |
| d2omzb1 | 104 | E-cadherin (epithelial) {Human (Homo sapiens) [Tax | 99.44 | |
| d1ncia_ | 102 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.44 | |
| d1u2ca1 | 103 | Dystroglycan, N-terminal domain {Mouse (Mus muscul | 91.99 |
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cadherin-like family: Cadherin domain: C-cadherin ectodomain species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Probab=99.81 E-value=3.2e-20 Score=151.94 Aligned_cols=105 Identities=27% Similarity=0.394 Sum_probs=93.7
Q ss_pred CCCCCCccCCCceEEEEeCCCCCCeEEEEEEEEeCCCC---CCceEEEEEEeCCC----CCceEEecccCCCceEEEEEE
Q psy8629 144 ENDNAPTFPSPFMSIEFPENTPRDVKRTLNAAKDRDLG---IYNTQRYNIVSGNT----NNAFRLSSHREKDGVLYLDLQ 216 (483)
Q Consensus 144 vND~~P~f~~~~~~~~V~E~~~~gt~v~~v~a~D~D~~---~~~~~~y~l~~~~~----~~~F~i~~~~~~~g~~~~~l~ 216 (483)
.|||+|+|.+..|.+.|+|++++|+.|+++.|+|+|.+ .|+.+.|+|..++. ...|.|++. +|. |.
T Consensus 1 eNDn~P~F~~~~y~~~V~En~~~gt~v~~v~A~D~D~~~~~~n~~i~y~i~~~~~~~~~~~~F~i~~~---tG~----i~ 73 (113)
T d1l3wa2 1 QNDNRPKFTQDVFRGSVREGVQPGTQVMAVSATDEDDNIDSLNGVLSYSILKQDPEEPIPNLFTINRE---TGV----IS 73 (113)
T ss_dssp CSCCCCEESSSCEEEEEETTCCSSEEEEECCEECCSCCSSSSTTCCEEEEEEESSCCSCSCSEEECTT---TCE----EE
T ss_pred CCCCCCccCCCeEEEEEECCCCCCCEEEEEEeecccccccccceEEEEEEecCCCCccccceeeeeec---cee----EE
Confidence 59999999999999999999999999999999999976 46789999987653 368999884 566 55
Q ss_pred e-ccCCCCCCCCEEEEEEEEEECCCCCeeeEEEEEEEEEe
Q psy8629 217 I-NGVLDRETIPEYSLVIEALDGGSPPLRGSMIVNVTIQD 255 (483)
Q Consensus 217 ~-~~~LD~E~~~~~~l~v~a~D~g~p~~~~~~~v~I~V~d 255 (483)
+ .++||||....|.|.|+|+|.|+|+++++++|+|+|+|
T Consensus 74 ~~~~~LD~E~~~~y~l~V~a~D~~~~~~~~~~~v~I~V~D 113 (113)
T d1l3wa2 74 LIGTGLDREKFPEYTLTVQATDLEGAGLSVEGKAIIQITD 113 (113)
T ss_dssp ECSCCCCTTTCCEEEEEEEEEHHHHTSCEEECCEEEEEEC
T ss_pred EeccccCcccCCEEEEEEEEEECCCCCcEEEEEEEEEEEC
Confidence 5 46899999999999999999999999999999999987
|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|