Psyllid ID: psy8803


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
KKSWYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPSKVKYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHFGTPQSTSGEIAVFSLQ
ccccccccEEEccccccEEEEEcccccccEEEEEEcccccEEEEEEcccEEEEEccccccEEEEEEcccccccccEEEEEEcccccEEEEEEccccccccccEEEEEEEcc
cccHHHHHHHHHcccccEEEEEEcccccEEEEEEEcccccEEEEcccccEEEEEEccccEEEEEEcccccccccEEEEEEEcccccEEEEEEEEcccccccccEEEEEEEc
KKSWYEEykrldyhtpiveTEVLTQHTHQVLHVSfshngryfatcskdgYILVWtssypskvkyshdmKTFSWKYTqysqfnesdTLLLVSgvhfgtpqstsgEIAVFSLQ
kkswyeeykrldyhTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPSKVKYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHfgtpqstsgeiavfsLQ
KKSWYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPSKVKYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHFGTPQSTSGEIAVFSLQ
***WYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPSKVKYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHFGT**************
*KSWYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPSKVKYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHFGTPQSTSGEIAVFSLQ
KKSWYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPSKVKYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHFGTPQSTSGEIAVFSLQ
*KSWYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPSKVKYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHFGTPQSTSGEIAVFSLQ
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KKSWYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPSKVKYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHFGTPQSTSGEIAVFSLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q4KLI9 569 F-box/WD repeat-containin yes N/A 0.972 0.189 0.527 1e-28
Q969U6 566 F-box/WD repeat-containin yes N/A 0.972 0.190 0.527 1e-28
Q9QXW2 573 F-box/WD repeat-containin yes N/A 0.972 0.188 0.527 1e-28
>sp|Q4KLI9|FBXW5_RAT F-box/WD repeat-containing protein 5 OS=Rattus norvegicus GN=Fbxw5 PE=2 SV=1 Back     alignment and function desciption
 Score =  125 bits (313), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 57/108 (52%), Positives = 76/108 (70%)

Query: 3   SWYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPSKV 62
           SWYEE++RL    P VE + L +HT QVLH+SFSH+G  FA+CSKD  + +W +     +
Sbjct: 68  SWYEEFRRLYDMVPCVEVQTLKEHTDQVLHLSFSHSGYQFASCSKDCTVKIWNNDLTISL 127

Query: 63  KYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHFGTPQSTSGEIAVFSL 110
            +S DM+ ++W YTQ+SQFN+ D+LLL SGV  G   S+SGEIAV SL
Sbjct: 128 LHSADMRPYNWSYTQFSQFNQDDSLLLASGVFLGPHNSSSGEIAVISL 175




Substrate recognition component of both SCF (SKP1-CUL1-F-box protein) and DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes. Substrate recognition component of the SCF(FBXW5) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of SASS6 during S phase, leading to prevent centriole reduplication. Substrate-specific adapter of the DCX(FBXW5) E3 ubiquitin-protein ligase complex which mediates the polyubiquitination and subsequent degradation of TSC2. May also act as a negative regulator of MAP3K7/TAK1 signaling in the interleukin-1B (IL1B) signaling pathway.
Rattus norvegicus (taxid: 10116)
>sp|Q969U6|FBXW5_HUMAN F-box/WD repeat-containing protein 5 OS=Homo sapiens GN=FBXW5 PE=1 SV=1 Back     alignment and function description
>sp|Q9QXW2|FBXW5_MOUSE F-box/WD repeat-containing protein 5 OS=Mus musculus GN=Fbxw5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
270008330 627 hypothetical protein TcasGA2_TC030756 [T 0.990 0.175 0.763 3e-46
189237257 629 PREDICTED: similar to CG9144 CG9144-PA [ 0.990 0.174 0.763 3e-46
350409711 676 PREDICTED: F-box/WD repeat-containing pr 0.990 0.162 0.8 3e-46
380028091 699 PREDICTED: F-box/WD repeat-containing pr 0.990 0.157 0.790 7e-46
328781430 670 PREDICTED: f-box/WD repeat-containing pr 0.990 0.164 0.790 8e-46
307170835 677 F-box/WD repeat-containing protein 5 [Ca 0.990 0.162 0.781 8e-46
322783222 671 hypothetical protein SINV_06875 [Solenop 0.990 0.163 0.781 1e-45
332028257 683 F-box/WD repeat-containing protein 5 [Ac 0.990 0.161 0.781 2e-45
307204112 675 F-box/WD repeat-containing protein 5 [Ha 0.990 0.162 0.763 2e-44
340718611 676 PREDICTED: f-box/WD repeat-containing pr 0.990 0.162 0.736 7e-43
>gi|270008330|gb|EFA04778.1| hypothetical protein TcasGA2_TC030756 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 99/110 (90%)

Query: 1   KKSWYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPS 60
           +++WYEE+KRL Y+ P+V+TE L  H HQVLHVSFSHNG+YFATCSKDGY+L+W S+YP 
Sbjct: 61  ERTWYEEFKRLSYNVPVVQTETLHDHRHQVLHVSFSHNGKYFATCSKDGYVLLWNSTYPV 120

Query: 61  KVKYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHFGTPQSTSGEIAVFSL 110
           ++KYS DM +FSWKYTQYSQFNESDTLLLVSGVHFGTP STSGEIAVF+L
Sbjct: 121 EIKYSRDMNSFSWKYTQYSQFNESDTLLLVSGVHFGTPHSTSGEIAVFNL 170




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189237257|ref|XP_001812039.1| PREDICTED: similar to CG9144 CG9144-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350409711|ref|XP_003488822.1| PREDICTED: F-box/WD repeat-containing protein 5-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380028091|ref|XP_003697745.1| PREDICTED: F-box/WD repeat-containing protein 5-like [Apis florea] Back     alignment and taxonomy information
>gi|328781430|ref|XP_395619.4| PREDICTED: f-box/WD repeat-containing protein 5-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307170835|gb|EFN62946.1| F-box/WD repeat-containing protein 5 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322783222|gb|EFZ10808.1| hypothetical protein SINV_06875 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332028257|gb|EGI68304.1| F-box/WD repeat-containing protein 5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307204112|gb|EFN82981.1| F-box/WD repeat-containing protein 5 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340718611|ref|XP_003397758.1| PREDICTED: f-box/WD repeat-containing protein 5-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
FB|FBgn0031773 656 Fbw5 [Drosophila melanogaster 0.981 0.166 0.655 2.8e-38
UNIPROTKB|F1RVZ3 497 FBXW5 "Uncharacterized protein 0.972 0.217 0.537 2.9e-28
UNIPROTKB|Q28BQ8 558 fbxw5 "F-box and WD-40 domain 0.981 0.195 0.568 7.2e-28
UNIPROTKB|Q969U6 566 FBXW5 "F-box/WD repeat-contain 0.963 0.189 0.541 4.5e-27
RGD|1305661 569 Fbxw5 "F-box and WD repeat dom 0.972 0.189 0.527 4.6e-27
MGI|MGI:1354731 573 Fbxw5 "F-box and WD-40 domain 0.972 0.188 0.527 4.7e-27
UNIPROTKB|E1B9Q1 565 FBXW5 "Uncharacterized protein 0.972 0.191 0.518 2.1e-26
UNIPROTKB|F1NV19 506 FBXW5 "Uncharacterized protein 0.972 0.213 0.5 2.7e-26
UNIPROTKB|F1NV20 510 FBXW5 "Uncharacterized protein 0.972 0.211 0.5 2.8e-26
ZFIN|ZDB-GENE-040426-2571 597 fbxw5 "F-box and WD-40 domain 0.972 0.180 0.504 4.8e-24
FB|FBgn0031773 Fbw5 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 414 (150.8 bits), Expect = 2.8e-38, P = 2.8e-38
 Identities = 76/116 (65%), Positives = 90/116 (77%)

Query:     2 KSWYEEYKRLDYHTPIVETEVLTQ-------HTHQVLHVSFSHNGRYFATCSKDGYILVW 54
             +SW  EYKRL  H P V+ + L         HTHQVLHVSF+HNG  FATCSKDGY+++W
Sbjct:    97 ESWRAEYKRLSMHIPFVQAQRLEPTVENNHGHTHQVLHVSFAHNGEMFATCSKDGYVIIW 156

Query:    55 TSSYPSKVKYSHDMKTFSWKYTQYSQFNESDTLLLVSGVHFGTPQSTSGEIAVFSL 110
              + +P   KY+H+MK FSWKY+QYSQFN+SDTLLLVSGVHFG+PQSTSGEIAVF L
Sbjct:   157 NAQHPCSEKYAHNMKQFSWKYSQYSQFNQSDTLLLVSGVHFGSPQSTSGEIAVFYL 212




GO:0042787 "protein ubiquitination involved in ubiquitin-dependent protein catabolic process" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|F1RVZ3 FBXW5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q28BQ8 fbxw5 "F-box and WD-40 domain protein 5" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q969U6 FBXW5 "F-box/WD repeat-containing protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305661 Fbxw5 "F-box and WD repeat domain containing 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1354731 Fbxw5 "F-box and WD-40 domain protein 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1B9Q1 FBXW5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV19 FBXW5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV20 FBXW5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2571 fbxw5 "F-box and WD-40 domain protein 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q969U6FBXW5_HUMANNo assigned EC number0.52770.97290.1908yesN/A
Q9QXW2FBXW5_MOUSENo assigned EC number0.52770.97290.1884yesN/A
Q4KLI9FBXW5_RATNo assigned EC number0.52770.97290.1898yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
smart0032040 smart00320, WD40, WD40 repeats 4e-07
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 9e-07
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-05
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 2e-04
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 2e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.002
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
 Score = 42.7 bits (101), Expect = 4e-07
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 22 VLTQHTHQVLHVSFSHNGRYFATCSKDGYILVW 54
           L  HT  V  V+FS +G+Y A+ S DG I +W
Sbjct: 7  TLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLW 39


Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain. Length = 40

>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
KOG0279|consensus 315 99.87
KOG0272|consensus459 99.85
KOG0271|consensus 480 99.85
KOG0263|consensus707 99.84
KOG0272|consensus459 99.84
KOG0266|consensus 456 99.82
KOG0279|consensus315 99.81
KOG0277|consensus311 99.81
KOG0286|consensus343 99.79
KOG0315|consensus 311 99.78
KOG0266|consensus456 99.78
KOG0647|consensus 347 99.77
PTZ00421 493 coronin; Provisional 99.77
KOG0285|consensus 460 99.77
PTZ00421 493 coronin; Provisional 99.75
KOG0302|consensus440 99.75
KOG0295|consensus406 99.74
KOG0271|consensus480 99.74
KOG0286|consensus343 99.74
KOG0282|consensus 503 99.73
KOG0273|consensus524 99.73
KOG0313|consensus423 99.72
KOG0283|consensus 712 99.72
KOG0263|consensus707 99.72
PLN00181 793 protein SPA1-RELATED; Provisional 99.71
KOG0273|consensus524 99.71
KOG0315|consensus 311 99.7
KOG0291|consensus 893 99.7
PTZ00420 568 coronin; Provisional 99.7
KOG0264|consensus 422 99.7
KOG0319|consensus 775 99.7
PTZ00420 568 coronin; Provisional 99.7
KOG0292|consensus 1202 99.69
KOG0269|consensus 839 99.69
KOG0265|consensus 338 99.68
KOG0264|consensus422 99.67
KOG0276|consensus 794 99.66
KOG0316|consensus 307 99.66
KOG0645|consensus 312 99.65
KOG0276|consensus 794 99.64
KOG0295|consensus406 99.64
KOG0292|consensus 1202 99.64
KOG0285|consensus 460 99.64
KOG0772|consensus 641 99.63
KOG0284|consensus 464 99.63
KOG0269|consensus 839 99.63
KOG0275|consensus 508 99.63
KOG0284|consensus 464 99.62
KOG0277|consensus311 99.62
KOG0281|consensus 499 99.62
KOG0645|consensus312 99.62
KOG0281|consensus499 99.61
KOG0310|consensus 487 99.61
KOG0319|consensus 775 99.61
KOG0282|consensus 503 99.59
KOG0278|consensus334 99.59
KOG0294|consensus 362 99.58
KOG0300|consensus481 99.56
KOG1034|consensus 385 99.56
KOG0291|consensus 893 99.56
KOG1446|consensus 311 99.56
KOG0313|consensus423 99.55
KOG0283|consensus 712 99.55
KOG1407|consensus313 99.55
KOG1332|consensus 299 99.55
KOG0318|consensus 603 99.55
KOG0310|consensus 487 99.54
KOG0305|consensus484 99.53
KOG0316|consensus 307 99.53
KOG0265|consensus338 99.53
KOG2110|consensus 391 99.53
KOG0302|consensus 440 99.52
KOG0268|consensus 433 99.51
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.5
KOG0274|consensus 537 99.5
KOG1407|consensus313 99.5
KOG4283|consensus 397 99.49
KOG0293|consensus519 99.49
KOG0289|consensus506 99.49
KOG0289|consensus506 99.49
KOG1036|consensus 323 99.48
KOG1539|consensus 910 99.48
KOG1445|consensus 1012 99.48
KOG0274|consensus 537 99.48
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 99.48
KOG0290|consensus364 99.47
PLN00181 793 protein SPA1-RELATED; Provisional 99.47
KOG0293|consensus 519 99.47
KOG0303|consensus 472 99.46
KOG0267|consensus 825 99.45
KOG0643|consensus 327 99.45
KOG0321|consensus 720 99.45
KOG1273|consensus 405 99.44
KOG0303|consensus 472 99.44
KOG2111|consensus346 99.44
KOG0305|consensus 484 99.43
KOG0772|consensus 641 99.43
KOG0318|consensus603 99.43
KOG0267|consensus 825 99.43
KOG0306|consensus 888 99.42
KOG0296|consensus 399 99.42
KOG0270|consensus 463 99.42
KOG0275|consensus 508 99.41
KOG4283|consensus 397 99.41
KOG2445|consensus 361 99.4
KOG1274|consensus 933 99.39
KOG0973|consensus 942 99.39
KOG2394|consensus 636 99.39
KOG0306|consensus 888 99.38
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.37
KOG0308|consensus 735 99.37
KOG0641|consensus350 99.37
KOG1539|consensus 910 99.37
KOG0640|consensus 430 99.36
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.36
KOG0643|consensus327 99.36
KOG0288|consensus459 99.35
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.34
KOG0278|consensus 334 99.34
KOG1188|consensus 376 99.34
KOG0270|consensus 463 99.33
KOG4378|consensus 673 99.33
KOG2096|consensus 420 99.32
KOG0973|consensus 942 99.31
KOG0296|consensus399 99.31
KOG0308|consensus 735 99.28
KOG1009|consensus 434 99.27
KOG0299|consensus 479 99.27
KOG0321|consensus 720 99.26
KOG0288|consensus459 99.26
KOG1036|consensus 323 99.25
KOG0301|consensus 745 99.23
KOG1007|consensus370 99.22
KOG0642|consensus 577 99.21
KOG0307|consensus 1049 99.21
KOG0294|consensus 362 99.2
KOG0301|consensus 745 99.2
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.2
KOG0647|consensus 347 99.2
KOG1332|consensus 299 99.19
KOG1310|consensus 758 99.19
KOG1063|consensus 764 99.18
KOG0268|consensus433 99.18
KOG1272|consensus 545 99.17
KOG1408|consensus 1080 99.17
KOG1445|consensus 1012 99.17
KOG4378|consensus 673 99.16
KOG0640|consensus430 99.16
KOG0639|consensus705 99.16
KOG2048|consensus 691 99.13
KOG1007|consensus 370 99.13
KOG0641|consensus350 99.12
KOG0649|consensus325 99.12
KOG1310|consensus 758 99.11
KOG2919|consensus406 99.1
KOG0646|consensus 476 99.09
KOG1538|consensus 1081 99.09
KOG1034|consensus 385 99.09
KOG0300|consensus 481 99.08
KOG0322|consensus323 99.07
KOG0646|consensus 476 99.07
KOG1273|consensus 405 99.07
KOG0299|consensus 479 99.05
KOG4328|consensus 498 99.05
KOG2394|consensus 636 99.04
KOG1446|consensus 311 99.04
COG2319 466 FOG: WD40 repeat [General function prediction only 99.03
KOG2919|consensus 406 99.03
KOG1272|consensus 545 99.02
KOG2096|consensus 420 98.99
KOG0322|consensus323 98.98
KOG2048|consensus 691 98.96
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.96
KOG0280|consensus339 98.95
KOG4328|consensus498 98.93
KOG1524|consensus 737 98.93
KOG0650|consensus 733 98.92
KOG0639|consensus 705 98.91
KOG0771|consensus 398 98.9
KOG1274|consensus 933 98.89
KOG0290|consensus 364 98.89
KOG0307|consensus 1049 98.88
KOG0644|consensus 1113 98.86
KOG2055|consensus514 98.85
KOG1188|consensus 376 98.85
KOG2055|consensus514 98.84
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.83
KOG2445|consensus 361 98.82
KOG0650|consensus 733 98.81
KOG1408|consensus 1080 98.81
PRK01742 429 tolB translocation protein TolB; Provisional 98.79
KOG2111|consensus346 98.79
COG2319 466 FOG: WD40 repeat [General function prediction only 98.77
KOG3914|consensus 390 98.75
KOG0974|consensus 967 98.75
KOG1063|consensus764 98.74
KOG0974|consensus 967 98.73
KOG2106|consensus 626 98.7
KOG1524|consensus 737 98.67
KOG1517|consensus1387 98.67
KOG3881|consensus412 98.63
KOG1963|consensus 792 98.61
KOG1587|consensus555 98.61
KOG2139|consensus 445 98.6
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.59
KOG2106|consensus 626 98.58
KOG1523|consensus 361 98.57
KOG4547|consensus 541 98.57
PRK11028 330 6-phosphogluconolactonase; Provisional 98.57
KOG4227|consensus 609 98.56
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.54
KOG1587|consensus 555 98.52
KOG1240|consensus 1431 98.51
KOG1009|consensus 434 98.47
KOG4227|consensus 609 98.47
KOG1064|consensus2439 98.46
KOG0644|consensus 1113 98.45
KOG1517|consensus1387 98.45
KOG2110|consensus 391 98.45
PRK05137 435 tolB translocation protein TolB; Provisional 98.43
KOG0771|consensus 398 98.42
PRK11028 330 6-phosphogluconolactonase; Provisional 98.42
KOG4497|consensus 447 98.39
KOG2139|consensus 445 98.38
PRK04922 433 tolB translocation protein TolB; Provisional 98.35
PRK01742 429 tolB translocation protein TolB; Provisional 98.33
KOG0649|consensus 325 98.33
PRK02889 427 tolB translocation protein TolB; Provisional 98.33
KOG0280|consensus339 98.32
KOG2321|consensus 703 98.31
KOG1963|consensus 792 98.29
KOG2315|consensus 566 98.29
KOG4532|consensus 344 98.26
KOG2321|consensus 703 98.25
KOG1240|consensus 1431 98.23
PRK03629 429 tolB translocation protein TolB; Provisional 98.21
KOG0642|consensus 577 98.15
KOG1523|consensus 361 98.15
KOG1409|consensus 404 98.14
KOG4190|consensus 1034 98.13
KOG1645|consensus 463 98.11
KOG1064|consensus2439 98.06
PRK00178 430 tolB translocation protein TolB; Provisional 98.04
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 98.03
KOG2695|consensus425 97.98
PRK05137 435 tolB translocation protein TolB; Provisional 97.96
KOG1334|consensus 559 97.94
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.94
KOG2315|consensus 566 97.91
KOG4547|consensus 541 97.87
KOG4714|consensus319 97.87
PRK03629 429 tolB translocation protein TolB; Provisional 97.86
PRK04922 433 tolB translocation protein TolB; Provisional 97.83
KOG2695|consensus425 97.8
KOG4714|consensus319 97.79
PRK02889 427 tolB translocation protein TolB; Provisional 97.79
KOG3881|consensus412 97.78
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.78
KOG1354|consensus 433 97.76
PRK04792 448 tolB translocation protein TolB; Provisional 97.75
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.73
KOG0309|consensus 1081 97.72
KOG1538|consensus 1081 97.68
COG4946 668 Uncharacterized protein related to the periplasmic 97.66
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.63
KOG3914|consensus 390 97.6
TIGR02658 352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.58
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 97.53
KOG1409|consensus404 97.53
KOG4190|consensus 1034 97.52
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.49
TIGR02800 417 propeller_TolB tol-pal system beta propeller repea 97.48
PRK01029428 tolB translocation protein TolB; Provisional 97.42
KOG0309|consensus 1081 97.42
PRK00178 430 tolB translocation protein TolB; Provisional 97.38
PRK04792 448 tolB translocation protein TolB; Provisional 97.38
KOG4497|consensus 447 97.34
PRK01029428 tolB translocation protein TolB; Provisional 97.31
KOG1354|consensus433 97.29
KOG4532|consensus344 97.17
KOG1334|consensus559 97.1
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.07
KOG4640|consensus 665 97.03
KOG1275|consensus 1118 97.02
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.97
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.88
KOG1275|consensus 1118 96.85
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.84
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 96.81
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 96.75
PF10282 345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 96.74
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 96.73
KOG2314|consensus 698 96.72
KOG1832|consensus 1516 96.64
KOG1645|consensus 463 96.61
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.6
COG4946 668 Uncharacterized protein related to the periplasmic 96.58
KOG2079|consensus 1206 96.57
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.46
KOG2314|consensus 698 96.46
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.29
KOG1832|consensus 1516 96.25
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.21
KOG1912|consensus 1062 96.14
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.02
PRK02888 635 nitrous-oxide reductase; Validated 95.79
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.75
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 95.73
KOG0882|consensus 558 95.73
KOG2041|consensus 1189 95.72
KOG1912|consensus 1062 95.66
KOG2041|consensus 1189 95.6
PRK04043 419 tolB translocation protein TolB; Provisional 95.58
PRK02888 635 nitrous-oxide reductase; Validated 95.45
PF15492 282 Nbas_N: Neuroblastoma-amplified sequence, N termin 95.42
KOG3617|consensus 1416 95.27
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 95.24
KOG2444|consensus238 95.23
KOG1008|consensus 783 95.12
KOG4640|consensus 665 95.11
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.11
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 94.96
KOG2066|consensus 846 94.86
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 94.82
KOG3621|consensus 726 94.77
KOG1008|consensus 783 94.56
KOG2066|consensus 846 94.46
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.2
KOG3617|consensus 1416 94.14
KOG4649|consensus 354 93.99
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 93.95
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.93
KOG2444|consensus238 93.82
PF12768 281 Rax2: Cortical protein marker for cell polarity 93.7
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 93.49
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 93.22
PRK04043 419 tolB translocation protein TolB; Provisional 93.2
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 92.96
COG0823 425 TolB Periplasmic component of the Tol biopolymer t 92.78
PF07433 305 DUF1513: Protein of unknown function (DUF1513); In 92.66
PF13360 238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.32
KOG2114|consensus 933 92.31
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 92.25
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 92.04
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 92.02
KOG2395|consensus 644 92.0
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.9
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 91.19
KOG1920|consensus 1265 91.07
KOG2079|consensus 1206 90.92
KOG0882|consensus 558 90.71
KOG2395|consensus644 90.35
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 89.95
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 89.71
COG0823 425 TolB Periplasmic component of the Tol biopolymer t 89.33
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 89.27
PF02897 414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 89.06
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 88.82
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 88.5
KOG1920|consensus 1265 87.88
PF06433 342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 87.87
PF0173186 Arylesterase: Arylesterase; InterPro: IPR002640 Th 87.85
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 87.34
PF00930 353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 87.33
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 87.31
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 87.26
KOG1916|consensus 1283 86.69
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 86.49
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 86.35
KOG3621|consensus 726 86.17
PF05694 461 SBP56: 56kDa selenium binding protein (SBP56); Int 85.64
PF08596 395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 85.55
PF00780 275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 83.24
KOG2114|consensus 933 82.66
KOG3630|consensus 1405 82.44
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 80.48
KOG2377|consensus 657 80.17
COG3391 381 Uncharacterized conserved protein [Function unknow 80.05
>KOG0279|consensus Back     alignment and domain information
Probab=99.87  E-value=3.1e-21  Score=115.50  Aligned_cols=100  Identities=23%  Similarity=0.316  Sum_probs=83.8

Q ss_pred             cccccCeeeecCCCCceeeeeeecccccEEEEEEcCCCcEEEEEeCCCeEEEEecCCCceeeeecceeeeecCceeeEEE
Q psy8803           2 KSWYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNGRYFATCSKDGYILVWTSSYPSKVKYSHDMKTFSWKYTQYSQF   81 (111)
Q Consensus         2 ~~~~d~~i~iw~~~~~~~~~~~~~~~~~v~~i~~s~~~~~l~s~~~d~~i~iw~~~~~~~~~~~~~~~~~~~~~~~~v~~   81 (111)
                      +.+||+++++||..+++....|.+|...|.+++|++|.+.|++|+.|++|++|+........-.... .  -.-++++.|
T Consensus        80 S~swD~~lrlWDl~~g~~t~~f~GH~~dVlsva~s~dn~qivSGSrDkTiklwnt~g~ck~t~~~~~-~--~~WVscvrf  156 (315)
T KOG0279|consen   80 SASWDGTLRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSGSRDKTIKLWNTLGVCKYTIHEDS-H--REWVSCVRF  156 (315)
T ss_pred             eccccceEEEEEecCCcEEEEEEecCCceEEEEecCCCceeecCCCcceeeeeeecccEEEEEecCC-C--cCcEEEEEE
Confidence            5789999999999999999999999999999999999999999999999999999876554311111 0  134678899


Q ss_pred             ccCC-CEEEEeccccCCccccCceEEEeecC
Q psy8803          82 NESD-TLLLVSGVHFGTPQSTSGEIAVFSLQ  111 (111)
Q Consensus        82 ~~~~-~~~~~~~~~~~~~~~~~~~i~iw~~~  111 (111)
                      +|.. +.+++++       +.|++|++||++
T Consensus       157 sP~~~~p~Ivs~-------s~DktvKvWnl~  180 (315)
T KOG0279|consen  157 SPNESNPIIVSA-------SWDKTVKVWNLR  180 (315)
T ss_pred             cCCCCCcEEEEc-------cCCceEEEEccC
Confidence            9964 6667777       999999999985



>KOG0272|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF01731 Arylesterase: Arylesterase; InterPro: IPR002640 The serum paraoxonases/arylesterases are enzymes that catalyse the hydrolysis of the toxic metabolites of a variety of organophosphorus insecticides Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.87
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.86
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.86
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.83
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.83
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.83
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.83
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.83
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.83
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.83
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.82
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.82
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.82
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.82
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.81
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.81
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.81
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.81
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.8
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.8
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.8
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.8
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.79
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.79
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 99.79
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.79
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.79
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.78
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.78
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.78
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.78
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.78
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.77
2pm7_B 297 Protein transport protein SEC13, protein transport 99.77
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.77
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.77
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.76
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.76
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.76
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.76
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.75
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.75
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.75
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.75
2pm7_B297 Protein transport protein SEC13, protein transport 99.75
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.75
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.74
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.74
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 99.74
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.74
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.73
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.73
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.73
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.73
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.72
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.72
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.72
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.72
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.72
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.72
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.72
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.72
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.72
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.72
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.71
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.71
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 99.71
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.71
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.71
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.71
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.7
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.7
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.7
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.7
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.7
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.7
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 99.7
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.69
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.69
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.69
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 99.69
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.69
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.68
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.68
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.68
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.67
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.67
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.67
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.67
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.67
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.67
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 99.66
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.66
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.66
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.66
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 99.66
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 99.65
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.65
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.65
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.65
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.65
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.64
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.64
3jro_A 753 Fusion protein of protein transport protein SEC13 99.64
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.64
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.64
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.63
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.63
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 99.62
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.62
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.62
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.62
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.61
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.61
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.6
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.59
3jro_A 753 Fusion protein of protein transport protein SEC13 99.59
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.58
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.57
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.56
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.56
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.55
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.55
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.54
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.54
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.52
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.52
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.49
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.39
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.38
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.27
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.25
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 99.22
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.19
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.16
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.16
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.16
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.14
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.12
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 99.09
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.08
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.08
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.08
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.07
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.05
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.05
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.02
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.02
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.02
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.97
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.95
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 98.93
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.93
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.92
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.89
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.85
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.8
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.78
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.78
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.76
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.75
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.74
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.71
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 98.69
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.66
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.65
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 98.63
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.56
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.53
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 98.48
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.48
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.43
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 98.42
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.39
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 98.39
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.36
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 98.36
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.36
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.34
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.33
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.32
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.28
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 98.27
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 98.26
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.21
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 98.2
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.14
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.13
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 98.03
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.97
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.96
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.94
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 97.94
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 97.93
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.93
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 97.89
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.86
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.85
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.84
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.76
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.7
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 97.66
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 97.61
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.55
2qe8_A 343 Uncharacterized protein; structural genomics, join 97.49
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.42
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 97.42
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.41
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.35
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.33
2ece_A 462 462AA long hypothetical selenium-binding protein; 97.32
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 97.28
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.27
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 97.27
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 97.25
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.23
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.18
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.13
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 97.03
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.02
2ece_A 462 462AA long hypothetical selenium-binding protein; 96.93
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 96.9
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 96.87
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.86
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 96.85
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 96.82
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 96.79
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 96.72
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 96.72
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.68
2qe8_A 343 Uncharacterized protein; structural genomics, join 96.67
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.58
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.53
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.53
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 96.46
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 96.45
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.14
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 96.08
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.06
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 95.89
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.73
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 95.71
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 95.2
2fp8_A 322 Strictosidine synthase; six bladed beta propeller 95.14
1npe_A 267 Nidogen, entactin; glycoprotein, basement membrane 94.63
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 94.5
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 94.47
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 94.33
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 94.22
3v65_B 386 Low-density lipoprotein receptor-related protein; 93.86
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 93.84
3sre_A 355 PON1, serum paraoxonase; directed evolution, 6-bla 93.84
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 93.73
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 93.53
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 93.36
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 93.01
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 92.9
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 92.45
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 92.07
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 91.9
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 91.79
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 91.67
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 91.04
3hxj_A 330 Pyrrolo-quinoline quinone; all beta protein. incom 90.82
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 90.69
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 90.37
1ijq_A 316 LDL receptor, low-density lipoprotein receptor; be 89.7
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 89.68
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 89.55
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 89.38
2p4o_A 306 Hypothetical protein; putative lactonase, structur 88.89
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 88.82
3sov_A 318 LRP-6, low-density lipoprotein receptor-related pr 88.78
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 88.75
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 88.66
1tl2_A 236 L10, protein (tachylectin-2); animal lectin, horse 88.57
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 88.52
3v65_B 386 Low-density lipoprotein receptor-related protein; 88.28
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 88.1
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 87.85
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 86.76
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 85.94
2p9w_A 334 MAL S 1 allergenic protein; beta propeller; 1.35A 85.31
3kya_A 496 Putative phosphatase; structural genomics, joint c 85.12
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 84.82
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 84.8
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 83.84
3a9g_A 354 Putative uncharacterized protein; PQQ dependent de 82.41
3f7f_A 729 Nucleoporin NUP120; nuclear pore complex, macromol 82.21
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 81.04
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 80.65
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
Probab=99.87  E-value=1.4e-21  Score=122.54  Aligned_cols=98  Identities=13%  Similarity=0.084  Sum_probs=81.8

Q ss_pred             cccccCeeeecCCCCceeeeeeecccccEEEEEEcCCC-cEEEEEeCCCeEEEEecCCCceeeeecceeeeecCceeeEE
Q psy8803           2 KSWYEEYKRLDYHTPIVETEVLTQHTHQVLHVSFSHNG-RYFATCSKDGYILVWTSSYPSKVKYSHDMKTFSWKYTQYSQ   80 (111)
Q Consensus         2 ~~~~d~~i~iw~~~~~~~~~~~~~~~~~v~~i~~s~~~-~~l~s~~~d~~i~iw~~~~~~~~~~~~~~~~~~~~~~~~v~   80 (111)
                      +++.|++|++||+++++++..+.+|...|.+++|+|++ ++|++++.|++|++||++.++....    ..+ -..+++++
T Consensus       232 sg~~dg~v~~wd~~~~~~~~~~~~h~~~v~~v~fsp~g~~~lasgs~D~~i~vwd~~~~~~~~~----~~H-~~~V~~v~  306 (344)
T 4gqb_B          232 FGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRS----QAH-RDFVRDAT  306 (344)
T ss_dssp             EEETTSEEEEEESCC--CCEEEECCSSCEEEEEECSSSSCCEEEEETTSCEEEECTTCCEEEEE----CCC-SSCEEEEE
T ss_pred             EeccCCcEEEEECCCCcEEEEEcCCCCCEEEEEEccCCCeEEEEEeCCCeEEEEECCCCcEEEE----cCC-CCCEEEEE
Confidence            56789999999999999999999999999999999997 6899999999999999988765531    111 14577889


Q ss_pred             EccCCCEEEEeccccCCccccCceEEEeecC
Q psy8803          81 FNESDTLLLVSGVHFGTPQSTSGEIAVFSLQ  111 (111)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~i~iw~~~  111 (111)
                      |+|++..+++++       +.|++|++|++.
T Consensus       307 ~sp~~~~llas~-------s~D~~v~~w~v~  330 (344)
T 4gqb_B          307 WSPLNHSLLTTV-------GWDHQVVHHVVP  330 (344)
T ss_dssp             ECSSSTTEEEEE-------ETTSCEEEEECC
T ss_pred             EeCCCCeEEEEE-------cCCCeEEEEECC
Confidence            999988888888       899999999974



>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3f7f_A Nucleoporin NUP120; nuclear pore complex, macromolecular assembly, membrane coat, nucleocytoplasmic transport, beta-propeller; 2.60A {Saccharomyces cerevisiae} PDB: 3h7n_A 3hxr_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 111
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-04
d1tbga_ 340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-05
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.002
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.004
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-04
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 9e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-04
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.001
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.001
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 40.5 bits (93), Expect = 1e-05
 Identities = 10/33 (30%), Positives = 18/33 (54%)

Query: 22  VLTQHTHQVLHVSFSHNGRYFATCSKDGYILVW 54
           VL  H ++V  +  + +G   AT S D ++ +W
Sbjct: 307 VLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 339


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.81
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.81
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.78
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.76
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.74
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.74
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.74
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.73
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.72
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.71
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.7
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.67
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.66
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.65
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.65
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.65
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.64
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.64
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.61
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.61
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.6
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.6
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.57
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.57
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.55
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.55
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.53
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.51
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.5
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.45
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.43
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.42
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 99.39
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.34
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.29
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 99.29
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.22
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.16
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.94
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 98.91
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.86
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.85
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.8
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.71
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 98.65
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.62
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.57
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.4
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.32
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.29
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.54
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.5
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 97.35
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 97.22
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.03
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 97.02
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.88
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 96.78
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 96.76
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 96.62
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.25
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.11
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 95.94
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 95.69
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.24
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 95.14
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 94.48
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 93.11
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 92.22
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 91.28
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 90.75
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 89.53
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 85.09
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 83.9
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.28
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 82.99
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 82.6
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 81.02
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Antiviral protein Ski8 (Ski8p)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.81  E-value=2e-19  Score=112.32  Aligned_cols=102  Identities=12%  Similarity=0.221  Sum_probs=78.1

Q ss_pred             CcccccCeeeecCCCCceeeeee------ecccccEEEEEEcCCCcEEEEEeCCC---eEEEEecCCCceeeeec-----
Q psy8803           1 KKSWYEEYKRLDYHTPIVETEVL------TQHTHQVLHVSFSHNGRYFATCSKDG---YILVWTSSYPSKVKYSH-----   66 (111)
Q Consensus         1 ~~~~~d~~i~iw~~~~~~~~~~~------~~~~~~v~~i~~s~~~~~l~s~~~d~---~i~iw~~~~~~~~~~~~-----   66 (111)
                      |+++.|++|++||+.+++++..+      .+|...|.+++|+|++++|++++.|+   .+++||++.+.......     
T Consensus       199 asgs~Dg~i~iwd~~~~~~~~~~~~~~~l~~h~~~V~~l~~spdg~~l~sgs~D~t~~~i~lwd~~~g~~~~~l~~~~~~  278 (393)
T d1sq9a_         199 ATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVPTHS  278 (393)
T ss_dssp             EEECTTSEEEEEETTTTEEEEEEECCC---CCCCCEEEEEECSSTTEEEEEEEETTEEEEEEEETTTCCEEEEECBC---
T ss_pred             EEEeCCCcEEEEeecccccccccccccccccccceEEEcccccccceeeeecCCCCcceeeecccccceeeeeecccccc
Confidence            46788999999999988766544      46889999999999999999999886   48999998765443110     


Q ss_pred             -----ceeeeecCceeeEEEccCCCEEEEeccccCCccccCceEEEeecC
Q psy8803          67 -----DMKTFSWKYTQYSQFNESDTLLLVSGVHFGTPQSTSGEIAVFSLQ  111 (111)
Q Consensus        67 -----~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~i~iw~~~  111 (111)
                           ....+ -..+++++|+|++..+ +++       +.|++|++||++
T Consensus       279 ~~~~~~~~gH-~~~V~~l~fspd~~~l-~S~-------s~D~~v~vWd~~  319 (393)
T d1sq9a_         279 SQASLGEFAH-SSWVMSLSFNDSGETL-CSA-------GWDGKLRFWDVK  319 (393)
T ss_dssp             -----CCBSB-SSCEEEEEECSSSSEE-EEE-------ETTSEEEEEETT
T ss_pred             ccceeeeecc-cCceeeeccCCCCCee-EEE-------CCCCEEEEEECC
Confidence                 00111 1457889999998776 566       789999999974



>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure