Psyllid ID: psy8764


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MSGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLYNCMDLSAIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITKANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALHLATISHHFYRPTFLDRNLALFFHNCVFVGSNPTPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKLGFLDLVIRKWFCNPFTEDAIDMVLESNGNDVFTDEIDKLKRKLNEIQIHLDHQFMFLRLIVHKMDIKTETDERDEGTSSNKELHPLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLFDPTNIVALLLFFSATIMIVPLFTKGRYMTDYQISFTSLTVFLSWLTLLLNLQSLL
cccHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHccccccHHHccccccccHHHHHHHHHcHHHHHHHHHccccccccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEHHHHcccHHHHHHHccccEEEEcccccccccHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHccHHHccccccccccHHHHHHHcccHHHHHHHHHccccEEEccccccHHHHHHHcccHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHcHHHHHHHHHHcccccccccccccEEEEEEEEEEEcccHHHHHcccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccHEEEEEEEcHHHHHHccHHHHHccccccEEEccccccccccHHHHHHHHHccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHc
msgytntmVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKllyncmdlsaIDYAIYYKFPEAALAMVTHntrgteimslrsdkhpcvTLALVASMPrvfesvqdksitkanckkdskSFYIKYNFSCLqclriypeinektgdataiskpiplpalnntaLHLATIShhfyrptfldrnlalffhncvfvgsnptpTLFLQVLLHTELERNLPKFLLEKVDKmeiyeypneckgklgfLDLVIRKWfcnpftedAIDMVLEsngndvftDEIDKLKRKLNEIQIHLDHQFMFLRLIVHKMdiktetderdegtssnkelhpLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLFDPTNIVALLLFFSATIMIvplftkgrymtdyQISFTSLTVFLSWLTLLLNLQSLL
MSGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLYNCMDLSAIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFesvqdksitkanckkdsksfYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALHLATISHHFYRPTFLDRNLALFFHNCVFVGSNPTPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKLGFLDLVIRKWFCNPFTEDAIDMVLESNGNDVFTDEIDKLKRKLNEIQIHLDHQFMFLRLIVHKMDIKTETderdegtssnkelhpLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLFDPTNIVALLLFFSATIMIVPLFTKGRYMTDYQISFTSLTVFLSWLTLLLNLQSLL
MSGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAIclllslnckllyncMDLSAIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITKANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALHLATISHHFYRPTFLDRNLALFFHNCVFVGSNPTPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKLGFLDLVIRKWFCNPFTEDAIDMVLESNGNDVFTDEIDKLKRKLNEIQIHLDHQFMFLRLIVHKMDIKTETDERDEGTSSNKELHPLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLFDPTNIVALLLFFSATIMIVPLFTKGRYMTDYQISFtsltvflswltlllnlqsll
********VHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLYNCMDLSAIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITKANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALHLATISHHFYRPTFLDRNLALFFHNCVFVGSNPTPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKLGFLDLVIRKWFCNPFTEDAIDMVLESNGNDVFTDEIDKLKRKLNEIQIHLDHQFMFLRLIVHKMDI****************LHPLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLFDPTNIVALLLFFSATIMIVPLFTKGRYMTDYQISFTSLTVFLSWLTLLLNL****
*SGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLYNCMDLSAIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITKANCKKDSKSFYIKYNFSCLQCLRIYPEI*E**GD*TAISKPIPLPALNNTALHLATISHHFYRPTFLDRNLALFFHNCVFVGSNPTPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKLGFLDLVIRKWFCNPFTEDAIDMVLESNGNDVFTDEIDKLKRKLNEIQIHLDHQFMFLRLIVHKMDIKTETDERDEGTSSNKELHPLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLFDPTNIVALLLFFSATIMIVPLFTKGRYMTDYQISFTSLTVFLSWLTLLLNLQSLL
MSGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLYNCMDLSAIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITKANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALHLATISHHFYRPTFLDRNLALFFHNCVFVGSNPTPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKLGFLDLVIRKWFCNPFTEDAIDMVLESNGNDVFTDEIDKLKRKLNEIQIHLDHQFMFLRLIVHKMDIKT***********NKELHPLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLFDPTNIVALLLFFSATIMIVPLFTKGRYMTDYQISFTSLTVFLSWLTLLLNLQSLL
*SGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLYNCMDLSAIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITKANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALHLATISHHFYRPTFLDRNLALFFHNCVFVGSNPTPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKLGFLDLVIRKWFCNPFTEDAIDMVLESNGNDVFTDEIDKLKRKLNEIQIHLDHQFMFLRLIVHKMDIKTETD***EGTSSNKELHPLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLFDPTNIVALLLFFSATIMIVPLFTKGRYMTDYQISFTSLTVFLSWLTLLLNLQSLL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLYNCMDLSAIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITKANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALHLATISHHFYRPTFLDRNLALFFHNCVFVGSNPTPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKLGFLDLVIRKWFCNPFTEDAIDMVLESNGxxxxxxxxxxxxxxxxxxxxxLDHQFMFLRLIVHKMDIKTETDERDEGTSSNKELHPLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLFDPTNIVALLLFFSATIMIVPLFTKGRYMTDYQISFTSLTVFLSWLTLLLNLQSLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query420 2.2.26 [Sep-21-2011]
Q7Z020 1296 Transient receptor potent yes N/A 0.409 0.132 0.728 7e-72
O75762 1119 Transient receptor potent yes N/A 0.383 0.143 0.325 2e-13
Q8BLA8 1125 Transient receptor potent yes N/A 0.333 0.124 0.312 3e-12
Q6RI86 1125 Transient receptor potent yes N/A 0.333 0.124 0.305 1e-11
>sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=3 Back     alignment and function desciption
 Score =  271 bits (693), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 126/173 (72%), Positives = 149/173 (86%)

Query: 1   MSGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLYNCMDLS 60
           MSGYT T+  L+SVHSHLLDQVDKDGNTALHLATMENKP AI +L+S+ CKL+YN +D+S
Sbjct: 653 MSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMS 712

Query: 61  AIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITK 120
           AIDYAIYYK+PEAALAMVTH  R  E+M+LRSDKHPCVTLAL+ASMP+VFE+VQDK ITK
Sbjct: 713 AIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITK 772

Query: 121 ANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALH 173
           ANCKKDSKSFYIKY+F+ LQC  ++ +I+EKTG++   + PIPLPALN    H
Sbjct: 773 ANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTH 825




Essential for thermotaxis by sensing environmental temperature. Receptor-activated non-selective cation channel involved in detection of sensations such as temperature. Involved in heat nociception by being activated by warm temperature of about 24-29 degrees Celsius.
Drosophila melanogaster (taxid: 7227)
>sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=2 SV=3 Back     alignment and function description
>sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 Back     alignment and function description
>sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
195491033 1238 GE21276 [Drosophila yakuba] gi|194179491 0.359 0.121 0.734 2e-70
442631143 1197 transient receptor potential A1, isoform 0.409 0.143 0.728 4e-70
194748865 1233 GF10143 [Drosophila ananassae] gi|190624 0.397 0.135 0.75 4e-70
238054359 1296 RecName: Full=Transient receptor potenti 0.409 0.132 0.728 5e-70
442631139 1232 transient receptor potential A1, isoform 0.409 0.139 0.728 5e-70
358681383 1251 TRPA1(A) isoform [Drosophila melanogaste 0.409 0.137 0.728 5e-70
194865766 1254 GG15054 [Drosophila erecta] gi|190653376 0.397 0.133 0.744 1e-69
296034212 1193 TRPA1 [Drosophila mojavensis] 0.409 0.144 0.728 1e-69
296034214 1200 TRPA1 [Drosophila virilis] 0.409 0.143 0.722 2e-69
195125906 1225 GI12404 [Drosophila mojavensis] gi|19391 0.397 0.136 0.744 3e-69
>gi|195491033|ref|XP_002093390.1| GE21276 [Drosophila yakuba] gi|194179491|gb|EDW93102.1| GE21276 [Drosophila yakuba] Back     alignment and taxonomy information
 Score =  272 bits (696), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 149/173 (86%)

Query: 1   MSGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLYNCMDLS 60
           MSGYT T+  L+SVHSHLLDQVDKDGNTALHLATMENKP AI +L+S+ CKLLYN +D+S
Sbjct: 574 MSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLLYNVLDMS 633

Query: 61  AIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITK 120
           AIDYAIYYK+PEAALAMVTH  R  E+M+LRSDKHPCVTLAL+ASMP+VFE+VQDK ITK
Sbjct: 634 AIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITK 693

Query: 121 ANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALH 173
           ANCKKDSKSFYIKY+F+ LQC  ++ +I+EKTG++   + PIPLPALN    H
Sbjct: 694 ANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTH 746




Source: Drosophila yakuba

Species: Drosophila yakuba

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|442631143|ref|NP_648263.5| transient receptor potential A1, isoform I [Drosophila melanogaster] gi|32351041|gb|AAP76197.1| ANKTM1 [Drosophila melanogaster] gi|440215511|gb|AAF50356.5| transient receptor potential A1, isoform I [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194748865|ref|XP_001956862.1| GF10143 [Drosophila ananassae] gi|190624144|gb|EDV39668.1| GF10143 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|238054359|sp|Q7Z020.3|TRPA1_DROME RecName: Full=Transient receptor potential cation channel subfamily A member 1; Short=dTRPA1; AltName: Full=Ankyrin-like with transmembrane domains protein 1; Short=dANKTM1 Back     alignment and taxonomy information
>gi|442631139|ref|NP_001261600.1| transient receptor potential A1, isoform G [Drosophila melanogaster] gi|356892152|gb|AET41695.1| TRPA1 isoform D [Drosophila melanogaster] gi|440215509|gb|AGB94295.1| transient receptor potential A1, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|358681383|gb|AEU17952.1| TRPA1(A) isoform [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194865766|ref|XP_001971593.1| GG15054 [Drosophila erecta] gi|190653376|gb|EDV50619.1| GG15054 [Drosophila erecta] Back     alignment and taxonomy information
>gi|296034212|gb|ADG84993.1| TRPA1 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|296034214|gb|ADG84994.1| TRPA1 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195125906|ref|XP_002007415.1| GI12404 [Drosophila mojavensis] gi|193919024|gb|EDW17891.1| GI12404 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
FB|FBgn0035934 1296 TrpA1 "Transient receptor pote 0.411 0.133 0.687 6.1e-92
ZFIN|ZDB-GENE-050106-1 1120 trpa1b "transient receptor pot 0.383 0.143 0.313 3e-21
UNIPROTKB|G5E522 1126 TRPA1 "Uncharacterized protein 0.564 0.210 0.261 6.6e-21
UNIPROTKB|F1RWI1 1121 TRPA1 "Uncharacterized protein 0.559 0.209 0.258 5.1e-20
UNIPROTKB|O75762 1119 TRPA1 "Transient receptor pote 0.557 0.209 0.262 1e-19
ZFIN|ZDB-GENE-050105-6 1126 trpa1a "transient receptor pot 0.378 0.141 0.305 2.9e-17
UNIPROTKB|E1C7Y7 1074 TRPA1 "Uncharacterized protein 0.447 0.175 0.287 1.1e-16
UNIPROTKB|E1BZK9 1075 TRPA1 "Uncharacterized protein 0.447 0.174 0.287 1.1e-16
MGI|MGI:3522699 1125 Trpa1 "transient receptor pote 0.333 0.124 0.270 1.2e-15
UNIPROTKB|F1Q2M0 1117 TRPA1 "Uncharacterized protein 0.616 0.231 0.258 4.2e-15
FB|FBgn0035934 TrpA1 "Transient receptor potential A1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 621 (223.7 bits), Expect = 6.1e-92, Sum P(2) = 6.1e-92
 Identities = 119/173 (68%), Positives = 138/173 (79%)

Query:     1 MSGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAIXXXXXXXXXXXXXXMDLS 60
             MSGYT T+  L+SVHSHLLDQVDKDGNTALHLATMENKP AI              +D+S
Sbjct:   653 MSGYTETIELLHSVHSHLLDQVDKDGNTALHLATMENKPHAISVLMSMGCKLVYNVLDMS 712

Query:    61 AIDYAIYYKFPEAALAMVTHNTRGTEIMSLRSDKHPCVTLALVASMPRVFESVQDKSITK 120
             AIDYAIYYK+PEAALAMVTH  R  E+M+LRSDKHPCVTLAL+ASMP+VFE+VQDK ITK
Sbjct:   713 AIDYAIYYKYPEAALAMVTHEERANEVMALRSDKHPCVTLALIASMPKVFEAVQDKCITK 772

Query:   121 ANCKKDSKSFYIKYNFSCLQCLRIYPEINEKTGDATAISKPIPLPALNNTALH 173
             ANCKKDSKSFYIKY+F+ LQC  ++ +I+EKTG++   + PIPLPALN    H
Sbjct:   773 ANCKKDSKSFYIKYSFAFLQCPFMFAKIDEKTGESITTASPIPLPALNTMVTH 825


GO:0006816 "calcium ion transport" evidence=ISS
GO:0005262 "calcium channel activity" evidence=ISS
GO:0009266 "response to temperature stimulus" evidence=NAS
GO:0005216 "ion channel activity" evidence=IEA
GO:0006811 "ion transport" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0043052 "thermotaxis" evidence=IDA;IMP
GO:0009408 "response to heat" evidence=IMP
GO:0034605 "cellular response to heat" evidence=IDA
GO:0042745 "circadian sleep/wake cycle" evidence=IMP
GO:0007613 "memory" evidence=IMP
GO:0033038 "bitter taste receptor activity" evidence=IDA
GO:0001580 "detection of chemical stimulus involved in sensory perception of bitter taste" evidence=IMP
GO:0040040 "thermosensory behavior" evidence=IMP
GO:0007638 "mechanosensory behavior" evidence=IMP
ZFIN|ZDB-GENE-050106-1 trpa1b "transient receptor potential cation channel, subfamily A, member 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G5E522 TRPA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWI1 TRPA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O75762 TRPA1 "Transient receptor potential cation channel subfamily A member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050105-6 trpa1a "transient receptor potential cation channel, subfamily A, member 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7Y7 TRPA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZK9 TRPA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:3522699 Trpa1 "transient receptor potential cation channel, subfamily A, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2M0 TRPA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7Z020TRPA1_DROMENo assigned EC number0.72830.40950.1327yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.003
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 41.2 bits (97), Expect = 1e-04
 Identities = 15/57 (26%), Positives = 22/57 (38%), Gaps = 1/57 (1%)

Query: 19  LDQVDKDGNTALHLATMENKPKAICLLLSLNCKL-LYNCMDLSAIDYAIYYKFPEAA 74
           ++  DKDGNT LHLA        + LLL     +   +    + +  A      E  
Sbjct: 66  VNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVV 122


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 420
KOG0510|consensus 929 100.0
KOG0510|consensus929 99.86
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.69
KOG4412|consensus226 99.58
KOG4412|consensus226 99.55
KOG3676|consensus 782 99.52
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.49
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.46
PHA02791284 ankyrin-like protein; Provisional 99.44
PHA02875413 ankyrin repeat protein; Provisional 99.43
PHA02741169 hypothetical protein; Provisional 99.41
PHA02946446 ankyin-like protein; Provisional 99.41
PHA02791284 ankyrin-like protein; Provisional 99.4
KOG0512|consensus228 99.39
PHA02875413 ankyrin repeat protein; Provisional 99.38
PHA02884300 ankyrin repeat protein; Provisional 99.38
PHA02795437 ankyrin-like protein; Provisional 99.38
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.36
PHA02878477 ankyrin repeat protein; Provisional 99.35
PHA02743166 Viral ankyrin protein; Provisional 99.33
PLN03192823 Voltage-dependent potassium channel; Provisional 99.33
PHA02736154 Viral ankyrin protein; Provisional 99.32
PHA02859209 ankyrin repeat protein; Provisional 99.31
KOG0509|consensus600 99.31
PHA02874434 ankyrin repeat protein; Provisional 99.31
PHA02878477 ankyrin repeat protein; Provisional 99.31
KOG0508|consensus615 99.28
PHA02743166 Viral ankyrin protein; Provisional 99.27
PHA02874434 ankyrin repeat protein; Provisional 99.27
KOG0514|consensus452 99.26
PHA03095471 ankyrin-like protein; Provisional 99.25
PHA03095471 ankyrin-like protein; Provisional 99.25
PHA02798489 ankyrin-like protein; Provisional 99.24
PHA03100480 ankyrin repeat protein; Provisional 99.24
PHA02741169 hypothetical protein; Provisional 99.24
PHA02798489 ankyrin-like protein; Provisional 99.24
KOG0509|consensus 600 99.22
PHA02859209 ankyrin repeat protein; Provisional 99.22
PHA03100480 ankyrin repeat protein; Provisional 99.22
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.2
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.2
KOG0195|consensus448 99.2
PHA02876 682 ankyrin repeat protein; Provisional 99.19
KOG0508|consensus615 99.18
PHA02989494 ankyrin repeat protein; Provisional 99.17
KOG0514|consensus452 99.16
PHA02989494 ankyrin repeat protein; Provisional 99.15
KOG4214|consensus117 99.14
KOG4177|consensus 1143 99.14
PHA02795437 ankyrin-like protein; Provisional 99.14
PHA02946446 ankyin-like protein; Provisional 99.12
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.11
PLN03192823 Voltage-dependent potassium channel; Provisional 99.1
KOG0512|consensus228 99.08
PHA02884300 ankyrin repeat protein; Provisional 99.08
PHA02917 661 ankyrin-like protein; Provisional 99.07
KOG0502|consensus296 99.06
PHA02876682 ankyrin repeat protein; Provisional 99.05
PHA02792631 ankyrin-like protein; Provisional 99.01
KOG0195|consensus448 99.0
PHA02730 672 ankyrin-like protein; Provisional 99.0
KOG4177|consensus 1143 98.99
KOG0502|consensus296 98.99
PHA02736154 Viral ankyrin protein; Provisional 98.98
PHA02917661 ankyrin-like protein; Provisional 98.97
PHA02730672 ankyrin-like protein; Provisional 98.97
KOG0515|consensus752 98.96
PHA02792631 ankyrin-like protein; Provisional 98.96
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 98.96
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 98.95
KOG0522|consensus 560 98.91
KOG0507|consensus 854 98.87
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 98.86
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 98.85
KOG1710|consensus396 98.82
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 98.81
KOG0507|consensus 854 98.73
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 98.73
TIGR00870 743 trp transient-receptor-potential calcium channel p 98.7
PF1360630 Ank_3: Ankyrin repeat 98.68
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.67
KOG0505|consensus527 98.59
KOG4214|consensus117 98.53
KOG1710|consensus396 98.49
KOG0818|consensus 669 98.44
KOG0515|consensus752 98.42
KOG0505|consensus527 98.41
KOG0705|consensus749 98.39
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.36
KOG0783|consensus 1267 98.34
KOG0506|consensus622 98.31
KOG2384|consensus223 98.28
KOG3676|consensus 782 98.26
KOG3609|consensus 822 98.25
KOG4369|consensus 2131 98.19
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.03
KOG4369|consensus 2131 98.0
KOG0782|consensus1004 97.9
PF1360630 Ank_3: Ankyrin repeat 97.84
KOG0783|consensus 1267 97.56
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 97.54
PLN03223 1634 Polycystin cation channel protein; Provisional 97.21
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.13
KOG0521|consensus785 97.13
PF08016 425 PKD_channel: Polycystin cation channel; InterPro: 97.13
KOG0511|consensus516 97.12
KOG0782|consensus1004 97.1
KOG0818|consensus 669 96.98
KOG0520|consensus975 96.86
KOG0506|consensus622 96.86
KOG0521|consensus785 96.71
KOG0511|consensus516 96.7
KOG2505|consensus591 96.3
KOG0520|consensus975 96.02
KOG3599|consensus 798 95.22
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.0
KOG0522|consensus560 94.54
KOG2384|consensus223 93.35
PF00520 200 Ion_trans: Ion transport protein calcium channel s 93.12
KOG0705|consensus749 92.83
KOG3609|consensus 822 91.89
>KOG0510|consensus Back     alignment and domain information
Probab=100.00  E-value=6.7e-52  Score=434.65  Aligned_cols=294  Identities=25%  Similarity=0.344  Sum_probs=240.0

Q ss_pred             CCCHHHHHHHHh-cCCCCCCCcCCCCChHHHHHHHcCCHHHHHHHHHCCCcccc----cCCCCcHHHHHHHcCCHHHHHH
Q psy8764           2 SGYTNTMVHLNS-VHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKLLY----NCMDLSAIDYAIYYKFPEAALA   76 (420)
Q Consensus         2 ~G~~e~ve~LL~-~~~~~in~~D~~G~TpLHlAa~~g~~~vV~lLL~~Ga~i~~----n~~g~TpLh~A~~~g~~evv~~   76 (420)
                      .|..++|+.||+ .+..++|+.|..|+||||+|+++||.++|++||++||....    |.+|.||||.|+.+|+..+|+.
T Consensus       316 yg~~ntv~rLL~~~~~rllne~D~~g~tpLHlaa~~gH~~v~qlLl~~GA~~~~~~e~D~dg~TaLH~Aa~~g~~~av~~  395 (929)
T KOG0510|consen  316 YGRINTVERLLQESDTRLLNESDLHGMTPLHLAAKSGHDRVVQLLLNKGALFLNMSEADSDGNTALHLAAKYGNTSAVQK  395 (929)
T ss_pred             cccHHHHHHHHhCcCccccccccccCCCchhhhhhcCHHHHHHHHHhcChhhhcccccccCCchhhhHHHHhccHHHHHH
Confidence            588999999999 67778999999999999999999999999999999998843    8999999999999999999999


Q ss_pred             HHhCCCCccc----------------h--hcccCCCCcchHHHHHhhCHHHHHHHhhccccccccCCCCcceeeeechhh
Q psy8764          77 MVTHNTRGTE----------------I--MSLRSDKHPCVTLALVASMPRVFESVQDKSITKANCKKDSKSFYIKYNFSC  138 (420)
Q Consensus        77 Ll~~~~~~~~----------------~--~~~~~~~~~~~~~~li~~~p~~~~~lLD~ci~~~~~~~~~~~~~i~y~f~~  138 (420)
                      |+.||..-..                +  .....+.+.||..++++++|++++.++|.|+.++.+++++           
T Consensus       396 Li~~Ga~I~~~n~~g~SA~~~~~~~~~p~~~~~~~~n~c~~~~~i~~~pe~~e~vlD~c~l~~~e~~~~-----------  464 (929)
T KOG0510|consen  396 LISHGADIGVKNKKGKSAFDTRPDRCLPVFVHRSPFNKCPTTELIEPLPECFEIVLDFCILKSQERKDS-----------  464 (929)
T ss_pred             HHHcCCceeeccccccccccccccccccHHHhhCCCCCcchhhhhccchHHHHHHHHHHHHHHhhccCC-----------
Confidence            9999765421                1  1112223789999999999999999999999999888765           


Q ss_pred             ccccccccccccccCCCCCCCCCCcchhhHHHHHH-------------HHHhhhhhhHHHHHHHHHHHhhhcccceeeee
Q psy8764         139 LQCLRIYPEINEKTGDATAISKPIPLPALNNTALH-------------LATISHHFYRPTFLDRNLALFFHNCVFVGSNP  205 (420)
Q Consensus       139 Lq~p~~~~~~~~~~~~~~~~~~~~pl~~Ln~mv~h-------------LL~~KW~~yg~~~~~~nl~~y~~~~~~lfl~~  205 (420)
                         |.           +.+...+.   .+|.||++             +|.|||++||+++|+.||++|+     +|++|
T Consensus       465 ---~~-----------~~Q~~~~~---~~~~mv~~~~~eLL~HPL~ssfL~mKW~~~g~~~~~~nL~~Y~-----lFlv~  522 (929)
T KOG0510|consen  465 ---PT-----------PLQDEAAP---ILNIMVDKEQIELLEHPLSSSFLFMKWNRYGKYFHLNNLLIYS-----LFLVS  522 (929)
T ss_pred             ---CC-----------hhhhhhhh---HHHHHhhhhHHHHhcChhHHHHHHHHHHHhhHHHHHHHHHHHH-----HHHHH
Confidence               21           11111121   67778776             4559999999999999999999     99999


Q ss_pred             cchhhhhhhhhhhhhhcchhhHHhhccccceeecCCCCCcccchhhhhhhhhccCccchhhhhhhhccCCCcchhhhHHH
Q psy8764         206 TPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKLGFLDLVIRKWFCNPFTEDAIDMVLESNGNDVFTDEIDK  285 (420)
Q Consensus       206 lT~~~~qv~l~t~le~~lp~~~~~~vd~~~~~~ypn~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~  285 (420)
                      +|.++    +|+    |-|..|                 ++.|                                     
T Consensus       523 lT~Yv----~~~----~~~~~~-----------------n~~~-------------------------------------  540 (929)
T KOG0510|consen  523 LTIYV----LLI----KAGMAF-----------------NSSG-------------------------------------  540 (929)
T ss_pred             HHHHH----HHh----cccccc-----------------cccc-------------------------------------
Confidence            99976    111    111111                 0000                                     


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhcccccCccCCCCCCCCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHhccccccC
Q psy8764         286 LKRKLNEIQIHLDHQFMFLRLIVHKMDIKTETDERDEGTSSNKELHPLLYICGTAISTYMLFSVAVQSVQIYQQKWHYLF  365 (420)
Q Consensus       286 ~k~rlk~~~~~~~~q~~l~kli~~~~ei~sea~d~d~~~~~~~~~~~~~~~~~~~i~~~~~~~i~~E~~Ql~~~~~~Yf~  365 (420)
                                               -||.++++|  .++..+..++..+.+|+++|+++++++++||++|+|||+++||.
T Consensus       541 -------------------------~~~~~~~s~--~se~lr~~~t~~i~~~~ili~~~i~~~~~~E~iQifqqk~~Y~~  593 (929)
T KOG0510|consen  541 -------------------------TEIISKTSD--HSEILRNNNTMLIAFCMILIFTSIILGILRECIQIFQQKRHYFM  593 (929)
T ss_pred             -------------------------ceeehhccc--hhhhhhccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence                                     134445444  33334445688899999999999999999999999999999999


Q ss_pred             CchhHHHHHHHHHHHHhhccccccccccccchhHHHHHHHHHHHHHHHHhhhcc
Q psy8764         366 DPTNIVALLLFFSATIMIVPLFTKGRYMTDYQISFTSLTVFLSWLTLLLNLQSL  419 (420)
Q Consensus       366 d~~N~~ew~ly~~si~~v~~~~~~~~~~~~~qw~~ga~aifl~W~~lll~l~rf  419 (420)
                      |++|++||++|++++++|.|.+.  ..+.+|||++||+||||+||||+|++|||
T Consensus       594 ~i~Nimew~iyts~li~v~~~~~--~~~~~~Q~~laa~aV~l~W~nllLmi~~~  645 (929)
T KOG0510|consen  594 DIENIMEWFIYTSALITVYPLFF--EITAHLQWVLAAFAVLLGWMNLLLMIGRF  645 (929)
T ss_pred             hhHHHHHHHHHhhhhheeehhhh--hhHHHHHHHHHHHHHHHHHHHHHHHHccC
Confidence            99999999999999999999985  25679999999999999999999999998



>KOG0510|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PLN03223 Polycystin cation channel protein; Provisional Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG3599|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 49.1 bits (116), Expect = 2e-06
 Identities = 66/448 (14%), Positives = 138/448 (30%), Gaps = 136/448 (30%)

Query: 3   GYTNT----MVHLNSVHSHL----LDQVDKDGNTALHLAT--------MENKPKAICLL- 45
              N+    +  L  +   +      + D   N  L + +        +++KP   CLL 
Sbjct: 190 KNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLV 249

Query: 46  ------------LSLNCKLLYNCMDLSAIDYAIYYKFPEAALAMVTHNTRGTEIMSL--- 90
                        +L+CK+L         D+         +L   +      E+ SL   
Sbjct: 250 LLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLK 309

Query: 91  ----RSDKHP---CVTLALVASMPRVFESVQDKSIT-----KANCKKDSKSFYIKYNFSC 138
               R    P     T     S+  + ES++D   T       NC K +    I+   S 
Sbjct: 310 YLDCRPQDLPREVLTTNPRRLSI--IAESIRDGLATWDNWKHVNCDKLTTI--IE---SS 362

Query: 139 LQCLRIYPEINEKTGDATAI---SKPIPLPAL-----NNTALHLATISHHFYRPTFLDRN 190
           L  L   P    K  D  ++   S  IP   L     +     +  + +  ++ + +++ 
Sbjct: 363 LNVL--EPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQ 420

Query: 191 ---LALFFHNCVFVGSNPTPTLFLQVLLHTELERNLPKFLLEKVDKMEIYEYPNECKGKL 247
                +   +           ++L++ +  E E  L + +++       Y  P       
Sbjct: 421 PKESTISIPS-----------IYLELKVKLENEYALHRSIVDH------YNIP------- 456

Query: 248 GFLDLVIRKWFCNPFTEDAIDMV--------LESNGNDVFTDEIDKLKRKLNEIQIHLDH 299
                  + +  +      +D          L++  +    + +   +       + LD 
Sbjct: 457 -------KTFDSDDLIPPYLDQYFYSHIGHHLKNIEH---PERMTLFRM------VFLD- 499

Query: 300 QFMFLRLIVHKMDIKTETDERDEGTSSNKELHPLL----YICGTA------ISTYMLFSV 349
            F FL     K  I+ ++   +   S    L  L     YIC         ++  + F  
Sbjct: 500 -FRFLE---QK--IRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLP 553

Query: 350 AVQSVQIYQQKWHYLFDPTNIVALLLFF 377
            ++   +   K+      T+++ + L  
Sbjct: 554 KIEE-NLICSKY------TDLLRIALMA 574


>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.68
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.67
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.67
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.63
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.63
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.6
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.59
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.59
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.59
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.59
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.58
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.58
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.58
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.57
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.57
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.56
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.56
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.56
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.55
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.55
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.55
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.54
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.54
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.54
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.54
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.54
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.53
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.53
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.53
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.52
3hra_A201 Ankyrin repeat family protein; structural protein; 99.52
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.52
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.52
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.52
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.52
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.51
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.51
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.51
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.51
2rfa_A232 Transient receptor potential cation channel subfa 99.51
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.51
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.5
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.5
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.5
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.5
2rfa_A232 Transient receptor potential cation channel subfa 99.49
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.49
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.49
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.49
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.48
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.48
2etb_A256 Transient receptor potential cation channel subfam 99.48
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.48
2pnn_A273 Transient receptor potential cation channel subfa 99.47
3hra_A201 Ankyrin repeat family protein; structural protein; 99.47
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.47
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.47
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.47
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.47
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.47
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.47
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.47
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.47
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.46
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.46
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.46
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.46
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.45
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.45
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.45
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.45
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.44
2etb_A256 Transient receptor potential cation channel subfam 99.44
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.43
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.43
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.43
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.43
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.43
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.43
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.43
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.42
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.42
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.42
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.42
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.42
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.42
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.41
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.41
2pnn_A273 Transient receptor potential cation channel subfa 99.41
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.41
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.4
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.4
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.4
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.4
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.39
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.39
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.36
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.36
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.36
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.35
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.34
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.34
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.32
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.32
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.31
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.31
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.31
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.29
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.28
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.28
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.27
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.26
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.1
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.08
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
Probab=99.68  E-value=2e-16  Score=126.50  Aligned_cols=80  Identities=19%  Similarity=0.208  Sum_probs=75.8

Q ss_pred             CCCHHHHHHHHhcCCCCCCCcCCCCChHHHHHHHcCCHHHHHHHHHCCCcc-cccCCCCcHHHHHHHcCCHHHHHHHHhC
Q psy8764           2 SGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKL-LYNCMDLSAIDYAIYYKFPEAALAMVTH   80 (420)
Q Consensus         2 ~G~~e~ve~LL~~~~~~in~~D~~G~TpLHlAa~~g~~~vV~lLL~~Ga~i-~~n~~g~TpLh~A~~~g~~evv~~Ll~~   80 (420)
                      +|+.++++.|++.++ ++|.+|.+|+||||+|+..|+.+++++|+++|+++ ..|..|.||||+|+..|+.++++.|+.+
T Consensus        12 ~~~~~~v~~Ll~~g~-~~n~~d~~g~t~L~~A~~~~~~~~v~~Ll~~ga~~~~~d~~g~t~l~~A~~~~~~~~~~~Ll~~   90 (93)
T 1n0q_A           12 NGHLEVVKLLLEAGA-DVNAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVNAKDKNGRTPLHLAARNGHLEVVKLLLEA   90 (93)
T ss_dssp             HTCHHHHHHHHHTTC-CTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHT
T ss_pred             cCCHHHHHHHHHcCC-CCcccCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCccCCCCCCHHHHHHHcCCHHHHHHHHHc
Confidence            588999999999776 79999999999999999999999999999999999 8999999999999999999999999988


Q ss_pred             CC
Q psy8764          81 NT   82 (420)
Q Consensus        81 ~~   82 (420)
                      ++
T Consensus        91 ga   92 (93)
T 1n0q_A           91 GA   92 (93)
T ss_dssp             TC
T ss_pred             CC
Confidence            74



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 420
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.001
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.003
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.004
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Swi6 ankyrin-repeat fragment
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 43.9 bits (102), Expect = 2e-05
 Identities = 12/60 (20%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 8   MVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKL-LYNCMDLSAIDYAI 66
            + L  + +++L+  D +G+T L++A        +  LL       + N   L  +D+  
Sbjct: 241 NLDLKWIIANMLNAQDSNGDTCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGA 300


>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.62
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.61
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.53
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.53
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.51
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.49
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.49
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.48
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.47
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.44
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.43
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.42
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.41
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.41
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.4
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.39
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.36
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.36
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.34
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.34
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.31
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.29
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.29
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.27
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.26
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.25
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.23
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.23
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.16
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.15
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.09
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.07
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.02
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 98.91
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 53BP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68  E-value=1.4e-17  Score=141.14  Aligned_cols=84  Identities=12%  Similarity=0.082  Sum_probs=78.7

Q ss_pred             CCCHHHHHHHHhcCCCCCCCcCCCCChHHHHHHHcCCHHHHHHHHHCCCcc-cccCCCCcHHHHHHHcCCHHHHHHHHhC
Q psy8764           2 SGYTNTMVHLNSVHSHLLDQVDKDGNTALHLATMENKPKAICLLLSLNCKL-LYNCMDLSAIDYAIYYKFPEAALAMVTH   80 (420)
Q Consensus         2 ~G~~e~ve~LL~~~~~~in~~D~~G~TpLHlAa~~g~~~vV~lLL~~Ga~i-~~n~~g~TpLh~A~~~g~~evv~~Ll~~   80 (420)
                      +|+.++++.|++.++ ++|.+|++|+||||+|+..|+.+++++|+++|+++ ..|.+|+||||+|+.+|+.++++.|+++
T Consensus        11 ~G~~~~v~~Ll~~g~-d~n~~d~~g~t~Lh~A~~~~~~~~~~~ll~~g~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~   89 (130)
T d1ycsb1          11 EGEFDLVQRIIYEVD-DPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVES   89 (130)
T ss_dssp             HTCHHHHHHHTSTTS-SCCCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHHT
T ss_pred             cCCHHHHHHHHHcCC-CccccccccccccccccccccccccccccccccccccccccCcccccccchhhHHHHHHHHHHc
Confidence            599999999999776 79999999999999999999999999999999999 8999999999999999999999999999


Q ss_pred             CCCccc
Q psy8764          81 NTRGTE   86 (420)
Q Consensus        81 ~~~~~~   86 (420)
                      +.....
T Consensus        90 ga~v~~   95 (130)
T d1ycsb1          90 GAAVFA   95 (130)
T ss_dssp             TCCTTC
T ss_pred             CCCccc
Confidence            865443



>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure