Psyllid ID: psy8764
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 420 | ||||||
| 195491033 | 1238 | GE21276 [Drosophila yakuba] gi|194179491 | 0.359 | 0.121 | 0.734 | 2e-70 | |
| 442631143 | 1197 | transient receptor potential A1, isoform | 0.409 | 0.143 | 0.728 | 4e-70 | |
| 194748865 | 1233 | GF10143 [Drosophila ananassae] gi|190624 | 0.397 | 0.135 | 0.75 | 4e-70 | |
| 238054359 | 1296 | RecName: Full=Transient receptor potenti | 0.409 | 0.132 | 0.728 | 5e-70 | |
| 442631139 | 1232 | transient receptor potential A1, isoform | 0.409 | 0.139 | 0.728 | 5e-70 | |
| 358681383 | 1251 | TRPA1(A) isoform [Drosophila melanogaste | 0.409 | 0.137 | 0.728 | 5e-70 | |
| 194865766 | 1254 | GG15054 [Drosophila erecta] gi|190653376 | 0.397 | 0.133 | 0.744 | 1e-69 | |
| 296034212 | 1193 | TRPA1 [Drosophila mojavensis] | 0.409 | 0.144 | 0.728 | 1e-69 | |
| 296034214 | 1200 | TRPA1 [Drosophila virilis] | 0.409 | 0.143 | 0.722 | 2e-69 | |
| 195125906 | 1225 | GI12404 [Drosophila mojavensis] gi|19391 | 0.397 | 0.136 | 0.744 | 3e-69 |
| >gi|195491033|ref|XP_002093390.1| GE21276 [Drosophila yakuba] gi|194179491|gb|EDW93102.1| GE21276 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Score = 272 bits (696), Expect = 2e-70, Method: Compositional matrix adjust.
Identities = 127/173 (73%), Positives = 149/173 (86%)
Query: 1 MSGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLYNCMDLS 60
MSGYT T+ L+SVHSHLLDQVDKDGNTALHLATMENKP AI +L+S+ CKLLYN +D+S
Sbjct: 574 MSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLLYNVLDMS 633
Query: 61 AIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITK 120
AIDYAIYYK+PEAALAMVTH R E+M+LRSDKHPCVTLAL+ASMP+VFE+VQDK ITK
Sbjct: 634 AIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITK 693
Query: 121 ANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALH 173
ANCKKDSKSFYIKY+F+ LQC ++ +I+EKTG++ + PIPLPALN H
Sbjct: 694 ANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTH 746
|
Source: Drosophila yakuba Species: Drosophila yakuba Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|442631143|ref|NP_648263.5| transient receptor potential A1, isoform I [Drosophila melanogaster] gi|32351041|gb|AAP76197.1| ANKTM1 [Drosophila melanogaster] gi|440215511|gb|AAF50356.5| transient receptor potential A1, isoform I [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194748865|ref|XP_001956862.1| GF10143 [Drosophila ananassae] gi|190624144|gb|EDV39668.1| GF10143 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|238054359|sp|Q7Z020.3|TRPA1_DROME RecName: Full=Transient receptor potential cation channel subfamily A member 1; Short=dTRPA1; AltName: Full=Ankyrin-like with transmembrane domains protein 1; Short=dANKTM1 | Back alignment and taxonomy information |
|---|
| >gi|442631139|ref|NP_001261600.1| transient receptor potential A1, isoform G [Drosophila melanogaster] gi|356892152|gb|AET41695.1| TRPA1 isoform D [Drosophila melanogaster] gi|440215509|gb|AGB94295.1| transient receptor potential A1, isoform G [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|358681383|gb|AEU17952.1| TRPA1(A) isoform [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194865766|ref|XP_001971593.1| GG15054 [Drosophila erecta] gi|190653376|gb|EDV50619.1| GG15054 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|296034212|gb|ADG84993.1| TRPA1 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|296034214|gb|ADG84994.1| TRPA1 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195125906|ref|XP_002007415.1| GI12404 [Drosophila mojavensis] gi|193919024|gb|EDW17891.1| GI12404 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 420 | ||||||
| FB|FBgn0035934 | 1296 | TrpA1 "Transient receptor pote | 0.411 | 0.133 | 0.687 | 6.1e-92 | |
| ZFIN|ZDB-GENE-050106-1 | 1120 | trpa1b "transient receptor pot | 0.383 | 0.143 | 0.313 | 3e-21 | |
| UNIPROTKB|G5E522 | 1126 | TRPA1 "Uncharacterized protein | 0.564 | 0.210 | 0.261 | 6.6e-21 | |
| UNIPROTKB|F1RWI1 | 1121 | TRPA1 "Uncharacterized protein | 0.559 | 0.209 | 0.258 | 5.1e-20 | |
| UNIPROTKB|O75762 | 1119 | TRPA1 "Transient receptor pote | 0.557 | 0.209 | 0.262 | 1e-19 | |
| ZFIN|ZDB-GENE-050105-6 | 1126 | trpa1a "transient receptor pot | 0.378 | 0.141 | 0.305 | 2.9e-17 | |
| UNIPROTKB|E1C7Y7 | 1074 | TRPA1 "Uncharacterized protein | 0.447 | 0.175 | 0.287 | 1.1e-16 | |
| UNIPROTKB|E1BZK9 | 1075 | TRPA1 "Uncharacterized protein | 0.447 | 0.174 | 0.287 | 1.1e-16 | |
| MGI|MGI:3522699 | 1125 | Trpa1 "transient receptor pote | 0.333 | 0.124 | 0.270 | 1.2e-15 | |
| UNIPROTKB|F1Q2M0 | 1117 | TRPA1 "Uncharacterized protein | 0.616 | 0.231 | 0.258 | 4.2e-15 |
| FB|FBgn0035934 TrpA1 "Transient receptor potential A1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 621 (223.7 bits), Expect = 6.1e-92, Sum P(2) = 6.1e-92
Identities = 119/173 (68%), Positives = 138/173 (79%)
Query: 1 MSGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAIXXXXXXXXXXXXXXMDLS 60
MSGYT T+ L+SVHSHLLDQVDKDGNTALHLATMENKP AI +D+S
Sbjct: 653 MSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMS 712
Query: 61 AIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITK 120
AIDYAIYYK+PEAALAMVTH R E+M+LRSDKHPCVTLAL+ASMP+VFE+VQDK ITK
Sbjct: 713 AIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITK 772
Query: 121 ANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALH 173
ANCKKDSKSFYIKY+F+ LQC ++ +I+EKTG++ + PIPLPALN H
Sbjct: 773 ANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTH 825
|
|
| ZFIN|ZDB-GENE-050106-1 trpa1b "transient receptor potential cation channel, subfamily A, member 1b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E522 TRPA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RWI1 TRPA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O75762 TRPA1 "Transient receptor potential cation channel subfamily A member 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050105-6 trpa1a "transient receptor potential cation channel, subfamily A, member 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C7Y7 TRPA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BZK9 TRPA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:3522699 Trpa1 "transient receptor potential cation channel, subfamily A, member 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q2M0 TRPA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 420 | |||
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 1e-04 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 0.003 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 0.003 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
Score = 41.2 bits (97), Expect = 1e-04
Identities = 15/57 (26%), Positives = 22/57 (38%), Gaps = 1/57 (1%)
Query: 19 LDQVDKDGNTALHLATMENKPKAICLLLSLNCKL-LYNCMDLSAIDYAIYYKFPEAA 74
++ DKDGNT LHLA + LLL + + + + A E
Sbjct: 66 VNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVV 122
|
The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 420 | |||
| KOG0510|consensus | 929 | 100.0 | ||
| KOG0510|consensus | 929 | 99.86 | ||
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.69 | |
| KOG4412|consensus | 226 | 99.58 | ||
| KOG4412|consensus | 226 | 99.55 | ||
| KOG3676|consensus | 782 | 99.52 | ||
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.49 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.46 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.44 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.43 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.41 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.41 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.4 | |
| KOG0512|consensus | 228 | 99.39 | ||
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.38 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.38 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.38 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.36 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.35 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.33 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.33 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.32 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.31 | |
| KOG0509|consensus | 600 | 99.31 | ||
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.31 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.31 | |
| KOG0508|consensus | 615 | 99.28 | ||
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.27 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.27 | |
| KOG0514|consensus | 452 | 99.26 | ||
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.25 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.25 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.24 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.24 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.24 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.24 | |
| KOG0509|consensus | 600 | 99.22 | ||
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.22 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.22 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.2 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.2 | |
| KOG0195|consensus | 448 | 99.2 | ||
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.19 | |
| KOG0508|consensus | 615 | 99.18 | ||
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.17 | |
| KOG0514|consensus | 452 | 99.16 | ||
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.15 | |
| KOG4214|consensus | 117 | 99.14 | ||
| KOG4177|consensus | 1143 | 99.14 | ||
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.14 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.12 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.11 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.1 | |
| KOG0512|consensus | 228 | 99.08 | ||
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.08 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.07 | |
| KOG0502|consensus | 296 | 99.06 | ||
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.05 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.01 | |
| KOG0195|consensus | 448 | 99.0 | ||
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.0 | |
| KOG4177|consensus | 1143 | 98.99 | ||
| KOG0502|consensus | 296 | 98.99 | ||
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 98.98 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 98.97 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 98.97 | |
| KOG0515|consensus | 752 | 98.96 | ||
| PHA02792 | 631 | ankyrin-like protein; Provisional | 98.96 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 98.96 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 98.95 | |
| KOG0522|consensus | 560 | 98.91 | ||
| KOG0507|consensus | 854 | 98.87 | ||
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 98.86 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 98.85 | |
| KOG1710|consensus | 396 | 98.82 | ||
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 98.81 | |
| KOG0507|consensus | 854 | 98.73 | ||
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 98.73 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 98.7 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.68 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.67 | |
| KOG0505|consensus | 527 | 98.59 | ||
| KOG4214|consensus | 117 | 98.53 | ||
| KOG1710|consensus | 396 | 98.49 | ||
| KOG0818|consensus | 669 | 98.44 | ||
| KOG0515|consensus | 752 | 98.42 | ||
| KOG0505|consensus | 527 | 98.41 | ||
| KOG0705|consensus | 749 | 98.39 | ||
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.36 | |
| KOG0783|consensus | 1267 | 98.34 | ||
| KOG0506|consensus | 622 | 98.31 | ||
| KOG2384|consensus | 223 | 98.28 | ||
| KOG3676|consensus | 782 | 98.26 | ||
| KOG3609|consensus | 822 | 98.25 | ||
| KOG4369|consensus | 2131 | 98.19 | ||
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 98.03 | |
| KOG4369|consensus | 2131 | 98.0 | ||
| KOG0782|consensus | 1004 | 97.9 | ||
| PF13606 | 30 | Ank_3: Ankyrin repeat | 97.84 | |
| KOG0783|consensus | 1267 | 97.56 | ||
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 97.54 | |
| PLN03223 | 1634 | Polycystin cation channel protein; Provisional | 97.21 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 97.13 | |
| KOG0521|consensus | 785 | 97.13 | ||
| PF08016 | 425 | PKD_channel: Polycystin cation channel; InterPro: | 97.13 | |
| KOG0511|consensus | 516 | 97.12 | ||
| KOG0782|consensus | 1004 | 97.1 | ||
| KOG0818|consensus | 669 | 96.98 | ||
| KOG0520|consensus | 975 | 96.86 | ||
| KOG0506|consensus | 622 | 96.86 | ||
| KOG0521|consensus | 785 | 96.71 | ||
| KOG0511|consensus | 516 | 96.7 | ||
| KOG2505|consensus | 591 | 96.3 | ||
| KOG0520|consensus | 975 | 96.02 | ||
| KOG3599|consensus | 798 | 95.22 | ||
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 95.0 | |
| KOG0522|consensus | 560 | 94.54 | ||
| KOG2384|consensus | 223 | 93.35 | ||
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 93.12 | |
| KOG0705|consensus | 749 | 92.83 | ||
| KOG3609|consensus | 822 | 91.89 |
| >KOG0510|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.7e-52 Score=434.65 Aligned_cols=294 Identities=25% Similarity=0.344 Sum_probs=240.0
Q ss_pred CCCHHHHHHHHh-cCCCCCCCcCCCCChHHHHHHHcCCHHHHHHHHHCCCcccc----cCCCCcHHHHHHHcCCHHHHHH
Q psy8764 2 SGYTNTMVHLNS-VHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLY----NCMDLSAIDYAIYYKFPEAALA 76 (420)
Q Consensus 2 ~G~~e~ve~LL~-~~~~~in~~D~~G~TpLHlAa~~g~~~vV~lLL~~Ga~i~~----n~~g~TpLh~A~~~g~~evv~~ 76 (420)
.|..++|+.||+ .+..++|+.|..|+||||+|+++||.++|++||++||.... |.+|.||||.|+.+|+..+|+.
T Consensus 316 yg~~ntv~rLL~~~~~rllne~D~~g~tpLHlaa~~gH~~v~qlLl~~GA~~~~~~e~D~dg~TaLH~Aa~~g~~~av~~ 395 (929)
T KOG0510|consen 316 YGRINTVERLLQESDTRLLNESDLHGMTPLHLAAKSGHDRVVQLLLNKGALFLNMSEADSDGNTALHLAAKYGNTSAVQK 395 (929)
T ss_pred cccHHHHHHHHhCcCccccccccccCCCchhhhhhcCHHHHHHHHHhcChhhhcccccccCCchhhhHHHHhccHHHHHH
Confidence 588999999999 67778999999999999999999999999999999998843 8999999999999999999999
Q ss_pred HHhCCCCccc----------------h--hcccCCCCcchHHHHHhhCHHHHHHHhhccccccccCCCCcceeeeechhh
Q psy8764 77 MVTHNTRGTE----------------I--MSLRSDKHPCVTLALVASMPRVFESVQDKSITKANCKKDSKSFYIKYNFSC 138 (420)
Q Consensus 77 Ll~~~~~~~~----------------~--~~~~~~~~~~~~~~li~~~p~~~~~lLD~ci~~~~~~~~~~~~~i~y~f~~ 138 (420)
|+.||..-.. + .....+.+.||..++++++|++++.++|.|+.++.+++++
T Consensus 396 Li~~Ga~I~~~n~~g~SA~~~~~~~~~p~~~~~~~~n~c~~~~~i~~~pe~~e~vlD~c~l~~~e~~~~----------- 464 (929)
T KOG0510|consen 396 LISHGADIGVKNKKGKSAFDTRPDRCLPVFVHRSPFNKCPTTELIEPLPECFEIVLDFCILKSQERKDS----------- 464 (929)
T ss_pred HHHcCCceeeccccccccccccccccccHHHhhCCCCCcchhhhhccchHHHHHHHHHHHHHHhhccCC-----------
Confidence 9999765421 1 1112223789999999999999999999999999888765
Q ss_pred ccccccccccccccCCCCCCCCCCcchhhHHHHHH-------------HHHhhhhhhHHHHHHHHHHHhhhcccceeeee
Q psy8764 139 LQCLRIYPEINEKTGDATAISKPIPLPALNNTALH-------------LATISHHFYRPTFLDRNLALFFHNCVFVGSNP 205 (420)
Q Consensus 139 Lq~p~~~~~~~~~~~~~~~~~~~~pl~~Ln~mv~h-------------LL~~KW~~yg~~~~~~nl~~y~~~~~~lfl~~ 205 (420)
|. +.+...+. .+|.||++ +|.|||++||+++|+.||++|+ +|++|
T Consensus 465 ---~~-----------~~Q~~~~~---~~~~mv~~~~~eLL~HPL~ssfL~mKW~~~g~~~~~~nL~~Y~-----lFlv~ 522 (929)
T KOG0510|consen 465 ---PT-----------PLQDEAAP---ILNIMVDKEQIELLEHPLSSSFLFMKWNRYGKYFHLNNLLIYS-----LFLVS 522 (929)
T ss_pred ---CC-----------hhhhhhhh---HHHHHhhhhHHHHhcChhHHHHHHHHHHHhhHHHHHHHHHHHH-----HHHHH
Confidence 21 11111121 67778776 4559999999999999999999 99999
Q ss_pred cchhhhhhhhhhhhhhcchhhHHhhccccceeecCCCCCcccchhhhhhhhhccCccchhhhhhhhccCCCcchhhhHHH
Q psy8764 206 TPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKLGFLDLVIRKWFCNPFTEDAIDMVLESNGNDVFTDEIDK 285 (420)
Q Consensus 206 lT~~~~qv~l~t~le~~lp~~~~~~vd~~~~~~ypn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~ 285 (420)
+|.++ +|+ |-|..| ++.|
T Consensus 523 lT~Yv----~~~----~~~~~~-----------------n~~~------------------------------------- 540 (929)
T KOG0510|consen 523 LTIYV----LLI----KAGMAF-----------------NSSG------------------------------------- 540 (929)
T ss_pred HHHHH----HHh----cccccc-----------------cccc-------------------------------------
Confidence 99976 111 111111 0000
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhcccccCccCCCCCCCCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHhccccccC
Q psy8764 286 LKRKLNEIQIHLDHQFMFLRLIVHKMDIKTETDERDEGTSSNKELHPLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLF 365 (420)
Q Consensus 286 ~k~rlk~~~~~~~~q~~l~kli~~~~ei~sea~d~d~~~~~~~~~~~~~~~~~~~i~~~~~~~i~~E~~Ql~~~~~~Yf~ 365 (420)
-||.++++| .++..+..++..+.+|+++|+++++++++||++|+|||+++||.
T Consensus 541 -------------------------~~~~~~~s~--~se~lr~~~t~~i~~~~ili~~~i~~~~~~E~iQifqqk~~Y~~ 593 (929)
T KOG0510|consen 541 -------------------------TEIISKTSD--HSEILRNNNTMLIAFCMILIFTSIILGILRECIQIFQQKRHYFM 593 (929)
T ss_pred -------------------------ceeehhccc--hhhhhhccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 134445444 33334445688899999999999999999999999999999999
Q ss_pred CchhHHHHHHHHHHHHhhccccccccccccchhHHHHHHHHHHHHHHHHhhhcc
Q psy8764 366 DPTNIVALLLFFSATIMIVPLFTKGRYMTDYQISFTSLTVFLSWLTLLLNLQSL 419 (420)
Q Consensus 366 d~~N~~ew~ly~~si~~v~~~~~~~~~~~~~qw~~ga~aifl~W~~lll~l~rf 419 (420)
|++|++||++|++++++|.|.+. ..+.+|||++||+||||+||||+|++|||
T Consensus 594 ~i~Nimew~iyts~li~v~~~~~--~~~~~~Q~~laa~aV~l~W~nllLmi~~~ 645 (929)
T KOG0510|consen 594 DIENIMEWFIYTSALITVYPLFF--EITAHLQWVLAAFAVLLGWMNLLLMIGRF 645 (929)
T ss_pred hhHHHHHHHHHhhhhheeehhhh--hhHHHHHHHHHHHHHHHHHHHHHHHHccC
Confidence 99999999999999999999985 25679999999999999999999999998
|
|
| >KOG0510|consensus | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG4412|consensus | Back alignment and domain information |
|---|
| >KOG4412|consensus | Back alignment and domain information |
|---|
| >KOG3676|consensus | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512|consensus | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509|consensus | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508|consensus | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514|consensus | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509|consensus | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0195|consensus | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508|consensus | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514|consensus | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4214|consensus | Back alignment and domain information |
|---|
| >KOG4177|consensus | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0512|consensus | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502|consensus | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195|consensus | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177|consensus | Back alignment and domain information |
|---|
| >KOG0502|consensus | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG0522|consensus | Back alignment and domain information |
|---|
| >KOG0507|consensus | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG1710|consensus | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG0507|consensus | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0505|consensus | Back alignment and domain information |
|---|
| >KOG4214|consensus | Back alignment and domain information |
|---|
| >KOG1710|consensus | Back alignment and domain information |
|---|
| >KOG0818|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG0505|consensus | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG0506|consensus | Back alignment and domain information |
|---|
| >KOG2384|consensus | Back alignment and domain information |
|---|
| >KOG3676|consensus | Back alignment and domain information |
|---|
| >KOG3609|consensus | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >KOG0782|consensus | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >PLN03223 Polycystin cation channel protein; Provisional | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >KOG0782|consensus | Back alignment and domain information |
|---|
| >KOG0818|consensus | Back alignment and domain information |
|---|
| >KOG0520|consensus | Back alignment and domain information |
|---|
| >KOG0506|consensus | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >KOG2505|consensus | Back alignment and domain information |
|---|
| >KOG0520|consensus | Back alignment and domain information |
|---|
| >KOG3599|consensus | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG0522|consensus | Back alignment and domain information |
|---|
| >KOG2384|consensus | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >KOG3609|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 420 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 4e-05 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 3e-04 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 6e-04 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 8e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 49.1 bits (116), Expect = 2e-06
Identities = 66/448 (14%), Positives = 138/448 (30%), Gaps = 136/448 (30%)
Query: 3 GYTNT----MVHLNSVHSHL----LDQVDKDGNTALHLAT--------MENKPKAICLL- 45
N+ + L + + + D N L + + +++KP CLL
Sbjct: 190 KNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLV 249
Query: 46 ------------LSLNCKLLYNCMDLSAIDYAIYYKFPEAALAMVTHNTRGTEIMSL--- 90
+L+CK+L D+ +L + E+ SL
Sbjct: 250 LLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLK 309
Query: 91 ----RSDKHP---CVTLALVASMPRVFESVQDKSIT-----KANCKKDSKSFYIKYNFSC 138
R P T S+ + ES++D T NC K + I+ S
Sbjct: 310 YLDCRPQDLPREVLTTNPRRLSI--IAESIRDGLATWDNWKHVNCDKLTTI--IE---SS 362
Query: 139 LQCLRIYPEINEKTGDATAI---SKPIPLPAL-----NNTALHLATISHHFYRPTFLDRN 190
L L P K D ++ S IP L + + + + ++ + +++
Sbjct: 363 LNVL--EPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQ 420
Query: 191 ---LALFFHNCVFVGSNPTPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKL 247
+ + ++L++ + E E L + +++ Y P
Sbjct: 421 PKESTISIPS-----------IYLELKVKLENEYALHRSIVDH------YNIP------- 456
Query: 248 GFLDLVIRKWFCNPFTEDAIDMV--------LESNGNDVFTDEIDKLKRKLNEIQIHLDH 299
+ + + +D L++ + + + + + LD
Sbjct: 457 -------KTFDSDDLIPPYLDQYFYSHIGHHLKNIEH---PERMTLFRM------VFLD- 499
Query: 300 QFMFLRLIVHKMDIKTETDERDEGTSSNKELHPLL----YICGTA------ISTYMLFSV 349
F FL K I+ ++ + S L L YIC ++ + F
Sbjct: 500 -FRFLE---QK--IRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLP 553
Query: 350 AVQSVQIYQQKWHYLFDPTNIVALLLFF 377
++ + K+ T+++ + L
Sbjct: 554 KIEE-NLICSKY------TDLLRIALMA 574
|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 420 | |||
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.68 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.67 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.67 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.63 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.63 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.6 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.59 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.59 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.59 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.59 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.58 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.58 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.58 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.57 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.57 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.56 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.56 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.56 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.55 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.55 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.55 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.54 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.54 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.54 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.54 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.54 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.53 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.53 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.53 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.52 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.52 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.52 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.52 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.52 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.52 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.51 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.51 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.51 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.51 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.51 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.51 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.5 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.5 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.5 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.5 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.49 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.49 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.49 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.49 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.48 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.48 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.48 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.48 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.47 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.47 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.47 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.47 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.47 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.47 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.47 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.47 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.47 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.47 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.46 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.46 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.46 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.46 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.45 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.45 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.45 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.45 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.44 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.44 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.43 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.43 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.43 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.43 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.43 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.43 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.43 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.42 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.42 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.42 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.42 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.42 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.42 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.41 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.41 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.41 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.41 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.4 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.4 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.4 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.4 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.39 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.39 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.36 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.36 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.36 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.35 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.34 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.34 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.32 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.32 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.31 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.31 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.31 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.29 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.28 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.28 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.27 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.26 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.1 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.08 |
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
Probab=99.68 E-value=2e-16 Score=126.50 Aligned_cols=80 Identities=19% Similarity=0.208 Sum_probs=75.8
Q ss_pred CCCHHHHHHHHhcCCCCCCCcCCCCChHHHHHHHcCCHHHHHHHHHCCCcc-cccCCCCcHHHHHHHcCCHHHHHHHHhC
Q psy8764 2 SGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKL-LYNCMDLSAIDYAIYYKFPEAALAMVTH 80 (420)
Q Consensus 2 ~G~~e~ve~LL~~~~~~in~~D~~G~TpLHlAa~~g~~~vV~lLL~~Ga~i-~~n~~g~TpLh~A~~~g~~evv~~Ll~~ 80 (420)
+|+.++++.|++.++ ++|.+|.+|+||||+|+..|+.+++++|+++|+++ ..|..|.||||+|+..|+.++++.|+.+
T Consensus 12 ~~~~~~v~~Ll~~g~-~~n~~d~~g~t~L~~A~~~~~~~~v~~Ll~~ga~~~~~d~~g~t~l~~A~~~~~~~~~~~Ll~~ 90 (93)
T 1n0q_A 12 NGHLEVVKLLLEAGA-DVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEA 90 (93)
T ss_dssp HTCHHHHHHHHHTTC-CTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHT
T ss_pred cCCHHHHHHHHHcCC-CCcccCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCccCCCCCCHHHHHHHcCCHHHHHHHHHc
Confidence 588999999999776 79999999999999999999999999999999999 8999999999999999999999999988
Q ss_pred CC
Q psy8764 81 NT 82 (420)
Q Consensus 81 ~~ 82 (420)
++
T Consensus 91 ga 92 (93)
T 1n0q_A 91 GA 92 (93)
T ss_dssp TC
T ss_pred CC
Confidence 74
|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 420 | ||||
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-05 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 5e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 0.001 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.001 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 0.003 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 0.004 |
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Swi6 ankyrin-repeat fragment species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 43.9 bits (102), Expect = 2e-05
Identities = 12/60 (20%), Positives = 26/60 (43%), Gaps = 1/60 (1%)
Query: 8 MVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKL-LYNCMDLSAIDYAI 66
+ L + +++L+ D +G+T L++A + LL + N L +D+
Sbjct: 241 NLDLKWIIANMLNAQDSNGDTCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGA 300
|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 420 | |||
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.68 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.62 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.61 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.53 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.53 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.51 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.49 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.49 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.48 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.47 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.44 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.43 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.42 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.41 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.4 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.39 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.36 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.36 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.34 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.34 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.31 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.29 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.29 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.27 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.27 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.26 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.25 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.23 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.23 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.16 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.15 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.09 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.07 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.02 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 98.91 |
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: 53BP2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68 E-value=1.4e-17 Score=141.14 Aligned_cols=84 Identities=12% Similarity=0.082 Sum_probs=78.7
Q ss_pred CCCHHHHHHHHhcCCCCCCCcCCCCChHHHHHHHcCCHHHHHHHHHCCCcc-cccCCCCcHHHHHHHcCCHHHHHHHHhC
Q psy8764 2 SGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKL-LYNCMDLSAIDYAIYYKFPEAALAMVTH 80 (420)
Q Consensus 2 ~G~~e~ve~LL~~~~~~in~~D~~G~TpLHlAa~~g~~~vV~lLL~~Ga~i-~~n~~g~TpLh~A~~~g~~evv~~Ll~~ 80 (420)
+|+.++++.|++.++ ++|.+|++|+||||+|+..|+.+++++|+++|+++ ..|.+|+||||+|+.+|+.++++.|+++
T Consensus 11 ~G~~~~v~~Ll~~g~-d~n~~d~~g~t~Lh~A~~~~~~~~~~~ll~~g~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~ 89 (130)
T d1ycsb1 11 EGEFDLVQRIIYEVD-DPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVES 89 (130)
T ss_dssp HTCHHHHHHHTSTTS-SCCCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHHT
T ss_pred cCCHHHHHHHHHcCC-CccccccccccccccccccccccccccccccccccccccccCcccccccchhhHHHHHHHHHHc
Confidence 599999999999776 79999999999999999999999999999999999 8999999999999999999999999999
Q ss_pred CCCccc
Q psy8764 81 NTRGTE 86 (420)
Q Consensus 81 ~~~~~~ 86 (420)
+.....
T Consensus 90 ga~v~~ 95 (130)
T d1ycsb1 90 GAAVFA 95 (130)
T ss_dssp TCCTTC
T ss_pred CCCccc
Confidence 865443
|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|