Psyllid ID: psy8719

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30---
MDRALIFCRTKLDCDNLERYLNSIDRRLIYYFT
cccEEEEEEcccccHHHHHHHHHHcccEEEEEc
cccEEEEEEcccccHHHHHHHHHHcccEEEEcc
MDRALIFCRTKLDCDNLERYLNSIDRRLIYYFT
mdralifcrtkldcdnlerylnsidrrLIYYFT
MDRALIFCRTKLDCDNLERYLNSIDRRLIYYFT
***ALIFCRTKLDCDNLERYLNSIDRRLIYYF*
*DRALIFCRTKLDCDNLERYLNSIDRRLIYYFT
MDRALIFCRTKLDCDNLERYLNSIDRRLIYYFT
*DRALIFCRTKLDCDNLERYLNSIDRRLIYYFT
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhooooooooooo
ooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRALIFCRTKLDCDNLERYLNSIDRRLIYYFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query33 2.2.26 [Sep-21-2011]
Q9VNV3 727 ATP-dependent RNA helicas yes N/A 0.636 0.028 0.857 4e-05
Q5XH91 740 ATP-dependent RNA helicas yes N/A 0.636 0.028 0.761 0.0002
A2VD92 740 ATP-dependent RNA helicas N/A N/A 0.636 0.028 0.761 0.0002
Q641Y8 740 ATP-dependent RNA helicas yes N/A 0.636 0.028 0.761 0.0002
Q5NVJ8 740 ATP-dependent RNA helicas yes N/A 0.636 0.028 0.761 0.0002
Q91VR5 740 ATP-dependent RNA helicas yes N/A 0.636 0.028 0.761 0.0002
Q4R7L5 740 ATP-dependent RNA helicas N/A N/A 0.636 0.028 0.761 0.0002
Q92499 740 ATP-dependent RNA helicas yes N/A 0.636 0.028 0.761 0.0002
Q0IIK5 740 ATP-dependent RNA helicas yes N/A 0.636 0.028 0.761 0.0002
Q90WU3 740 ATP-dependent RNA helicas yes N/A 0.636 0.028 0.714 0.0003
>sp|Q9VNV3|DDX1_DROME ATP-dependent RNA helicase Ddx1 OS=Drosophila melanogaster GN=Ddx1 PE=2 SV=1 Back     alignment and function desciption
 Score = 46.6 bits (109), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/21 (85%), Positives = 20/21 (95%)

Query: 1   MDRALIFCRTKLDCDNLERYL 21
           MDRA+IFCRTK DCDNLER+L
Sbjct: 505 MDRAIIFCRTKQDCDNLERFL 525
Acts as an ATP-dependent RNA helicase, able to unwind both RNA-RNA and RNA-DNA duplexes. Possesses 5' single-stranded RNA overhang nuclease activity.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q5XH91|DDX1_XENTR ATP-dependent RNA helicase DDX1 OS=Xenopus tropicalis GN=ddx1 PE=2 SV=1 Back     alignment and function description
>sp|A2VD92|DDX1_XENLA ATP-dependent RNA helicase DDX1 OS=Xenopus laevis GN=ddx1 PE=2 SV=1 Back     alignment and function description
>sp|Q641Y8|DDX1_RAT ATP-dependent RNA helicase DDX1 OS=Rattus norvegicus GN=Ddx1 PE=2 SV=1 Back     alignment and function description
>sp|Q5NVJ8|DDX1_PONAB ATP-dependent RNA helicase DDX1 OS=Pongo abelii GN=DDX1 PE=2 SV=1 Back     alignment and function description
>sp|Q91VR5|DDX1_MOUSE ATP-dependent RNA helicase DDX1 OS=Mus musculus GN=Ddx1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R7L5|DDX1_MACFA ATP-dependent RNA helicase DDX1 OS=Macaca fascicularis GN=DDX1 PE=2 SV=1 Back     alignment and function description
>sp|Q92499|DDX1_HUMAN ATP-dependent RNA helicase DDX1 OS=Homo sapiens GN=DDX1 PE=1 SV=2 Back     alignment and function description
>sp|Q0IIK5|DDX1_BOVIN ATP-dependent RNA helicase DDX1 OS=Bos taurus GN=DDX1 PE=2 SV=1 Back     alignment and function description
>sp|Q90WU3|DDX1_CHICK ATP-dependent RNA helicase DDX1 OS=Gallus gallus GN=DDX1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query33
156550743 730 PREDICTED: ATP-dependent RNA helicase Dd 0.848 0.038 0.827 9e-06
321469806 737 hypothetical protein DAPPUDRAFT_211767 [ 0.818 0.036 0.777 1e-05
312378013 266 hypothetical protein AND_10520 [Anophele 0.848 0.105 0.75 2e-05
189239355 731 PREDICTED: similar to DEAD box ATP-depen 0.787 0.035 0.769 2e-05
332022361 729 ATP-dependent RNA helicase Ddx1 [Acromyr 0.636 0.028 1.0 6e-05
322778877 741 hypothetical protein SINV_12578 [Solenop 0.636 0.028 1.0 6e-05
307172370 713 ATP-dependent RNA helicase Ddx1 [Campono 0.636 0.029 1.0 6e-05
383865900 735 PREDICTED: ATP-dependent RNA helicase Dd 0.727 0.032 0.833 6e-05
170060755 690 ATP-dependent RNA helicase Ddx1 [Culex q 0.727 0.034 0.833 6e-05
170054518 611 ATP-dependent RNA helicase Ddx1 [Culex q 0.727 0.039 0.833 6e-05
>gi|156550743|ref|XP_001606114.1| PREDICTED: ATP-dependent RNA helicase Ddx1-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score = 54.3 bits (129), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 24/29 (82%), Positives = 25/29 (86%), Gaps = 1/29 (3%)

Query: 1   MDRALIFCRTKLDCDNLERYLNSI-DRRL 28
           MDRALIFCRTKLDCDNLERYL  + DR L
Sbjct: 506 MDRALIFCRTKLDCDNLERYLKQVGDREL 534

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|321469806|gb|EFX80785.1| hypothetical protein DAPPUDRAFT_211767 [Daphnia pulex] Back     alignment and taxonomy information
>gi|312378013|gb|EFR24699.1| hypothetical protein AND_10520 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|189239355|ref|XP_974286.2| PREDICTED: similar to DEAD box ATP-dependent RNA helicase [Tribolium castaneum] gi|270009695|gb|EFA06143.1| hypothetical protein TcasGA2_TC008987 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332022361|gb|EGI62673.1| ATP-dependent RNA helicase Ddx1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322778877|gb|EFZ09293.1| hypothetical protein SINV_12578 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307172370|gb|EFN63841.1| ATP-dependent RNA helicase Ddx1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383865900|ref|XP_003708410.1| PREDICTED: ATP-dependent RNA helicase Ddx1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|170060755|ref|XP_001865941.1| ATP-dependent RNA helicase Ddx1 [Culex quinquefasciatus] gi|167879122|gb|EDS42505.1| ATP-dependent RNA helicase Ddx1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170054518|ref|XP_001863165.1| ATP-dependent RNA helicase Ddx1 [Culex quinquefasciatus] gi|167874771|gb|EDS38154.1| ATP-dependent RNA helicase Ddx1 [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query33
FB|FBgn0015075 727 Ddx1 "Dead-box-1" [Drosophila 0.636 0.028 0.857 0.00013
UNIPROTKB|Q24731 400 Ddx1 "ATP-dependent RNA helica 0.666 0.055 0.772 0.00024
UNIPROTKB|I3LGP0 524 I3LGP0 "Uncharacterized protei 0.606 0.038 0.8 0.00036
UNIPROTKB|F1SCS1 689 F1SCS1 "Uncharacterized protei 0.606 0.029 0.8 0.00051
UNIPROTKB|Q0IIK5 740 DDX1 "ATP-dependent RNA helica 0.606 0.027 0.8 0.00055
UNIPROTKB|F6V659 740 DDX1 "Uncharacterized protein" 0.606 0.027 0.8 0.00055
UNIPROTKB|Q92499 740 DDX1 "ATP-dependent RNA helica 0.606 0.027 0.8 0.00055
UNIPROTKB|A2VD92 740 ddx1 "ATP-dependent RNA helica 0.606 0.027 0.8 0.00055
UNIPROTKB|Q4R7L5 740 DDX1 "ATP-dependent RNA helica 0.606 0.027 0.8 0.00055
UNIPROTKB|Q5NVJ8 740 DDX1 "ATP-dependent RNA helica 0.606 0.027 0.8 0.00055
FB|FBgn0015075 Ddx1 "Dead-box-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 102 (41.0 bits), Expect = 0.00013, Sum P(2) = 0.00013
 Identities = 18/21 (85%), Positives = 20/21 (95%)

Query:     1 MDRALIFCRTKLDCDNLERYL 21
             MDRA+IFCRTK DCDNLER+L
Sbjct:   505 MDRAIIFCRTKQDCDNLERFL 525
GO:0008026 "ATP-dependent helicase activity" evidence=ISS
GO:0006446 "regulation of translational initiation" evidence=ISS
GO:0042254 "ribosome biogenesis" evidence=ISS
GO:0001700 "embryonic development via the syncytial blastoderm" evidence=IEP
GO:0000245 "spliceosomal complex assembly" evidence=ISS
GO:0004386 "helicase activity" evidence=ISS
GO:0005575 "cellular_component" evidence=ND
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|Q24731 Ddx1 "ATP-dependent RNA helicase Ddx1" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|I3LGP0 I3LGP0 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SCS1 F1SCS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IIK5 DDX1 "ATP-dependent RNA helicase DDX1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6V659 DDX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q92499 DDX1 "ATP-dependent RNA helicase DDX1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A2VD92 ddx1 "ATP-dependent RNA helicase DDX1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7L5 DDX1 "ATP-dependent RNA helicase DDX1" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q5NVJ8 DDX1 "ATP-dependent RNA helicase DDX1" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0IIK5DDX1_BOVIN3, ., 6, ., 4, ., 1, 30.76190.63630.0283yesN/A
Q92499DDX1_HUMAN3, ., 6, ., 4, ., 1, 30.76190.63630.0283yesN/A
Q5XH91DDX1_XENTR3, ., 6, ., 4, ., 1, 30.76190.63630.0283yesN/A
Q9VNV3DDX1_DROME3, ., 6, ., 4, ., 1, 30.85710.63630.0288yesN/A
Q90WU3DDX1_CHICK3, ., 6, ., 4, ., 1, 30.71420.63630.0283yesN/A
Q641Y8DDX1_RAT3, ., 6, ., 4, ., 1, 30.76190.63630.0283yesN/A
Q5NVJ8DDX1_PONAB3, ., 6, ., 4, ., 1, 30.76190.63630.0283yesN/A
Q91VR5DDX1_MOUSE3, ., 6, ., 4, ., 1, 30.76190.63630.0283yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 33
KOG0349|consensus 725 98.11
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 97.76
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 97.74
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 97.71
KOG0331|consensus 519 97.57
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 97.55
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 97.55
KOG0332|consensus 477 97.52
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.46
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 97.44
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 97.43
KOG0328|consensus 400 97.38
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 97.33
PTZ00110 545 helicase; Provisional 97.32
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 97.32
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 97.3
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.26
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 97.2
PTZ00424 401 helicase 45; Provisional 97.1
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 97.07
KOG0333|consensus 673 97.03
KOG0327|consensus 397 96.99
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 96.92
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 96.91
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 96.88
COG1202 830 Superfamily II helicase, archaea-specific [General 96.71
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 96.56
PRK05298 652 excinuclease ABC subunit B; Provisional 96.5
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 96.5
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 96.41
PRK13767 876 ATP-dependent helicase; Provisional 96.34
PRK09401 1176 reverse gyrase; Reviewed 96.33
PRK02362 737 ski2-like helicase; Provisional 96.29
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 96.22
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 96.22
PRK00254 720 ski2-like helicase; Provisional 96.03
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 96.02
PRK09200 790 preprotein translocase subunit SecA; Reviewed 95.96
PRK01172 674 ski2-like helicase; Provisional 95.86
PRK14701 1638 reverse gyrase; Provisional 95.8
KOG0335|consensus 482 95.74
PRK04914 956 ATP-dependent helicase HepA; Validated 95.72
COG1201 814 Lhr Lhr-like helicases [General function predictio 95.72
PRK13766 773 Hef nuclease; Provisional 95.66
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 95.49
KOG0352|consensus 641 95.32
PRK09694 878 helicase Cas3; Provisional 95.31
PF05939109 Phage_min_tail: Phage minor tail protein; InterPro 95.24
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 95.23
PRK12904 830 preprotein translocase subunit SecA; Reviewed 95.14
PHA02653 675 RNA helicase NPH-II; Provisional 95.1
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 94.89
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 94.85
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 94.84
KOG0337|consensus 529 94.73
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 94.48
KOG0330|consensus 476 94.22
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 93.93
KOG0326|consensus 459 93.92
KOG0351|consensus 941 93.8
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 93.66
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 93.41
COG4718111 Phage-related protein [Function unknown] 93.11
COG1204 766 Superfamily II helicase [General function predicti 93.09
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 92.98
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 92.88
PRK10689 1147 transcription-repair coupling factor; Provisional 92.85
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 92.67
KOG0354|consensus 746 92.65
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 92.58
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 92.54
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 92.1
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 92.0
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 91.97
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 91.59
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 91.24
KOG0340|consensus 442 91.21
COG4096 875 HsdR Type I site-specific restriction-modification 91.2
PRK13107 908 preprotein translocase subunit SecA; Reviewed 91.09
PF10740172 DUF2529: Protein of unknown function (DUF2529); In 91.07
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 90.96
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 90.82
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 90.66
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 90.64
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 90.51
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 90.33
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 90.32
PHA02558 501 uvsW UvsW helicase; Provisional 90.09
PF0261782 ClpS: ATP-dependent Clp protease adaptor protein C 90.0
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 89.95
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 89.53
PF00849164 PseudoU_synth_2: RNA pseudouridylate synthase This 89.33
KOG0347|consensus 731 89.32
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 89.27
cd02557 213 PseudoU_synth_ScRIB2 PseudoU_synth_ScRIB2_like: Ps 88.86
TIGR01621 217 RluA-like pseudouridine synthase Rlu family protei 88.12
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 87.86
PF0854485 GHMP_kinases_C: GHMP kinases C terminal ; InterPro 87.71
cd02869 185 PseudoU_synth_RluCD_like PseudoU_synth_RsuA/RluD: 87.69
PF0286370 Arg_repressor_C: Arginine repressor, C-terminal do 87.46
PRK10158 219 23S rRNA/tRNA pseudouridine synthase A; Provisiona 87.38
PRK11112 257 tRNA pseudouridine synthase C; Provisional 87.2
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 86.84
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 86.6
KOG4284|consensus 980 86.35
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 85.54
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 85.22
cd02563 223 PseudoU_synth_TruC tRNA pseudouridine isomerase C: 85.13
KOG0950|consensus 1008 84.66
cd02558 246 PSRA_1 PSRA_1: Pseudouridine synthase, a subgroup 83.89
KOG0334|consensus 997 83.59
KOG0353|consensus 695 83.02
PRK05752 255 uroporphyrinogen-III synthase; Validated 82.72
PRK09271 160 flavodoxin; Provisional 82.49
PRK11025 317 23S rRNA pseudouridylate synthase C; Provisional 82.39
PRK11180 325 rluD 23S rRNA pseudouridine synthase D; Provisiona 82.28
PRK08811 266 uroporphyrinogen-III synthase; Validated 82.26
KOG0338|consensus 691 82.25
TIGR00005 299 rluA_subfam pseudouridine synthase, RluA family. m 82.13
PLN02160136 thiosulfate sulfurtransferase 81.78
COG0564 289 RluA Pseudouridylate synthases, 23S RNA-specific [ 81.68
TIGR01754 140 flav_RNR ribonucleotide reductase-associated flavo 81.18
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 80.14
KOG0336|consensus 629 80.07
>KOG0349|consensus Back     alignment and domain information 
Probab=98.11  E-value=2e-06  Score=58.20  Aligned_cols=26  Identities=65%  Similarity=1.137  Sum_probs=24.6

Q ss_pred             CceEEEEecchhhHHHHHHHHHhcCC
Q psy8719           1 MDRALIFCRTKLDCDNLERYLNSIDR   26 (33)
Q Consensus         1 ~~~aIVF~nTK~~ad~La~~L~~~G~   26 (33)
                      |++|||||+||.+||+|.++++++|+
T Consensus       505 mdkaiifcrtk~dcDnLer~~~qkgg  530 (725)
T KOG0349|consen  505 MDKAIIFCRTKQDCDNLERMMNQKGG  530 (725)
T ss_pred             cCceEEEEeccccchHHHHHHHHcCC
Confidence            68999999999999999999999887

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PF05939 Phage_min_tail: Phage minor tail protein; InterPro: IPR010265 This entry is represented by Bacteriophage lambda, GpM, the minor tail protein Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG4718 Phage-related protein [Function unknown] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF10740 DUF2529: Protein of unknown function (DUF2529); InterPro: IPR019676 This entry represents a protein family conserved in the Bacillales Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PF02617 ClpS: ATP-dependent Clp protease adaptor protein ClpS; InterPro: IPR003769 In the bacterial cytosol, ATP-dependent protein degradation is performed by several different chaperone-protease pairs, including ClpAP Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF00849 PseudoU_synth_2: RNA pseudouridylate synthase This Prosite family is a subset of the Pfam family Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>cd02557 PseudoU_synth_ScRIB2 PseudoU_synth_ScRIB2_like: Pseudouridine synthase, Saccharomyces cerevisiae RIB2_like Back     alignment and domain information
>TIGR01621 RluA-like pseudouridine synthase Rlu family protein, TIGR01621 Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF08544 GHMP_kinases_C: GHMP kinases C terminal ; InterPro: IPR013750 This domain is found in homoserine kinases (2 Back     alignment and domain information
>cd02869 PseudoU_synth_RluCD_like PseudoU_synth_RsuA/RluD: Pseudouridine synthase, RsuA/RluD family Back     alignment and domain information
>PF02863 Arg_repressor_C: Arginine repressor, C-terminal domain; InterPro: IPR020899 The arginine dihydrolase (AD) pathway is found in many prokaryotes and some primitive eukaryotes, an example of the latter being Giardia lamblia (Giardia intestinalis) [] Back     alignment and domain information
>PRK10158 23S rRNA/tRNA pseudouridine synthase A; Provisional Back     alignment and domain information
>PRK11112 tRNA pseudouridine synthase C; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd02563 PseudoU_synth_TruC tRNA pseudouridine isomerase C: Pseudouridine synthases catalyze the isomerization of specific uridines in an tRNA molecule to pseudouridines (5-ribosyluracil, psi) Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>cd02558 PSRA_1 PSRA_1: Pseudouridine synthase, a subgroup of the RluA family Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK05752 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>PRK09271 flavodoxin; Provisional Back     alignment and domain information
>PRK11025 23S rRNA pseudouridylate synthase C; Provisional Back     alignment and domain information
>PRK11180 rluD 23S rRNA pseudouridine synthase D; Provisional Back     alignment and domain information
>PRK08811 uroporphyrinogen-III synthase; Validated Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>TIGR00005 rluA_subfam pseudouridine synthase, RluA family Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>COG0564 RluA Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01754 flav_RNR ribonucleotide reductase-associated flavodoxin, putative Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query33
2rb4_A 175 ATP-dependent RNA helicase DDX25; rossmann fold, s 97.95
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 97.92
1t5i_A 172 C_terminal domain of A probable ATP-dependent RNA 97.91
1fuk_A 165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 97.88
2jgn_A 185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 97.78
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 97.73
2p6n_A 191 ATP-dependent RNA helicase DDX41; DEAD, structural 97.7
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 97.56
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 97.51
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 97.49
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 97.48
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 97.47
2yjt_D 170 ATP-dependent RNA helicase SRMB, regulator of ribo 96.6
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 97.45
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 97.43
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 97.4
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 97.37
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 97.37
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 97.34
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 97.32
1yks_A 440 Genome polyprotein [contains: flavivirin protease 97.3
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 97.29
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 97.28
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 97.28
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 97.22
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 97.19
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 97.15
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 97.05
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 97.03
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 97.02
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 97.01
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 97.01
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 96.98
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 96.88
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 96.85
4gl2_A 699 Interferon-induced helicase C domain-containing P; 96.83
3h1t_A 590 Type I site-specific restriction-modification syst 96.76
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 96.75
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 96.71
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 96.6
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 96.58
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 96.54
3jux_A 822 Protein translocase subunit SECA; protein transloc 96.52
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 96.32
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 96.28
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 96.09
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 96.02
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 95.95
1z5z_A 271 Helicase of the SNF2/RAD54 family; hydrolase, reco 95.84
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 95.79
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 95.76
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 95.67
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 95.6
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 95.33
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 95.23
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.17
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 95.14
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 94.97
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 94.83
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 94.7
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 94.69
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 94.43
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 94.43
2jtq_A85 Phage shock protein E; solution structure rhodanes 94.01
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 93.83
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 93.81
3foj_A100 Uncharacterized protein; protein SSP1007, structur 93.54
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 93.4
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 93.15
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 92.96
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 92.85
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 92.52
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 92.25
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 92.24
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 92.11
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 92.07
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 91.72
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 91.25
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 91.25
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 91.11
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 91.02
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 90.91
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 90.89
1tq1_A129 AT5G66040, senescence-associated family protein; C 90.71
2i82_A 217 Ribosomal large subunit pseudouridine synthase A; 90.34
3gon_A335 Phosphomevalonate kinase; GHMP kinase superfamily, 90.33
1vee_A134 Proline-rich protein family; hypothetical protein, 90.14
1v9k_A 228 Ribosomal large subunit pseudouridine synthase C; 90.02
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 87.91
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 87.57
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 86.93
3h11_A 272 CAsp8 and FADD-like apoptosis regulator; cell deat 86.46
1v9f_A 325 Ribosomal large subunit pseudouridine synthase D; 86.19
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 85.43
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 85.37
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 85.17
3h11_B 271 Caspase-8; cell death, apoptosis, caspase, alterna 84.21
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 83.29
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 82.99
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 82.89
1b4b_A71 Arginine repressor; core, oligomerization domain, 82.29
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 81.82
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 81.33
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 81.0
3re1_A 269 Uroporphyrinogen-III synthetase; HEMD-like family, 80.82
3e4c_A 302 Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna 80.76
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 80.54
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 80.37
3dmn_A174 Putative DNA helicase; APC89291.2, lactobacillus p 80.31
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
Probab=97.95  E-value=1.4e-05  Score=42.86  Aligned_cols=30  Identities=20%  Similarity=0.348  Sum_probs=26.5

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +++||||+|+..|+.+++.|.+.|....++
T Consensus        35 ~~~lVF~~~~~~~~~l~~~L~~~~~~~~~~   64 (175)
T 2rb4_A           35 GQAIIFCQTRRNAKWLTVEMIQDGHQVSLL   64 (175)
T ss_dssp             SEEEEECSCHHHHHHHHHHHHTTTCCEEEE
T ss_pred             CCEEEEECCHHHHHHHHHHHHHcCCcEEEE
Confidence            589999999999999999999998766554
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>2i82_A Ribosomal large subunit pseudouridine synthase A; lyase/RNA complex; HET: FOU; 2.05A {Escherichia coli} Back     alignment and structure
>3gon_A Phosphomevalonate kinase; GHMP kinase superfamily, ATP-binding, nucleotide- binding, transferase; HET: PMV ANP; 1.90A {Streptococcus pneumoniae} PDB: 1k47_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1v9k_A Ribosomal large subunit pseudouridine synthase C; pseudouridine syntase, RNA binding, lyase; 2.00A {Escherichia coli} SCOP: d.265.1.3 PDB: 1xpi_A Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A Back     alignment and structure
>1v9f_A Ribosomal large subunit pseudouridine synthase D; RNA binding, lyase; 1.70A {Escherichia coli} SCOP: d.265.1.3 PDB: 2ist_A 1qyu_A 1prz_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} SCOP: c.17.1.1 PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1b4b_A Arginine repressor; core, oligomerization domain, helix TUR; HET: ARG; 2.20A {Geobacillus stearothermophilus} SCOP: d.74.2.1 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3re1_A Uroporphyrinogen-III synthetase; HEMD-like family, uroporphyrinogen III synthase, HMB, lyase; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 33
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 2e-04
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 0.001
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: HCV helicase domain
species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]

 Score = 33.4 bits (76), Expect = 2e-04
 Identities = 10/21 (47%), Positives = 12/21 (57%)

Query: 3  RALIFCRTKLDCDNLERYLNS 23
          R LIFC +K  CD L   L +
Sbjct: 38 RHLIFCHSKKKCDELAAKLVA 58
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query33
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 98.52
d1c4oa2 174 Nucleotide excision repair enzyme UvrB {Thermus th 98.24
d1fuka_ 162 Initiation factor 4a {Baker's yeast (Saccharomyces 98.23
d1s2ma2 171 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.23
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 98.2
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 98.14
d1t5ia_ 168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.13
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 97.98
d2rb4a1 168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 97.95
d1t5la2 181 Nucleotide excision repair enzyme UvrB {Bacillus c 97.92
d2j0sa2 168 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.86
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 97.56
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 97.51
d2p6ra4 201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.49
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.22
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 96.25
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 93.81
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 93.33
d1v9ka_ 227 Ribosomal large subunit pseudouridine synthase C, 92.33
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.29
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 91.75
d1t35a_ 179 Hypothetical protein YvdD {Bacillus subtilis [TaxI 91.55
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 90.65
d1z5za1 244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 90.46
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 90.27
d1k47a2135 Phosphomevalonate kinase (PMK) {Streptococcus pneu 90.19
d1tf5a4 175 Translocation ATPase SecA, nucleotide-binding doma 90.17
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 90.16
d1v9fa_ 250 Ribosomal large subunit pseudouridine synthase D, 89.98
d1xxaa_71 C-terminal domain of arginine repressor {Escherich 88.95
d1b4ba_71 C-terminal domain of arginine repressor {Bacillus 87.92
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 87.16
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 87.02
d1m72a_ 256 Caspase-1 {Fall armyworm (Spodoptera frugiperda) [ 85.95
g1qtn.1 242 Caspase-8 {Human (Homo sapiens) [TaxId: 9606]} 85.36
d2p5ma171 C-terminal domain of arginine repressor {Bacillus 85.33
g1pyo.1 257 Caspase-2 {Human (Homo sapiens) [TaxId: 9606]} 83.98
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 83.88
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 83.82
d2q4oa1 183 Hypothetical protein At2g37210/T2N18.3 {Thale cres 82.39
d1ydhb_ 181 Hypothetical protein At5g11950 {Thale cress (Arabi 82.34
d1rcua_ 170 Hypothetical protein TM1055 {Thermotoga maritima [ 81.65
g1nme.1 238 Apopain (caspase-3, cpp32) {Human (Homo sapiens) [ 81.18
d1zcza1 157 IMP cyclohydrolase domain of bifunctional purine b 80.59
d1weha_ 171 Hypothetical protein TT1887 (TTHA0294) {Thermus th 80.53
d1pjra2 333 DEXX box DNA helicase {Bacillus stearothermophilus 80.3
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: HCV helicase domain
species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]

Probab=98.52  E-value=5.3e-08  Score=51.80  Aligned_cols=30  Identities=37%  Similarity=0.709  Sum_probs=26.7

Q ss_pred             ceEEEEecchhhHHHHHHHHHhcCCceeee
Q psy8719           2 DRALIFCRTKLDCDNLERYLNSIDRRLIYY   31 (33)
Q Consensus         2 ~~aIVF~nTK~~ad~La~~L~~~G~~~~~~   31 (33)
                      +++||||||+..|++|++.|++.|..-..|
T Consensus        36 ~k~IVFc~t~~~ae~la~~L~~~G~~~~~~   65 (138)
T d1jr6a_          36 GRHLIFCHSKKKCDELAAKLVALGINAVAY   65 (138)
T ss_dssp             SCEEEECSCHHHHHHHHHHHHHHTCEEEEE
T ss_pred             CCEEEEeCcHHHHHHHHHHHhccccchhhh
Confidence            579999999999999999999999876554
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9ka_ d.265.1.3 (A:) Ribosomal large subunit pseudouridine synthase C, RluC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1t35a_ c.129.1.1 (A:) Hypothetical protein YvdD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1k47a2 d.58.26.4 (A:195-329) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v9fa_ d.265.1.3 (A:) Ribosomal large subunit pseudouridine synthase D, RluD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxaa_ d.74.2.1 (A:) C-terminal domain of arginine repressor {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b4ba_ d.74.2.1 (A:) C-terminal domain of arginine repressor {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m72a_ c.17.1.1 (A:) Caspase-1 {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]} Back     information, alignment and structure
>d2p5ma1 d.74.2.1 (A:79-149) C-terminal domain of arginine repressor {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2q4oa1 c.129.1.1 (A:8-190) Hypothetical protein At2g37210/T2N18.3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ydhb_ c.129.1.1 (B:) Hypothetical protein At5g11950 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rcua_ c.129.1.1 (A:) Hypothetical protein TM1055 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zcza1 c.24.1.3 (A:1-157) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1weha_ c.129.1.1 (A:) Hypothetical protein TT1887 (TTHA0294) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure