Psyllid ID: psy8858
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| 340785619 | 121 | 30S ribosomal protein S13 [Collimonas fu | 1.0 | 1.0 | 0.785 | 7e-52 | |
| 134096299 | 121 | 30S ribosomal protein S13 [Herminiimonas | 1.0 | 1.0 | 0.776 | 8e-52 | |
| 152980690 | 121 | 30S ribosomal protein S13 [Janthinobacte | 1.0 | 1.0 | 0.768 | 9e-52 | |
| 399017011 | 121 | 30S ribosomal protein S13 [Herbaspirillu | 1.0 | 1.0 | 0.760 | 5e-51 | |
| 427399570 | 121 | 30S ribosomal protein S13 [Massilia timo | 1.0 | 1.0 | 0.760 | 8e-51 | |
| 445494445 | 121 | 30S ribosomal protein S13 [Janthinobacte | 1.0 | 1.0 | 0.760 | 3e-50 | |
| 300309479 | 121 | 30S ribosomal protein S13 [Herbaspirillu | 1.0 | 1.0 | 0.752 | 6e-50 | |
| 237747387 | 121 | 30S ribosomal subunit protein S13 [Oxalo | 1.0 | 1.0 | 0.760 | 1e-49 | |
| 237749537 | 121 | 30S ribosomal subunit protein S13 [Oxalo | 1.0 | 1.0 | 0.743 | 6e-49 | |
| 83748172 | 121 | SSU ribosomal protein S13P [Ralstonia so | 1.0 | 1.0 | 0.727 | 4e-48 |
| >gi|340785619|ref|YP_004751084.1| 30S ribosomal protein S13 [Collimonas fungivorans Ter331] gi|340550886|gb|AEK60261.1| SSU ribosomal protein S13p (S18e) [Collimonas fungivorans Ter331] | Back alignment and taxonomy information |
|---|
Score = 207 bits (527), Expect = 7e-52, Method: Compositional matrix adjust.
Identities = 95/121 (78%), Positives = 111/121 (91%)
Query: 1 MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI 60
M RI G+NIPN+QH +IGLTAIYG+GR RA++IC+ T I TTKKIKDL+DNELEKLR+EI
Sbjct: 1 MARIAGVNIPNHQHTVIGLTAIYGVGRPRAQEICDSTGILTTKKIKDLDDNELEKLRDEI 60
Query: 61 SKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLR 120
+KF++EGDLRRE SMNIKRL+DL CYRG+RHRK LPCRGQRTRTNARTRKGPR+AAQSL+
Sbjct: 61 AKFVVEGDLRRELSMNIKRLMDLGCYRGMRHRKGLPCRGQRTRTNARTRKGPRKAAQSLK 120
Query: 121 K 121
K
Sbjct: 121 K 121
|
Source: Collimonas fungivorans Ter331 Species: Collimonas fungivorans Genus: Collimonas Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|134096299|ref|YP_001101374.1| 30S ribosomal protein S13 [Herminiimonas arsenicoxydans] gi|158706238|sp|A4G9R6.1|RS13_HERAR RecName: Full=30S ribosomal protein S13 gi|133740202|emb|CAL63253.1| 30S ribosomal subunit protein S13 [Herminiimonas arsenicoxydans] | Back alignment and taxonomy information |
|---|
| >gi|152980690|ref|YP_001355078.1| 30S ribosomal protein S13 [Janthinobacterium sp. Marseille] gi|158706240|sp|A6T3I1.1|RS13_JANMA RecName: Full=30S ribosomal protein S13 gi|151280767|gb|ABR89177.1| small subunit ribosomal protein S13 [Janthinobacterium sp. Marseille] | Back alignment and taxonomy information |
|---|
| >gi|399017011|ref|ZP_10719212.1| 30S ribosomal protein S13 [Herbaspirillum sp. CF444] gi|398104341|gb|EJL94483.1| 30S ribosomal protein S13 [Herbaspirillum sp. CF444] | Back alignment and taxonomy information |
|---|
| >gi|427399570|ref|ZP_18890808.1| 30S ribosomal protein S13 [Massilia timonae CCUG 45783] gi|425721332|gb|EKU84245.1| 30S ribosomal protein S13 [Massilia timonae CCUG 45783] | Back alignment and taxonomy information |
|---|
| >gi|445494445|ref|ZP_21461489.1| 30S ribosomal protein S13 [Janthinobacterium sp. HH01] gi|444790606|gb|ELX12153.1| 30S ribosomal protein S13 [Janthinobacterium sp. HH01] | Back alignment and taxonomy information |
|---|
| >gi|300309479|ref|YP_003773571.1| 30S ribosomal protein S13 [Herbaspirillum seropedicae SmR1] gi|409408724|ref|ZP_11257159.1| 30S ribosomal protein S13 [Herbaspirillum sp. GW103] gi|415943234|ref|ZP_11556034.1| 30S ribosomal protein S13 [Herbaspirillum frisingense GSF30] gi|300072264|gb|ADJ61663.1| 30S ribosomal subunit S13 protein [Herbaspirillum seropedicae SmR1] gi|386432046|gb|EIJ44874.1| 30S ribosomal protein S13 [Herbaspirillum sp. GW103] gi|407758750|gb|EKF68534.1| 30S ribosomal protein S13 [Herbaspirillum frisingense GSF30] | Back alignment and taxonomy information |
|---|
| >gi|237747387|ref|ZP_04577867.1| 30S ribosomal subunit protein S13 [Oxalobacter formigenes HOxBLS] gi|229378738|gb|EEO28829.1| 30S ribosomal subunit protein S13 [Oxalobacter formigenes HOxBLS] | Back alignment and taxonomy information |
|---|
| >gi|237749537|ref|ZP_04580017.1| 30S ribosomal subunit protein S13 [Oxalobacter formigenes OXCC13] gi|229380899|gb|EEO30990.1| 30S ribosomal subunit protein S13 [Oxalobacter formigenes OXCC13] | Back alignment and taxonomy information |
|---|
| >gi|83748172|ref|ZP_00945199.1| SSU ribosomal protein S13P [Ralstonia solanacearum UW551] gi|207744553|ref|YP_002260945.1| 30s ribosomal protein s13 [Ralstonia solanacearum IPO1609] gi|300702803|ref|YP_003744404.1| 30S ribosomal protein S13 [Ralstonia solanacearum CFBP2957] gi|386332170|ref|YP_006028339.1| 30S ribosomal protein S13 [Ralstonia solanacearum Po82] gi|421890471|ref|ZP_16321330.1| 30S ribosomal subunit protein S13 [Ralstonia solanacearum K60-1] gi|421895877|ref|ZP_16326276.1| 30s ribosomal protein s13 [Ralstonia solanacearum MolK2] gi|83725140|gb|EAP72291.1| SSU ribosomal protein S13P [Ralstonia solanacearum UW551] gi|206587042|emb|CAQ17626.1| 30s ribosomal protein s13 [Ralstonia solanacearum MolK2] gi|206595959|emb|CAQ62886.1| 30s ribosomal protein s13 [Ralstonia solanacearum IPO1609] gi|299070465|emb|CBJ41760.1| 30S ribosomal subunit protein S13 [Ralstonia solanacearum CFBP2957] gi|334194618|gb|AEG67803.1| 30S ribosomal protein S13 [Ralstonia solanacearum Po82] gi|378964182|emb|CCF98078.1| 30S ribosomal subunit protein S13 [Ralstonia solanacearum K60-1] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| TIGR_CMR|SO_0253 | 118 | SO_0253 "ribosomal protein S13 | 0.942 | 0.966 | 0.657 | 1.4e-39 | |
| TIGR_CMR|CPS_0623 | 118 | CPS_0623 "ribosomal protein S1 | 0.942 | 0.966 | 0.649 | 1.9e-37 | |
| UNIPROTKB|A6UZL0 | 118 | rpsM "30S ribosomal protein S1 | 0.942 | 0.966 | 0.614 | 3.9e-37 | |
| UNIPROTKB|P0A7S9 | 118 | rpsM [Escherichia coli K-12 (t | 0.942 | 0.966 | 0.587 | 1.2e-35 | |
| UNIPROTKB|Q9KP05 | 118 | rpsM "30S ribosomal protein S1 | 0.942 | 0.966 | 0.605 | 2.4e-35 | |
| TIGR_CMR|VC_2574 | 118 | VC_2574 "ribosomal protein S13 | 0.942 | 0.966 | 0.605 | 2.4e-35 | |
| TIGR_CMR|CHY_2284 | 123 | CHY_2284 "ribosomal protein S1 | 1.0 | 0.983 | 0.573 | 6.7e-33 | |
| TIGR_CMR|CBU_0260 | 119 | CBU_0260 "ribosomal protein S1 | 0.958 | 0.974 | 0.603 | 8.5e-33 | |
| TIGR_CMR|SPO_0509 | 122 | SPO_0509 "ribosomal protein S1 | 1.0 | 0.991 | 0.549 | 4.7e-32 | |
| UNIPROTKB|O66486 | 126 | rpsM "30S ribosomal protein S1 | 1.0 | 0.960 | 0.540 | 2e-31 |
| TIGR_CMR|SO_0253 SO_0253 "ribosomal protein S13" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
Score = 422 (153.6 bits), Expect = 1.4e-39, P = 1.4e-39
Identities = 75/114 (65%), Positives = 98/114 (85%)
Query: 1 MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI 60
M RI GINIP+ +H +I LTAI+GIGR+RA+ IC T I+ T KIK+L++ +++ LREE+
Sbjct: 1 MARIAGINIPDQKHTVIALTAIFGIGRTRARAICAATSIAETAKIKELSEAQIDTLREEV 60
Query: 61 SKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRR 114
+K+++EGDLRRE SMNIKRL+DL CYRG+RHR+SLP RGQRT+TNARTRKGPR+
Sbjct: 61 AKYLVEGDLRREISMNIKRLMDLGCYRGLRHRRSLPLRGQRTKTNARTRKGPRK 114
|
|
| TIGR_CMR|CPS_0623 CPS_0623 "ribosomal protein S13" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6UZL0 rpsM "30S ribosomal protein S13" [Pseudomonas aeruginosa PA7 (taxid:381754)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A7S9 rpsM [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KP05 rpsM "30S ribosomal protein S13" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2574 VC_2574 "ribosomal protein S13" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_2284 CHY_2284 "ribosomal protein S13" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0260 CBU_0260 "ribosomal protein S13/S18" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0509 SPO_0509 "ribosomal protein S13" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O66486 rpsM "30S ribosomal protein S13" [Aquifex aeolicus VF5 (taxid:224324)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 121 | |||
| PRK05179 | 122 | PRK05179, rpsM, 30S ribosomal protein S13; Validat | 2e-66 | |
| TIGR03631 | 113 | TIGR03631, bact_S13, 30S ribosomal protein S13 | 2e-60 | |
| COG0099 | 121 | COG0099, RpsM, Ribosomal protein S13 [Translation, | 4e-52 | |
| CHL00137 | 122 | CHL00137, rps13, ribosomal protein S13; Validated | 2e-41 | |
| pfam00416 | 106 | pfam00416, Ribosomal_S13, Ribosomal protein S13/S1 | 9e-37 | |
| PRK04053 | 149 | PRK04053, rps13p, 30S ribosomal protein S13P; Revi | 2e-20 | |
| TIGR03629 | 144 | TIGR03629, arch_S13P, archaeal ribosomal protein S | 1e-19 | |
| PTZ00134 | 154 | PTZ00134, PTZ00134, 40S ribosomal protein S18; Pro | 3e-09 |
| >gnl|CDD|235358 PRK05179, rpsM, 30S ribosomal protein S13; Validated | Back alignment and domain information |
|---|
Score = 196 bits (500), Expect = 2e-66
Identities = 73/122 (59%), Positives = 93/122 (76%), Gaps = 1/122 (0%)
Query: 1 MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI 60
M RI G++IP N+ ++I LT IYGIGR+RAK+I I ++KDL D EL+K+REEI
Sbjct: 1 MARIAGVDIPRNKRVVIALTYIYGIGRTRAKEILAAAGIDPDTRVKDLTDEELDKIREEI 60
Query: 61 SK-FIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSL 119
K + +EGDLRRE SMNIKRL+D+ CYRG+RHR+ LP RGQRT+TNARTRKGPR+
Sbjct: 61 DKNYKVEGDLRREVSMNIKRLMDIGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKTIAGK 120
Query: 120 RK 121
+K
Sbjct: 121 KK 122
|
Length = 122 |
| >gnl|CDD|213840 TIGR03631, bact_S13, 30S ribosomal protein S13 | Back alignment and domain information |
|---|
| >gnl|CDD|223177 COG0099, RpsM, Ribosomal protein S13 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|177059 CHL00137, rps13, ribosomal protein S13; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|144128 pfam00416, Ribosomal_S13, Ribosomal protein S13/S18 | Back alignment and domain information |
|---|
| >gnl|CDD|235215 PRK04053, rps13p, 30S ribosomal protein S13P; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213839 TIGR03629, arch_S13P, archaeal ribosomal protein S13P | Back alignment and domain information |
|---|
| >gnl|CDD|185469 PTZ00134, PTZ00134, 40S ribosomal protein S18; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| CHL00137 | 122 | rps13 ribosomal protein S13; Validated | 100.0 | |
| COG0099 | 121 | RpsM Ribosomal protein S13 [Translation, ribosomal | 100.0 | |
| PRK05179 | 122 | rpsM 30S ribosomal protein S13; Validated | 100.0 | |
| TIGR03631 | 113 | bact_S13 30S ribosomal protein S13. This model des | 100.0 | |
| TIGR03629 | 144 | arch_S13P archaeal ribosomal protein S13P. This mo | 100.0 | |
| PRK04053 | 149 | rps13p 30S ribosomal protein S13P; Reviewed | 100.0 | |
| PF00416 | 107 | Ribosomal_S13: Ribosomal protein S13/S18; InterPro | 100.0 | |
| PTZ00134 | 154 | 40S ribosomal protein S18; Provisional | 100.0 | |
| KOG3311|consensus | 152 | 100.0 | ||
| PF06831 | 92 | H2TH: Formamidopyrimidine-DNA glycosylase H2TH dom | 97.71 | |
| PRK01103 | 274 | formamidopyrimidine/5-formyluracil/ 5-hydroxymethy | 97.35 | |
| PRK04184 | 535 | DNA topoisomerase VI subunit B; Validated | 97.32 | |
| PRK14810 | 272 | formamidopyrimidine-DNA glycosylase; Provisional | 97.02 | |
| PRK14811 | 269 | formamidopyrimidine-DNA glycosylase; Provisional | 96.93 | |
| PRK10445 | 263 | endonuclease VIII; Provisional | 96.9 | |
| PRK13945 | 282 | formamidopyrimidine-DNA glycosylase; Provisional | 96.82 | |
| TIGR00577 | 272 | fpg formamidopyrimidine-DNA glycosylase (fpg). All | 96.8 | |
| TIGR01052 | 488 | top6b DNA topoisomerase VI, B subunit. This model | 96.66 | |
| COG1389 | 538 | DNA topoisomerase VI, subunit B [DNA replication, | 96.06 | |
| COG0266 | 273 | Nei Formamidopyrimidine-DNA glycosylase [DNA repli | 95.49 | |
| PF05833 | 455 | FbpA: Fibronectin-binding protein A N-terminus (Fb | 95.26 | |
| PF00633 | 30 | HHH: Helix-hairpin-helix motif; InterPro: IPR00044 | 94.94 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 93.39 | |
| KOG3311|consensus | 152 | 93.32 | ||
| PF11798 | 32 | IMS_HHH: IMS family HHH motif; InterPro: IPR024728 | 92.63 | |
| PF10391 | 52 | DNA_pol_lambd_f: Fingers domain of DNA polymerase | 91.53 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 91.29 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 91.19 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 90.98 | |
| smart00278 | 26 | HhH1 Helix-hairpin-helix DNA-binding motif class 1 | 90.09 | |
| PRK02515 | 132 | psbU photosystem II complex extrinsic protein prec | 90.02 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 89.23 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 87.57 | |
| PRK14606 | 188 | ruvA Holliday junction DNA helicase RuvA; Provisio | 87.18 | |
| COG3743 | 133 | Uncharacterized conserved protein [Function unknow | 86.48 | |
| PRK14601 | 183 | ruvA Holliday junction DNA helicase RuvA; Provisio | 86.45 | |
| PRK13844 | 200 | recombination protein RecR; Provisional | 85.69 | |
| PRK14603 | 197 | ruvA Holliday junction DNA helicase RuvA; Provisio | 85.67 | |
| TIGR00615 | 195 | recR recombination protein RecR. This family is ba | 85.52 | |
| PRK14604 | 195 | ruvA Holliday junction DNA helicase RuvA; Provisio | 85.47 | |
| PRK13901 | 196 | ruvA Holliday junction DNA helicase RuvA; Provisio | 85.18 | |
| TIGR03252 | 177 | uncharacterized HhH-GPD family protein. This model | 84.74 | |
| PRK14602 | 203 | ruvA Holliday junction DNA helicase RuvA; Provisio | 84.54 | |
| PRK00076 | 196 | recR recombination protein RecR; Reviewed | 84.51 | |
| PF09883 | 225 | DUF2110: Uncharacterized protein conserved in arch | 84.5 | |
| COG0632 | 201 | RuvA Holliday junction resolvasome, DNA-binding su | 84.41 | |
| COG0353 | 198 | RecR Recombinational DNA repair protein (RecF path | 84.15 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 83.94 | |
| PF14579 | 90 | HHH_6: Helix-hairpin-helix motif; PDB: 2HPM_A 2HPI | 83.82 | |
| COG1293 | 564 | Predicted RNA-binding protein homologous to eukary | 83.6 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 80.88 | |
| PRK14605 | 194 | ruvA Holliday junction DNA helicase RuvA; Provisio | 80.39 | |
| PRK14605 | 194 | ruvA Holliday junction DNA helicase RuvA; Provisio | 80.36 | |
| PRK14600 | 186 | ruvA Holliday junction DNA helicase RuvA; Provisio | 80.04 |
| >CHL00137 rps13 ribosomal protein S13; Validated | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.9e-55 Score=307.78 Aligned_cols=121 Identities=51% Similarity=0.852 Sum_probs=118.1
Q ss_pred CceeeCccCCCCeeeeeehhcccccCHHHHHHHHHHhCCCCCcccCCCCHHHHHHHHHHH-hhcccchhhHHHHHHHHHH
Q psy8858 1 MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI-SKFIIEGDLRREFSMNIKR 79 (121)
Q Consensus 1 mv~i~~~~~~~~k~v~~aLt~I~GIG~~~A~~Ic~~lGi~p~~~~~~Ls~~qi~~L~~~l-~~~~i~~~L~~~~~~~I~r 79 (121)
||||+|+|||++|+|.+||++|||||+++|.+||+.+||||++++++|+++|+++|.++| ++|.+|+||++.+++||+|
T Consensus 1 mvrI~~~~i~~~k~v~~aLt~i~GIG~~~A~~ic~~lgi~~~~~~~~Lt~~qi~~l~~~i~~~~~i~~dL~~~~~~dI~r 80 (122)
T CHL00137 1 MVRIAGVDLPRNKRIEYALTYIYGIGLTSAKEILEKANIDPDIRTKDLTDEQISALREIIEENYQVEGDLRRFESLNIKR 80 (122)
T ss_pred CceEcCccCCCCCEeeeeecccccccHHHHHHHHHHcCcCcCcCcccCCHHHHHHHHHHHHHhCcchHHHHHHHHHHHHH
Confidence 899999999999999999999999999999999999999999999999999999999999 5799999999999999999
Q ss_pred HHhhccccccccCCCCCcCCccccccccccCCCCcccccccC
Q psy8858 80 LIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLRK 121 (121)
Q Consensus 80 l~~i~~yRG~RH~~gLpVRGQRT~tNart~k~~~~~~~~~~~ 121 (121)
|++|+||||+||.+|||||||||||||||+|+++++++++++
T Consensus 81 l~~I~sYRG~RH~~gLPVRGQRT~tNarT~k~~~~~~~~kk~ 122 (122)
T CHL00137 81 LMEINCYRGRRHRLGLPVRGQRTRTNARTRRGAKKTVAGKKK 122 (122)
T ss_pred HHHhCchhcccccCCCCCCCCcCCccccccCCCcccccccCC
Confidence 999999999999999999999999999999999999997664
|
|
| >COG0099 RpsM Ribosomal protein S13 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05179 rpsM 30S ribosomal protein S13; Validated | Back alignment and domain information |
|---|
| >TIGR03631 bact_S13 30S ribosomal protein S13 | Back alignment and domain information |
|---|
| >TIGR03629 arch_S13P archaeal ribosomal protein S13P | Back alignment and domain information |
|---|
| >PRK04053 rps13p 30S ribosomal protein S13P; Reviewed | Back alignment and domain information |
|---|
| >PF00416 Ribosomal_S13: Ribosomal protein S13/S18; InterPro: IPR001892 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PTZ00134 40S ribosomal protein S18; Provisional | Back alignment and domain information |
|---|
| >KOG3311|consensus | Back alignment and domain information |
|---|
| >PF06831 H2TH: Formamidopyrimidine-DNA glycosylase H2TH domain; InterPro: IPR015886 This entry represents a helix-2turn-helix DNA-binding domain found in DNA glycosylase/AP lyase enzymes, which are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents | Back alignment and domain information |
|---|
| >PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated | Back alignment and domain information |
|---|
| >PRK04184 DNA topoisomerase VI subunit B; Validated | Back alignment and domain information |
|---|
| >PRK14810 formamidopyrimidine-DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >PRK14811 formamidopyrimidine-DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >PRK10445 endonuclease VIII; Provisional | Back alignment and domain information |
|---|
| >PRK13945 formamidopyrimidine-DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg) | Back alignment and domain information |
|---|
| >TIGR01052 top6b DNA topoisomerase VI, B subunit | Back alignment and domain information |
|---|
| >COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05833 FbpA: Fibronectin-binding protein A N-terminus (FbpA); InterPro: IPR008616 This family consists of the N-terminal region of the prokaryotic fibronectin-binding protein, the C-terminal region is IPR008532 from INTERPRO | Back alignment and domain information |
|---|
| >PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >KOG3311|consensus | Back alignment and domain information |
|---|
| >PF11798 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases [] | Back alignment and domain information |
|---|
| >PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >smart00278 HhH1 Helix-hairpin-helix DNA-binding motif class 1 | Back alignment and domain information |
|---|
| >PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >COG3743 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK13844 recombination protein RecR; Provisional | Back alignment and domain information |
|---|
| >PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >TIGR00615 recR recombination protein RecR | Back alignment and domain information |
|---|
| >PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >TIGR03252 uncharacterized HhH-GPD family protein | Back alignment and domain information |
|---|
| >PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK00076 recR recombination protein RecR; Reviewed | Back alignment and domain information |
|---|
| >PF09883 DUF2110: Uncharacterized protein conserved in archaea (DUF2110); InterPro: IPR016757 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0353 RecR Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >PF14579 HHH_6: Helix-hairpin-helix motif; PDB: 2HPM_A 2HPI_A 3E0D_A 3F2C_A 3F2B_A 3F2D_A 2HQA_A 2HNH_A | Back alignment and domain information |
|---|
| >COG1293 Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 121 | ||||
| 1vs5_M | 118 | Crystal Structure Of The Bacterial Ribosome From Es | 2e-39 | ||
| 3fih_M | 113 | Ternary Complex-Bound E.Coli 70s Ribosome. This Ent | 1e-38 | ||
| 3ofo_M | 114 | Crystal Structure Of The E. Coli Ribosome Bound To | 1e-38 | ||
| 2gy9_M | 115 | Structure Of The 30s Subunit Of A Pre-Translocation | 1e-38 | ||
| 1p6g_M | 117 | Real Space Refined Coordinates Of The 30s Subunit F | 1e-38 | ||
| 1fjg_M | 126 | Structure Of The Thermus Thermophilus 30s Ribosomal | 4e-33 | ||
| 1i94_M | 125 | Crystal Structures Of The Small Ribosomal Subunit W | 2e-32 | ||
| 3mr8_M | 117 | Recognition Of The Amber Stop Codon By Release Fact | 4e-32 | ||
| 3pyn_M | 116 | Crystal Structure Of A Complex Containing Domain 3 | 4e-32 | ||
| 3bbn_M | 145 | Homology Model For The Spinach Chloroplast 30s Subu | 2e-14 | ||
| 3j20_O | 148 | Promiscuous Behavior Of Proteins In Archaeal Riboso | 9e-11 | ||
| 1s1h_M | 132 | Structure Of The Ribosomal 80s-Eef2-Sordarin Comple | 3e-06 | ||
| 3izb_M | 146 | Localization Of The Small Subunit Ribosomal Protein | 3e-06 | ||
| 3jyv_M | 130 | Structure Of The 40s Rrna And Proteins And PE TRNA | 3e-06 | ||
| 2zkq_m | 152 | Structure Of A Mammalian Ribosomal 40s Subunit With | 7e-06 | ||
| 3iz6_M | 152 | Localization Of The Small Subunit Ribosomal Protein | 9e-06 | ||
| 2xzm_M | 155 | Crystal Structure Of The Eukaryotic 40s Ribosomal S | 2e-05 | ||
| 3zey_M | 153 | High-resolution Cryo-electron Microscopy Structure | 2e-04 |
| >pdb|1VS5|M Chain M, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 118 | Back alignment and structure |
|
| >pdb|3FIH|M Chain M, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 113 | Back alignment and structure |
| >pdb|3OFO|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To Erythromycin. This File Contains The 30s Subunit Of The First 70s Ribosome. Length = 114 | Back alignment and structure |
| >pdb|2GY9|M Chain M, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 115 | Back alignment and structure |
| >pdb|1P6G|M Chain M, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 117 | Back alignment and structure |
| >pdb|1FJG|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 126 | Back alignment and structure |
| >pdb|1I94|M Chain M, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 125 | Back alignment and structure |
| >pdb|3MR8|M Chain M, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mr8 Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 3ms1. Molecule B In The Same Asymmetric Unit Is Deposited As 3mrz (50s) And 3ms0 (30s). Length = 117 | Back alignment and structure |
| >pdb|3PYN|M Chain M, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 30s Subunit Of The First 70s Ribosome. Length = 116 | Back alignment and structure |
| >pdb|3BBN|M Chain M, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 145 | Back alignment and structure |
| >pdb|3J20|O Chain O, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (30s Ribosomal Subunit) Length = 148 | Back alignment and structure |
| >pdb|1S1H|M Chain M, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 132 | Back alignment and structure |
| >pdb|3IZB|M Chain M, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 146 | Back alignment and structure |
| >pdb|3JYV|M Chain M, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 130 | Back alignment and structure |
| >pdb|2ZKQ|MM Chain m, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 152 | Back alignment and structure |
| >pdb|3IZ6|M Chain M, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 152 | Back alignment and structure |
| >pdb|2XZM|M Chain M, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 155 | Back alignment and structure |
| >pdb|3ZEY|M Chain M, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 153 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 121 | |||
| 3r8n_M | 114 | 30S ribosomal protein S13; protein biosynthesis, R | 6e-65 | |
| 2vqe_M | 126 | 30S ribosomal protein S13, 30S ribosomal protein S | 1e-63 | |
| 3bbn_M | 145 | Ribosomal protein S13; small ribosomal subunit, sp | 5e-53 | |
| 3u5c_S | 146 | 40S ribosomal protein S18-A, 40S ribosomal protein | 4e-47 | |
| 3iz6_M | 152 | 40S ribosomal protein S18 (S13P); eukaryotic ribos | 6e-45 | |
| 2xzm_M | 155 | RPS18E; ribosome, translation; 3.93A {Tetrahymena | 1e-43 |
| >2vqe_M 30S ribosomal protein S13, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.156.1.1 PDB: 1gix_P* 1hnw_M* 1hnx_M* 1hnz_M* 1hr0_M 1ibk_M* 1ibl_M* 1ibm_M 1j5e_M 1jgo_P* 1jgp_P* 1jgq_P* 1mj1_P* 1ml5_P* 1n32_M* 1n33_M* 1n34_M 1n36_M 1xmo_M* 1xmq_M* ... Length = 126 | Back alignment and structure |
|---|
| >3bbn_M Ribosomal protein S13; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 145 | Back alignment and structure |
|---|
| >3u5c_S 40S ribosomal protein S18-A, 40S ribosomal protein S17-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_M 3o30_L 3o2z_L 3u5g_S 1s1h_M 3jyv_M* 2zkq_m Length = 146 | Back alignment and structure |
|---|
| >3iz6_M 40S ribosomal protein S18 (S13P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 152 | Back alignment and structure |
|---|
| >2xzm_M RPS18E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_M Length = 155 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| 2vqe_M | 126 | 30S ribosomal protein S13, 30S ribosomal protein S | 100.0 | |
| 3r8n_M | 114 | 30S ribosomal protein S13; protein biosynthesis, R | 100.0 | |
| 2xzm_M | 155 | RPS18E; ribosome, translation; 3.93A {Tetrahymena | 100.0 | |
| 3j20_O | 148 | 30S ribosomal protein S13P; archaea, archaeal, KIN | 100.0 | |
| 3iz6_M | 152 | 40S ribosomal protein S18 (S13P); eukaryotic ribos | 100.0 | |
| 3u5c_S | 146 | 40S ribosomal protein S18-A, 40S ribosomal protein | 100.0 | |
| 3bbn_M | 145 | Ribosomal protein S13; small ribosomal subunit, sp | 100.0 | |
| 1mu5_A | 471 | Type II DNA topoisomerase VI subunit B; GHKL ATPas | 96.86 | |
| 1k3x_A | 262 | Endonuclease VIII; hydrolase/DNA, hydrolase-DNA co | 96.73 | |
| 1ee8_A | 266 | MUTM (FPG) protein; beta sandwich, zinc finger, he | 96.72 | |
| 1k82_A | 268 | Formamidopyrimidine-DNA glycosylase; protein-DNA c | 96.71 | |
| 2xzf_A | 271 | Formamidopyrimidine-DNA glycosylase; hydrolase-DNA | 96.7 | |
| 3u6p_A | 273 | Formamidopyrimidine-DNA glycosylase; DNA glycosyla | 96.69 | |
| 3w0f_A | 287 | Endonuclease 8-like 3; helix two turns helix, zinc | 96.63 | |
| 3twl_A | 310 | Formamidopyrimidine-DNA glycosylase 1; helix two t | 96.56 | |
| 3vk8_A | 295 | Probable formamidopyrimidine-DNA glycosylase; DNA | 96.53 | |
| 2zbk_B | 530 | Type 2 DNA topoisomerase 6 subunit B; DNA binding | 94.29 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 92.92 | |
| 2a1j_A | 63 | DNA repair endonuclease XPF; XPF, xeroderma pigmen | 92.88 | |
| 1tdh_A | 364 | NEI endonuclease VIII-like 1; helix two turns heli | 92.32 | |
| 1kft_A | 78 | UVRC, excinuclease ABC subunit C; helix-hairpin-he | 92.22 | |
| 3arc_U | 97 | Photosystem II 12 kDa extrinsic protein; PSII, mem | 91.42 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 91.23 | |
| 1s5l_U | 134 | Photosystem II 12 kDa extrinsic protein; photosynt | 89.24 | |
| 1z00_B | 84 | DNA repair endonuclease XPF; helix-hairpin-helix, | 89.23 | |
| 1z00_A | 89 | DNA excision repair protein ERCC-1; helix-hairpin- | 87.7 | |
| 2a1j_B | 91 | DNA excision repair protein ERCC-1; XPF, xeroderma | 87.44 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 86.44 | |
| 3fhf_A | 214 | Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel | 86.29 | |
| 2duy_A | 75 | Competence protein comea-related protein; helix-ha | 86.08 | |
| 3fhg_A | 207 | Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel | 86.03 | |
| 1x2i_A | 75 | HEF helicase/nuclease; alpha helix, helix-hairpin- | 85.8 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 85.77 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 83.85 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 81.41 | |
| 3vdp_A | 212 | Recombination protein RECR; zinc finger, DNA repai | 81.1 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 80.76 | |
| 2edu_A | 98 | Kinesin-like protein KIF22; kinesin-like DNA bindi | 80.16 | |
| 3n0u_A | 219 | Probable N-glycosylase/DNA lyase; structural genom | 80.07 |
| >2vqe_M 30S ribosomal protein S13, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.156.1.1 PDB: 1gix_P* 1hnw_M* 1hnx_M* 1hnz_M* 1hr0_M 1ibk_M* 1ibl_M* 1ibm_M 1j5e_M 1jgo_P* 1jgp_P* 1jgq_P* 1mj1_P* 1ml5_P* 1n32_M* 1n33_M* 1n34_M 1n36_M 1xmo_M* 1xmq_M* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-56 Score=314.79 Aligned_cols=121 Identities=53% Similarity=0.934 Sum_probs=117.6
Q ss_pred CceeeCccCCCCeeeeeehhcccccCHHHHHHHHHHhCCCCCcccCCCCHHHHHHHHHHHh-hcccchhhHHHHHHHHHH
Q psy8858 1 MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEIS-KFIIEGDLRREFSMNIKR 79 (121)
Q Consensus 1 mv~i~~~~~~~~k~v~~aLt~I~GIG~~~A~~Ic~~lGi~p~~~~~~Ls~~qi~~L~~~l~-~~~i~~~L~~~~~~~I~r 79 (121)
|+||+|+|||++|.|++||++|||||+++|..||+.+||||++++++||++|+++|.++|+ +|.+|+||++++++||+|
T Consensus 1 m~rI~g~~i~~~k~v~~aLt~I~GIG~~~A~~I~~~~gi~~~~r~~~Lt~~ei~~l~~~i~~~~~ve~dLrr~~~~nIkR 80 (126)
T 2vqe_M 1 MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKR 80 (126)
T ss_dssp -CCCSTTCCCCSSBHHHHHTTSSSCCSHHHHHHTTTTTCCTTSBGGGCCHHHHHHHHHHHHTTSCCHHHHHHHHHHHHHH
T ss_pred CceEeCccCCCCcEeeeehhccccccHHHHHHHHHHcCCCcccccCcCCHHHHHHHHHHHHHhCcchhHHHHHHHHHHHH
Confidence 8999999999999999999999999999999999999999999999999999999999996 699999999999999999
Q ss_pred HHhhccccccccCCCCCcCCccccccccccCCCCcccccccC
Q psy8858 80 LIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLRK 121 (121)
Q Consensus 80 l~~i~~yRG~RH~~gLpVRGQRT~tNart~k~~~~~~~~~~~ 121 (121)
|++|+||||+||.+|||||||||||||||+|+++++|+++||
T Consensus 81 L~~I~~YRG~RH~~GLPVRGQRTkTNaRTrkg~~~~v~~kkk 122 (126)
T 2vqe_M 81 LMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKK 122 (126)
T ss_dssp HHHTTCHHHHHHHTTCCSSSCCCSSCCHHHHCSCCCCCCCCS
T ss_pred HHHHHHHhhhhhccCCcCCCccCccccccCCCcccccccccC
Confidence 999999999999999999999999999999999999998775
|
| >2xzm_M RPS18E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_M | Back alignment and structure |
|---|
| >3j20_O 30S ribosomal protein S13P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3iz6_M 40S ribosomal protein S18 (S13P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3u5c_S 40S ribosomal protein S18-A, 40S ribosomal protein S17-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_M 3o30_L 3o2z_L 3u5g_S 1s1h_M 3jyv_M* 2zkq_m | Back alignment and structure |
|---|
| >3bbn_M Ribosomal protein S13; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} | Back alignment and structure |
|---|
| >1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* | Back alignment and structure |
|---|
| >1k3x_A Endonuclease VIII; hydrolase/DNA, hydrolase-DNA complex; HET: BRU PED; 1.25A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 PDB: 1k3w_A* 1q39_A 2ea0_A* 2oq4_A* 1q3c_A 2opf_A* 1q3b_A* | Back alignment and structure |
|---|
| >1ee8_A MUTM (FPG) protein; beta sandwich, zinc finger, helix two-turns helix, riken STR genomics/proteomics initiative, RSGI, structural genomics; 1.90A {Thermus thermophilus} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 | Back alignment and structure |
|---|
| >1k82_A Formamidopyrimidine-DNA glycosylase; protein-DNA complex, DNA repair, beta sandwich, zinc finger, helix two-turns helix, hydrolase/DNA complex; HET: PED; 2.10A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 | Back alignment and structure |
|---|
| >2xzf_A Formamidopyrimidine-DNA glycosylase; hydrolase-DNA complex; HET: VET; 1.80A {Lactococcus lactis subsp} PDB: 1pm5_A* 1xc8_A* 1pji_A* 2xzu_A* 3c58_A* 1tdz_A* 1nnj_A 1kfv_A 1pjj_A* | Back alignment and structure |
|---|
| >3u6p_A Formamidopyrimidine-DNA glycosylase; DNA glycosylase, DNA repair, sequence context; HET: DNA 08Q; 1.60A {Geobacillus stearothermophilus} PDB: 3u6d_A* 3u6c_A* 3u6l_A* 3u6m_A* 3u6o_A* 3u6e_A* 3u6q_A* 3u6s_A* 3gp1_A* 3sbj_A* 2f5q_A* 2f5s_A* 3gq4_A* 3gpy_A* 2f5n_A 2f5o_A 2f5p_A 3sau_A* 3sar_A* 3sav_A* ... | Back alignment and structure |
|---|
| >3w0f_A Endonuclease 8-like 3; helix two turns helix, zinc finger, DNA binding, hydrolase; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3twl_A Formamidopyrimidine-DNA glycosylase 1; helix two turns helix, zinc-LESS finger, hydrolase, DNA DAMA repair, DNA-binding, glycosidase, lyase; 1.70A {Arabidopsis thaliana} PDB: 3twm_A* 3twk_A | Back alignment and structure |
|---|
| >3vk8_A Probable formamidopyrimidine-DNA glycosylase; DNA glycosylase, hneil1 ortholog, DNA lesion, thymine glycol zincless finger; HET: DNA CTG; 2.00A {Acanthamoeba polyphaga mimivirus} PDB: 3vk7_A* 3a42_A 3a46_A* 3a45_A* | Back alignment and structure |
|---|
| >2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* | Back alignment and structure |
|---|
| >1tdh_A NEI endonuclease VIII-like 1; helix two turns helix, zinc-LESS finger, hydrolase; 2.10A {Homo sapiens} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 | Back alignment and structure |
|---|
| >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 | Back alignment and structure |
|---|
| >3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* | Back alignment and structure |
|---|
| >1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase; 2.00A {Methanocaldococcus jannaschii} PDB: 3knt_A* | Back alignment and structure |
|---|
| >2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3vdp_A Recombination protein RECR; zinc finger, DNA repair, DNA binding; 2.45A {Thermoanaerobacter tengcongensis} PDB: 3vdu_A 3ve5_D | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >3n0u_A Probable N-glycosylase/DNA lyase; structural genomics, ISFI, DNA repair, 8-oxoguanine, base EX repair, PSI-2, protein structure initiative; 1.50A {Thermotoga maritima} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 121 | ||||
| d2gy9m1 | 114 | a.156.1.1 (M:1-114) Ribosomal protein S13 {Escheri | 6e-44 | |
| d2uubm1 | 125 | a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus | 4e-40 | |
| d2hkja1 | 78 | a.156.1.3 (A:229-306) Topoisomerase VI-B subunit m | 0.003 |
| >d2gy9m1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} Length = 114 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: S13-like H2TH domain superfamily: S13-like H2TH domain family: Ribosomal protein S13 domain: Ribosomal protein S13 species: Escherichia coli [TaxId: 562]
Score = 137 bits (346), Expect = 6e-44
Identities = 66/112 (58%), Positives = 93/112 (83%)
Query: 3 RIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEISK 62
RI GINIP+++H +I LT+IYG+G++R+K I I+ KI +L++ +++ LR+E++K
Sbjct: 2 RIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAK 61
Query: 63 FIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRR 114
F++EGDLRRE SM+IKRL+DL CYRG+RHR+ LP RGQRT+TNARTRKGPR+
Sbjct: 62 FVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRK 113
|
| >d2uubm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} Length = 125 | Back information, alignment and structure |
|---|
| >d2hkja1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| d2uubm1 | 125 | Ribosomal protein S13 {Thermus thermophilus [TaxId | 100.0 | |
| d2gy9m1 | 114 | Ribosomal protein S13 {Escherichia coli [TaxId: 56 | 100.0 | |
| d2hkja1 | 78 | Topoisomerase VI-B subunit middle domain {Archaeon | 98.63 | |
| d1k3xa1 | 89 | Endonuclease VIII {Escherichia coli [TaxId: 562]} | 97.95 | |
| d1r2za1 | 94 | DNA repair protein MutM (Fpg) {Bacillus stearother | 97.85 | |
| d1ee8a1 | 89 | DNA repair protein MutM (Fpg) {Thermus thermophilu | 97.85 | |
| d1k82a1 | 88 | DNA repair protein MutM (Fpg) {Escherichia coli [T | 97.85 | |
| d1tdza1 | 88 | DNA repair protein MutM (Fpg) {Lactococcus lactis | 97.82 | |
| d2bgwa1 | 70 | DNA repair endonuclease XPF {Aeropyrum pernix [Tax | 95.47 | |
| d1pzna1 | 61 | DNA repair protein Rad51, N-terminal domain {Archa | 95.43 | |
| d2i0za2 | 169 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 95.41 | |
| d2fmpa2 | 57 | DNA polymerase beta {Human (Homo sapiens) [TaxId: | 95.38 | |
| d2bcqa2 | 57 | DNA polymerase lambda {Human (Homo sapiens) [TaxId | 95.34 | |
| d1tdha1 | 115 | Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapi | 95.34 | |
| d2i1qa1 | 60 | DNA repair protein Rad51, N-terminal domain {Archa | 95.08 | |
| d1jmsa3 | 60 | Terminal deoxynucleotidyl transferase {Mouse (Mus | 95.01 | |
| d2axtu1 | 98 | Photosystem II 12 kDa extrinsic protein PsbU {Ther | 93.83 | |
| d2gqfa2 | 148 | Hypothetical protein HI0933 {Haemophilus influenza | 93.83 | |
| d1bvsa2 | 71 | DNA helicase RuvA subunit, middle domain {Mycobact | 93.14 | |
| d1ixra1 | 73 | DNA helicase RuvA subunit, middle domain {Thermus | 92.99 | |
| d2a1ja1 | 62 | DNA repair endonuclease XPF {Human (Homo sapiens) | 92.9 | |
| d1kfta_ | 56 | Excinuclease UvrC C-terminal domain {Escherichia c | 92.78 | |
| d2a1jb1 | 78 | DNA excision repair protein ERCC-1 {Human (Homo sa | 92.21 | |
| d1cuka2 | 78 | DNA helicase RuvA subunit, middle domain {Escheric | 92.14 | |
| d1x2ia1 | 68 | ATP-dependent RNA helicase PF2015 {Pyrococcus furi | 90.5 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 89.57 | |
| d1vdda_ | 199 | Recombination protein RecR {Deinococcus radioduran | 87.78 | |
| d1bvsa2 | 71 | DNA helicase RuvA subunit, middle domain {Mycobact | 86.14 | |
| d1ixra1 | 73 | DNA helicase RuvA subunit, middle domain {Thermus | 83.93 | |
| d1cuka2 | 78 | DNA helicase RuvA subunit, middle domain {Escheric | 83.93 | |
| d2duya1 | 65 | Uncharacterized protein TTHA1967 {Thermus thermoph | 81.54 |
| >d2uubm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: S13-like H2TH domain superfamily: S13-like H2TH domain family: Ribosomal protein S13 domain: Ribosomal protein S13 species: Thermus thermophilus [TaxId: 274]
Probab=100.00 E-value=4.6e-54 Score=301.32 Aligned_cols=120 Identities=53% Similarity=0.931 Sum_probs=116.7
Q ss_pred ceeeCccCCCCeeeeeehhcccccCHHHHHHHHHHhCCCCCcccCCCCHHHHHHHHHHH-hhcccchhhHHHHHHHHHHH
Q psy8858 2 TRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI-SKFIIEGDLRREFSMNIKRL 80 (121)
Q Consensus 2 v~i~~~~~~~~k~v~~aLt~I~GIG~~~A~~Ic~~lGi~p~~~~~~Ls~~qi~~L~~~l-~~~~i~~~L~~~~~~~I~rl 80 (121)
.||+|+|||++|+|.+||++|||||+++|.+||+.+||||++++++||++|++.|.+++ ++|.+|+||++.+.+||+||
T Consensus 1 aRI~g~di~~~K~v~~ALt~I~GIG~~~A~~Ic~~lgId~~~k~~~Lt~~qi~~I~~~i~~~~~i~~~L~~~~~~dIkrl 80 (125)
T d2uubm1 1 ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRL 80 (125)
T ss_dssp CCCSTTCCCCSSBHHHHHTTSTTCCHHHHHHHHHTTTCCTTSBGGGCCHHHHHHHHHHHHHHSCCTTHHHHHHHHHHHHH
T ss_pred CcccCccCCCCCEEEEeeeeeeCcCHHHHHHHHHHcCCCcccccccccHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHH
Confidence 48999999999999999999999999999999999999999999999999999999999 57999999999999999999
Q ss_pred HhhccccccccCCCCCcCCccccccccccCCCCcccccccC
Q psy8858 81 IDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLRK 121 (121)
Q Consensus 81 ~~i~~yRG~RH~~gLpVRGQRT~tNart~k~~~~~~~~~~~ 121 (121)
++|+||||+||.+|||||||||||||||+|+.+++|+++|+
T Consensus 81 ~~i~~yRG~RH~~gLpvRGQRT~tN~rt~kg~~~~v~~kk~ 121 (125)
T d2uubm1 81 MDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKK 121 (125)
T ss_dssp HHTTCHHHHHHHHTCCSSSCCCSSCCHHHHCSCCCCCCCSS
T ss_pred HHhhhhhhhhhcCCCCCCCCCCCCCccccCCCccccccccC
Confidence 99999999999999999999999999999999999998875
|
| >d2gy9m1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hkja1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Archaeon Sulfolobus shibatae [TaxId: 2286]} | Back information, alignment and structure |
|---|
| >d1k3xa1 a.156.1.2 (A:125-213) Endonuclease VIII {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r2za1 a.156.1.2 (A:135-228) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ee8a1 a.156.1.2 (A:122-210) DNA repair protein MutM (Fpg) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1k82a1 a.156.1.2 (A:129-216) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tdza1 a.156.1.2 (A:132-219) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2i0za2 e.74.1.1 (A:193-361) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} | Back information, alignment and structure |
|---|
| >d2gqfa2 e.74.1.1 (A:195-342) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vdda_ e.49.1.1 (A:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|