Psyllid ID: psy8858


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEISKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLRK
cccEEcccccccccEEEEEEEEEcccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
ccEEEEcccccccEEEEEEEEEEccccHHHHHHHHHHcccccccHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHccccc
mtrivginipnnqhIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEISKFIIEGDLRREFSMNIKRLIDLScyrgirhrkslpcrgqrtrtnartrkgprRAAQSLRK
mtrivginipnnqhiiIGLTAIYGIGRSRAKKICevtkisttkkikdlndnelEKLREEISKfiiegdlrrefSMNIKRLIdlscyrgirhrkslpcrgqrtrtnartrkgprraaqslrk
MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEISKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLRK
***IVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEISKFIIEGDLRREFSMNIKRLIDLSCYRGIRHR*****************************
MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEISKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAA*****
MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEISKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQ*********************
*TRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEISKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRK*LP*************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEISKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
A4G9R6121 30S ribosomal protein S13 yes N/A 1.0 1.0 0.776 2e-53
A6T3I1121 30S ribosomal protein S13 yes N/A 1.0 1.0 0.768 2e-53
Q13TJ3121 30S ribosomal protein S13 yes N/A 1.0 1.0 0.735 3e-49
B2T728121 30S ribosomal protein S13 yes N/A 1.0 1.0 0.727 3e-49
Q2SU50121 30S ribosomal protein S13 yes N/A 1.0 1.0 0.710 1e-48
Q63Q34121 30S ribosomal protein S13 yes N/A 1.0 1.0 0.710 1e-48
A3NEF6121 30S ribosomal protein S13 yes N/A 1.0 1.0 0.710 1e-48
Q3JMT6121 30S ribosomal protein S13 yes N/A 1.0 1.0 0.710 1e-48
A3P090121 30S ribosomal protein S13 yes N/A 1.0 1.0 0.710 1e-48
A1V880121 30S ribosomal protein S13 yes N/A 1.0 1.0 0.710 1e-48
>sp|A4G9R6|RS13_HERAR 30S ribosomal protein S13 OS=Herminiimonas arsenicoxydans GN=rpsM PE=3 SV=1 Back     alignment and function desciption
 Score =  207 bits (526), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 94/121 (77%), Positives = 111/121 (91%)

Query: 1   MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI 60
           M RI G+N+PN+QH +IGLTAIYGIGR RA+KIC+ T + TTKK+KDL+D+ELEKLR+EI
Sbjct: 1   MARIAGVNVPNHQHTVIGLTAIYGIGRPRAQKICDATGVLTTKKVKDLDDSELEKLRDEI 60

Query: 61  SKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLR 120
           +KFI+EGDLRRE SMNIKRL+DL CYRG+RHRK LPCRGQRTRTNARTRKGPR+AAQSL+
Sbjct: 61  AKFIVEGDLRREISMNIKRLMDLGCYRGMRHRKGLPCRGQRTRTNARTRKGPRKAAQSLK 120

Query: 121 K 121
           K
Sbjct: 121 K 121




Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.
Herminiimonas arsenicoxydans (taxid: 204773)
>sp|A6T3I1|RS13_JANMA 30S ribosomal protein S13 OS=Janthinobacterium sp. (strain Marseille) GN=rpsM PE=3 SV=1 Back     alignment and function description
>sp|Q13TJ3|RS13_BURXL 30S ribosomal protein S13 OS=Burkholderia xenovorans (strain LB400) GN=rpsM PE=3 SV=1 Back     alignment and function description
>sp|B2T728|RS13_BURPP 30S ribosomal protein S13 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsM PE=3 SV=1 Back     alignment and function description
>sp|Q2SU50|RS13_BURTA 30S ribosomal protein S13 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsM PE=3 SV=1 Back     alignment and function description
>sp|Q63Q34|RS13_BURPS 30S ribosomal protein S13 OS=Burkholderia pseudomallei (strain K96243) GN=rpsM PE=3 SV=1 Back     alignment and function description
>sp|A3NEF6|RS13_BURP6 30S ribosomal protein S13 OS=Burkholderia pseudomallei (strain 668) GN=rpsM PE=3 SV=1 Back     alignment and function description
>sp|Q3JMT6|RS13_BURP1 30S ribosomal protein S13 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsM PE=3 SV=1 Back     alignment and function description
>sp|A3P090|RS13_BURP0 30S ribosomal protein S13 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsM PE=3 SV=1 Back     alignment and function description
>sp|A1V880|RS13_BURMS 30S ribosomal protein S13 OS=Burkholderia mallei (strain SAVP1) GN=rpsM PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
340785619121 30S ribosomal protein S13 [Collimonas fu 1.0 1.0 0.785 7e-52
134096299121 30S ribosomal protein S13 [Herminiimonas 1.0 1.0 0.776 8e-52
152980690121 30S ribosomal protein S13 [Janthinobacte 1.0 1.0 0.768 9e-52
399017011121 30S ribosomal protein S13 [Herbaspirillu 1.0 1.0 0.760 5e-51
427399570121 30S ribosomal protein S13 [Massilia timo 1.0 1.0 0.760 8e-51
445494445121 30S ribosomal protein S13 [Janthinobacte 1.0 1.0 0.760 3e-50
300309479121 30S ribosomal protein S13 [Herbaspirillu 1.0 1.0 0.752 6e-50
237747387121 30S ribosomal subunit protein S13 [Oxalo 1.0 1.0 0.760 1e-49
237749537121 30S ribosomal subunit protein S13 [Oxalo 1.0 1.0 0.743 6e-49
83748172121 SSU ribosomal protein S13P [Ralstonia so 1.0 1.0 0.727 4e-48
>gi|340785619|ref|YP_004751084.1| 30S ribosomal protein S13 [Collimonas fungivorans Ter331] gi|340550886|gb|AEK60261.1| SSU ribosomal protein S13p (S18e) [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
 Score =  207 bits (527), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 95/121 (78%), Positives = 111/121 (91%)

Query: 1   MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI 60
           M RI G+NIPN+QH +IGLTAIYG+GR RA++IC+ T I TTKKIKDL+DNELEKLR+EI
Sbjct: 1   MARIAGVNIPNHQHTVIGLTAIYGVGRPRAQEICDSTGILTTKKIKDLDDNELEKLRDEI 60

Query: 61  SKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLR 120
           +KF++EGDLRRE SMNIKRL+DL CYRG+RHRK LPCRGQRTRTNARTRKGPR+AAQSL+
Sbjct: 61  AKFVVEGDLRRELSMNIKRLMDLGCYRGMRHRKGLPCRGQRTRTNARTRKGPRKAAQSLK 120

Query: 121 K 121
           K
Sbjct: 121 K 121




Source: Collimonas fungivorans Ter331

Species: Collimonas fungivorans

Genus: Collimonas

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi|134096299|ref|YP_001101374.1| 30S ribosomal protein S13 [Herminiimonas arsenicoxydans] gi|158706238|sp|A4G9R6.1|RS13_HERAR RecName: Full=30S ribosomal protein S13 gi|133740202|emb|CAL63253.1| 30S ribosomal subunit protein S13 [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|152980690|ref|YP_001355078.1| 30S ribosomal protein S13 [Janthinobacterium sp. Marseille] gi|158706240|sp|A6T3I1.1|RS13_JANMA RecName: Full=30S ribosomal protein S13 gi|151280767|gb|ABR89177.1| small subunit ribosomal protein S13 [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|399017011|ref|ZP_10719212.1| 30S ribosomal protein S13 [Herbaspirillum sp. CF444] gi|398104341|gb|EJL94483.1| 30S ribosomal protein S13 [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|427399570|ref|ZP_18890808.1| 30S ribosomal protein S13 [Massilia timonae CCUG 45783] gi|425721332|gb|EKU84245.1| 30S ribosomal protein S13 [Massilia timonae CCUG 45783] Back     alignment and taxonomy information
>gi|445494445|ref|ZP_21461489.1| 30S ribosomal protein S13 [Janthinobacterium sp. HH01] gi|444790606|gb|ELX12153.1| 30S ribosomal protein S13 [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|300309479|ref|YP_003773571.1| 30S ribosomal protein S13 [Herbaspirillum seropedicae SmR1] gi|409408724|ref|ZP_11257159.1| 30S ribosomal protein S13 [Herbaspirillum sp. GW103] gi|415943234|ref|ZP_11556034.1| 30S ribosomal protein S13 [Herbaspirillum frisingense GSF30] gi|300072264|gb|ADJ61663.1| 30S ribosomal subunit S13 protein [Herbaspirillum seropedicae SmR1] gi|386432046|gb|EIJ44874.1| 30S ribosomal protein S13 [Herbaspirillum sp. GW103] gi|407758750|gb|EKF68534.1| 30S ribosomal protein S13 [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|237747387|ref|ZP_04577867.1| 30S ribosomal subunit protein S13 [Oxalobacter formigenes HOxBLS] gi|229378738|gb|EEO28829.1| 30S ribosomal subunit protein S13 [Oxalobacter formigenes HOxBLS] Back     alignment and taxonomy information
>gi|237749537|ref|ZP_04580017.1| 30S ribosomal subunit protein S13 [Oxalobacter formigenes OXCC13] gi|229380899|gb|EEO30990.1| 30S ribosomal subunit protein S13 [Oxalobacter formigenes OXCC13] Back     alignment and taxonomy information
>gi|83748172|ref|ZP_00945199.1| SSU ribosomal protein S13P [Ralstonia solanacearum UW551] gi|207744553|ref|YP_002260945.1| 30s ribosomal protein s13 [Ralstonia solanacearum IPO1609] gi|300702803|ref|YP_003744404.1| 30S ribosomal protein S13 [Ralstonia solanacearum CFBP2957] gi|386332170|ref|YP_006028339.1| 30S ribosomal protein S13 [Ralstonia solanacearum Po82] gi|421890471|ref|ZP_16321330.1| 30S ribosomal subunit protein S13 [Ralstonia solanacearum K60-1] gi|421895877|ref|ZP_16326276.1| 30s ribosomal protein s13 [Ralstonia solanacearum MolK2] gi|83725140|gb|EAP72291.1| SSU ribosomal protein S13P [Ralstonia solanacearum UW551] gi|206587042|emb|CAQ17626.1| 30s ribosomal protein s13 [Ralstonia solanacearum MolK2] gi|206595959|emb|CAQ62886.1| 30s ribosomal protein s13 [Ralstonia solanacearum IPO1609] gi|299070465|emb|CBJ41760.1| 30S ribosomal subunit protein S13 [Ralstonia solanacearum CFBP2957] gi|334194618|gb|AEG67803.1| 30S ribosomal protein S13 [Ralstonia solanacearum Po82] gi|378964182|emb|CCF98078.1| 30S ribosomal subunit protein S13 [Ralstonia solanacearum K60-1] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
TIGR_CMR|SO_0253118 SO_0253 "ribosomal protein S13 0.942 0.966 0.657 1.4e-39
TIGR_CMR|CPS_0623118 CPS_0623 "ribosomal protein S1 0.942 0.966 0.649 1.9e-37
UNIPROTKB|A6UZL0118 rpsM "30S ribosomal protein S1 0.942 0.966 0.614 3.9e-37
UNIPROTKB|P0A7S9118 rpsM [Escherichia coli K-12 (t 0.942 0.966 0.587 1.2e-35
UNIPROTKB|Q9KP05118 rpsM "30S ribosomal protein S1 0.942 0.966 0.605 2.4e-35
TIGR_CMR|VC_2574118 VC_2574 "ribosomal protein S13 0.942 0.966 0.605 2.4e-35
TIGR_CMR|CHY_2284123 CHY_2284 "ribosomal protein S1 1.0 0.983 0.573 6.7e-33
TIGR_CMR|CBU_0260119 CBU_0260 "ribosomal protein S1 0.958 0.974 0.603 8.5e-33
TIGR_CMR|SPO_0509122 SPO_0509 "ribosomal protein S1 1.0 0.991 0.549 4.7e-32
UNIPROTKB|O66486126 rpsM "30S ribosomal protein S1 1.0 0.960 0.540 2e-31
TIGR_CMR|SO_0253 SO_0253 "ribosomal protein S13" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
 Score = 422 (153.6 bits), Expect = 1.4e-39, P = 1.4e-39
 Identities = 75/114 (65%), Positives = 98/114 (85%)

Query:     1 MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI 60
             M RI GINIP+ +H +I LTAI+GIGR+RA+ IC  T I+ T KIK+L++ +++ LREE+
Sbjct:     1 MARIAGINIPDQKHTVIALTAIFGIGRTRARAICAATSIAETAKIKELSEAQIDTLREEV 60

Query:    61 SKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRR 114
             +K+++EGDLRRE SMNIKRL+DL CYRG+RHR+SLP RGQRT+TNARTRKGPR+
Sbjct:    61 AKYLVEGDLRREISMNIKRLMDLGCYRGLRHRRSLPLRGQRTKTNARTRKGPRK 114




GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0006412 "translation" evidence=ISS
TIGR_CMR|CPS_0623 CPS_0623 "ribosomal protein S13" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|A6UZL0 rpsM "30S ribosomal protein S13" [Pseudomonas aeruginosa PA7 (taxid:381754)] Back     alignment and assigned GO terms
UNIPROTKB|P0A7S9 rpsM [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KP05 rpsM "30S ribosomal protein S13" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2574 VC_2574 "ribosomal protein S13" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2284 CHY_2284 "ribosomal protein S13" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0260 CBU_0260 "ribosomal protein S13/S18" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0509 SPO_0509 "ribosomal protein S13" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|O66486 rpsM "30S ribosomal protein S13" [Aquifex aeolicus VF5 (taxid:224324)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B2UEJ6RS13_RALPJNo assigned EC number0.71071.01.0yesN/A
B2T728RS13_BURPPNo assigned EC number0.72721.01.0yesN/A
B1JU45RS13_BURCCNo assigned EC number0.69421.01.0yesN/A
A1KB04RS13_AZOSBNo assigned EC number0.66950.95040.9583yesN/A
B2JI42RS13_BURP8No assigned EC number0.72721.01.0yesN/A
B1XSS4RS13_POLNSNo assigned EC number0.65281.01.0yesN/A
Q7VTA8RS13_BORPENo assigned EC number0.68591.01.0yesN/A
B4E5E3RS13_BURCJNo assigned EC number0.70241.01.0yesN/A
B3R7E6RS13_CUPTRNo assigned EC number0.70241.01.0yesN/A
Q39KE4RS13_BURS3No assigned EC number0.69421.01.0yesN/A
A1W330RS13_ACISJNo assigned EC number0.67761.01.0yesN/A
A3NEF6RS13_BURP6No assigned EC number0.71071.01.0yesN/A
A0K3P8RS13_BURCHNo assigned EC number0.69421.01.0yesN/A
Q62GM8RS13_BURMANo assigned EC number0.71071.01.0yesN/A
Q46WG6RS13_CUPPJNo assigned EC number0.69421.01.0yesN/A
Q0BJ23RS13_BURCMNo assigned EC number0.71071.01.0yesN/A
Q7WRA0RS13_BORBRNo assigned EC number0.68591.01.0yesN/A
B1YRQ2RS13_BURA4No assigned EC number0.71071.01.0yesN/A
Q1BRX1RS13_BURCANo assigned EC number0.69421.01.0yesN/A
A3MRX7RS13_BURM7No assigned EC number0.71071.01.0yesN/A
A1TJT9RS13_ACIACNo assigned EC number0.68591.01.0yesN/A
Q2SU50RS13_BURTANo assigned EC number0.71071.01.0yesN/A
B9MBV9RS13_ACIETNo assigned EC number0.67761.01.0yesN/A
Q5P310RS13_AROAENo assigned EC number0.66950.95040.9583yesN/A
C5CQ78RS13_VARPSNo assigned EC number0.69421.01.0yesN/A
A4SUY3RS13_POLSQNo assigned EC number0.66941.01.0yesN/A
Q47J80RS13_DECARNo assigned EC number0.66950.95040.9583yesN/A
Q2L248RS13_BORA1No assigned EC number0.66941.01.0yesN/A
A1V880RS13_BURMSNo assigned EC number0.71071.01.0yesN/A
Q3SLM7RS13_THIDANo assigned EC number0.70430.95040.9745yesN/A
A6T3I1RS13_JANMANo assigned EC number0.76851.01.0yesN/A
A3P090RS13_BURP0No assigned EC number0.71071.01.0yesN/A
Q12G80RS13_POLSJNo assigned EC number0.69421.01.0yesN/A
A1WK95RS13_VEREINo assigned EC number0.66941.01.0yesN/A
A4JAR3RS13_BURVGNo assigned EC number0.71071.01.0yesN/A
Q0K642RS13_CUPNHNo assigned EC number0.69421.01.0yesN/A
A9IHS0RS13_BORPDNo assigned EC number0.66941.01.0yesN/A
A4G9R6RS13_HERARNo assigned EC number0.77681.01.0yesN/A
Q63Q34RS13_BURPSNo assigned EC number0.71071.01.0yesN/A
Q2YAX5RS13_NITMUNo assigned EC number0.66100.97520.944yesN/A
Q1LI60RS13_RALMENo assigned EC number0.70241.01.0yesN/A
A2S7J9RS13_BURM9No assigned EC number0.71071.01.0yesN/A
Q7W2D2RS13_BORPANo assigned EC number0.68591.01.0yesN/A
Q13TJ3RS13_BURXLNo assigned EC number0.73551.01.0yesN/A
A9ADL6RS13_BURM1No assigned EC number0.70241.01.0yesN/A
A1VJ37RS13_POLNANo assigned EC number0.69421.01.0yesN/A
Q3JMT6RS13_BURP1No assigned EC number0.71071.01.0yesN/A
C1DAU0RS13_LARHHNo assigned EC number0.71050.94210.95yesN/A
Q21QP6RS13_RHOFDNo assigned EC number0.68591.01.0yesN/A
Q8XV35RS13_RALSONo assigned EC number0.71071.01.0yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
PRK05179122 PRK05179, rpsM, 30S ribosomal protein S13; Validat 2e-66
TIGR03631113 TIGR03631, bact_S13, 30S ribosomal protein S13 2e-60
COG0099121 COG0099, RpsM, Ribosomal protein S13 [Translation, 4e-52
CHL00137122 CHL00137, rps13, ribosomal protein S13; Validated 2e-41
pfam00416106 pfam00416, Ribosomal_S13, Ribosomal protein S13/S1 9e-37
PRK04053149 PRK04053, rps13p, 30S ribosomal protein S13P; Revi 2e-20
TIGR03629144 TIGR03629, arch_S13P, archaeal ribosomal protein S 1e-19
PTZ00134154 PTZ00134, PTZ00134, 40S ribosomal protein S18; Pro 3e-09
>gnl|CDD|235358 PRK05179, rpsM, 30S ribosomal protein S13; Validated Back     alignment and domain information
 Score =  196 bits (500), Expect = 2e-66
 Identities = 73/122 (59%), Positives = 93/122 (76%), Gaps = 1/122 (0%)

Query: 1   MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI 60
           M RI G++IP N+ ++I LT IYGIGR+RAK+I     I    ++KDL D EL+K+REEI
Sbjct: 1   MARIAGVDIPRNKRVVIALTYIYGIGRTRAKEILAAAGIDPDTRVKDLTDEELDKIREEI 60

Query: 61  SK-FIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSL 119
            K + +EGDLRRE SMNIKRL+D+ CYRG+RHR+ LP RGQRT+TNARTRKGPR+     
Sbjct: 61  DKNYKVEGDLRREVSMNIKRLMDIGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKTIAGK 120

Query: 120 RK 121
           +K
Sbjct: 121 KK 122


Length = 122

>gnl|CDD|213840 TIGR03631, bact_S13, 30S ribosomal protein S13 Back     alignment and domain information
>gnl|CDD|223177 COG0099, RpsM, Ribosomal protein S13 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177059 CHL00137, rps13, ribosomal protein S13; Validated Back     alignment and domain information
>gnl|CDD|144128 pfam00416, Ribosomal_S13, Ribosomal protein S13/S18 Back     alignment and domain information
>gnl|CDD|235215 PRK04053, rps13p, 30S ribosomal protein S13P; Reviewed Back     alignment and domain information
>gnl|CDD|213839 TIGR03629, arch_S13P, archaeal ribosomal protein S13P Back     alignment and domain information
>gnl|CDD|185469 PTZ00134, PTZ00134, 40S ribosomal protein S18; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
CHL00137122 rps13 ribosomal protein S13; Validated 100.0
COG0099121 RpsM Ribosomal protein S13 [Translation, ribosomal 100.0
PRK05179122 rpsM 30S ribosomal protein S13; Validated 100.0
TIGR03631113 bact_S13 30S ribosomal protein S13. This model des 100.0
TIGR03629144 arch_S13P archaeal ribosomal protein S13P. This mo 100.0
PRK04053149 rps13p 30S ribosomal protein S13P; Reviewed 100.0
PF00416107 Ribosomal_S13: Ribosomal protein S13/S18; InterPro 100.0
PTZ00134154 40S ribosomal protein S18; Provisional 100.0
KOG3311|consensus152 100.0
PF0683192 H2TH: Formamidopyrimidine-DNA glycosylase H2TH dom 97.71
PRK01103274 formamidopyrimidine/5-formyluracil/ 5-hydroxymethy 97.35
PRK04184 535 DNA topoisomerase VI subunit B; Validated 97.32
PRK14810272 formamidopyrimidine-DNA glycosylase; Provisional 97.02
PRK14811269 formamidopyrimidine-DNA glycosylase; Provisional 96.93
PRK10445263 endonuclease VIII; Provisional 96.9
PRK13945282 formamidopyrimidine-DNA glycosylase; Provisional 96.82
TIGR00577272 fpg formamidopyrimidine-DNA glycosylase (fpg). All 96.8
TIGR01052 488 top6b DNA topoisomerase VI, B subunit. This model 96.66
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, 96.06
COG0266273 Nei Formamidopyrimidine-DNA glycosylase [DNA repli 95.49
PF05833 455 FbpA: Fibronectin-binding protein A N-terminus (Fb 95.26
PF0063330 HHH: Helix-hairpin-helix motif; InterPro: IPR00044 94.94
TIGR00275400 flavoprotein, HI0933 family. The model when search 93.39
KOG3311|consensus152 93.32
PF1179832 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 92.63
PF1039152 DNA_pol_lambd_f: Fingers domain of DNA polymerase 91.53
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 91.29
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 91.19
PF1452060 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU 90.98
smart0027826 HhH1 Helix-hairpin-helix DNA-binding motif class 1 90.09
PRK02515132 psbU photosystem II complex extrinsic protein prec 90.02
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 89.23
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 87.57
PRK14606188 ruvA Holliday junction DNA helicase RuvA; Provisio 87.18
COG3743133 Uncharacterized conserved protein [Function unknow 86.48
PRK14601183 ruvA Holliday junction DNA helicase RuvA; Provisio 86.45
PRK13844200 recombination protein RecR; Provisional 85.69
PRK14603197 ruvA Holliday junction DNA helicase RuvA; Provisio 85.67
TIGR00615195 recR recombination protein RecR. This family is ba 85.52
PRK14604195 ruvA Holliday junction DNA helicase RuvA; Provisio 85.47
PRK13901196 ruvA Holliday junction DNA helicase RuvA; Provisio 85.18
TIGR03252177 uncharacterized HhH-GPD family protein. This model 84.74
PRK14602203 ruvA Holliday junction DNA helicase RuvA; Provisio 84.54
PRK00076196 recR recombination protein RecR; Reviewed 84.51
PF09883225 DUF2110: Uncharacterized protein conserved in arch 84.5
COG0632201 RuvA Holliday junction resolvasome, DNA-binding su 84.41
COG0353198 RecR Recombinational DNA repair protein (RecF path 84.15
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 83.94
PF1457990 HHH_6: Helix-hairpin-helix motif; PDB: 2HPM_A 2HPI 83.82
COG1293 564 Predicted RNA-binding protein homologous to eukary 83.6
PF1452060 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU 80.88
PRK14605194 ruvA Holliday junction DNA helicase RuvA; Provisio 80.39
PRK14605194 ruvA Holliday junction DNA helicase RuvA; Provisio 80.36
PRK14600186 ruvA Holliday junction DNA helicase RuvA; Provisio 80.04
>CHL00137 rps13 ribosomal protein S13; Validated Back     alignment and domain information
Probab=100.00  E-value=4.9e-55  Score=307.78  Aligned_cols=121  Identities=51%  Similarity=0.852  Sum_probs=118.1

Q ss_pred             CceeeCccCCCCeeeeeehhcccccCHHHHHHHHHHhCCCCCcccCCCCHHHHHHHHHHH-hhcccchhhHHHHHHHHHH
Q psy8858           1 MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI-SKFIIEGDLRREFSMNIKR   79 (121)
Q Consensus         1 mv~i~~~~~~~~k~v~~aLt~I~GIG~~~A~~Ic~~lGi~p~~~~~~Ls~~qi~~L~~~l-~~~~i~~~L~~~~~~~I~r   79 (121)
                      ||||+|+|||++|+|.+||++|||||+++|.+||+.+||||++++++|+++|+++|.++| ++|.+|+||++.+++||+|
T Consensus         1 mvrI~~~~i~~~k~v~~aLt~i~GIG~~~A~~ic~~lgi~~~~~~~~Lt~~qi~~l~~~i~~~~~i~~dL~~~~~~dI~r   80 (122)
T CHL00137          1 MVRIAGVDLPRNKRIEYALTYIYGIGLTSAKEILEKANIDPDIRTKDLTDEQISALREIIEENYQVEGDLRRFESLNIKR   80 (122)
T ss_pred             CceEcCccCCCCCEeeeeecccccccHHHHHHHHHHcCcCcCcCcccCCHHHHHHHHHHHHHhCcchHHHHHHHHHHHHH
Confidence            899999999999999999999999999999999999999999999999999999999999 5799999999999999999


Q ss_pred             HHhhccccccccCCCCCcCCccccccccccCCCCcccccccC
Q psy8858          80 LIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLRK  121 (121)
Q Consensus        80 l~~i~~yRG~RH~~gLpVRGQRT~tNart~k~~~~~~~~~~~  121 (121)
                      |++|+||||+||.+|||||||||||||||+|+++++++++++
T Consensus        81 l~~I~sYRG~RH~~gLPVRGQRT~tNarT~k~~~~~~~~kk~  122 (122)
T CHL00137         81 LMEINCYRGRRHRLGLPVRGQRTRTNARTRRGAKKTVAGKKK  122 (122)
T ss_pred             HHHhCchhcccccCCCCCCCCcCCccccccCCCcccccccCC
Confidence            999999999999999999999999999999999999997664



>COG0099 RpsM Ribosomal protein S13 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05179 rpsM 30S ribosomal protein S13; Validated Back     alignment and domain information
>TIGR03631 bact_S13 30S ribosomal protein S13 Back     alignment and domain information
>TIGR03629 arch_S13P archaeal ribosomal protein S13P Back     alignment and domain information
>PRK04053 rps13p 30S ribosomal protein S13P; Reviewed Back     alignment and domain information
>PF00416 Ribosomal_S13: Ribosomal protein S13/S18; InterPro: IPR001892 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PTZ00134 40S ribosomal protein S18; Provisional Back     alignment and domain information
>KOG3311|consensus Back     alignment and domain information
>PF06831 H2TH: Formamidopyrimidine-DNA glycosylase H2TH domain; InterPro: IPR015886 This entry represents a helix-2turn-helix DNA-binding domain found in DNA glycosylase/AP lyase enzymes, which are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents Back     alignment and domain information
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional Back     alignment and domain information
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional Back     alignment and domain information
>PRK10445 endonuclease VIII; Provisional Back     alignment and domain information
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional Back     alignment and domain information
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg) Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05833 FbpA: Fibronectin-binding protein A N-terminus (FbpA); InterPro: IPR008616 This family consists of the N-terminal region of the prokaryotic fibronectin-binding protein, the C-terminal region is IPR008532 from INTERPRO Back     alignment and domain information
>PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>KOG3311|consensus Back     alignment and domain information
>PF11798 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases [] Back     alignment and domain information
>PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A Back     alignment and domain information
>smart00278 HhH1 Helix-hairpin-helix DNA-binding motif class 1 Back     alignment and domain information
>PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>COG3743 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK13844 recombination protein RecR; Provisional Back     alignment and domain information
>PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>TIGR00615 recR recombination protein RecR Back     alignment and domain information
>PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>TIGR03252 uncharacterized HhH-GPD family protein Back     alignment and domain information
>PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK00076 recR recombination protein RecR; Reviewed Back     alignment and domain information
>PF09883 DUF2110: Uncharacterized protein conserved in archaea (DUF2110); InterPro: IPR016757 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0353 RecR Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF14579 HHH_6: Helix-hairpin-helix motif; PDB: 2HPM_A 2HPI_A 3E0D_A 3F2C_A 3F2B_A 3F2D_A 2HQA_A 2HNH_A Back     alignment and domain information
>COG1293 Predicted RNA-binding protein homologous to eukaryotic snRNP [Transcription] Back     alignment and domain information
>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A Back     alignment and domain information
>PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
1vs5_M118 Crystal Structure Of The Bacterial Ribosome From Es 2e-39
3fih_M113 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 1e-38
3ofo_M114 Crystal Structure Of The E. Coli Ribosome Bound To 1e-38
2gy9_M115 Structure Of The 30s Subunit Of A Pre-Translocation 1e-38
1p6g_M117 Real Space Refined Coordinates Of The 30s Subunit F 1e-38
1fjg_M126 Structure Of The Thermus Thermophilus 30s Ribosomal 4e-33
1i94_M125 Crystal Structures Of The Small Ribosomal Subunit W 2e-32
3mr8_M117 Recognition Of The Amber Stop Codon By Release Fact 4e-32
3pyn_M116 Crystal Structure Of A Complex Containing Domain 3 4e-32
3bbn_M145 Homology Model For The Spinach Chloroplast 30s Subu 2e-14
3j20_O148 Promiscuous Behavior Of Proteins In Archaeal Riboso 9e-11
1s1h_M132 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 3e-06
3izb_M146 Localization Of The Small Subunit Ribosomal Protein 3e-06
3jyv_M130 Structure Of The 40s Rrna And Proteins And PE TRNA 3e-06
2zkq_m152 Structure Of A Mammalian Ribosomal 40s Subunit With 7e-06
3iz6_M152 Localization Of The Small Subunit Ribosomal Protein 9e-06
2xzm_M155 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-05
3zey_M153 High-resolution Cryo-electron Microscopy Structure 2e-04
>pdb|1VS5|M Chain M, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 118 Back     alignment and structure

Iteration: 1

Score = 156 bits (395), Expect = 2e-39, Method: Compositional matrix adjust. Identities = 67/114 (58%), Positives = 94/114 (82%) Query: 1 MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI 60 M RI GINIP+++H +I LT+IYG+G++R+K I I+ KI +L++ +++ LR+E+ Sbjct: 1 MARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEV 60 Query: 61 SKFIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRR 114 +KF++EGDLRRE SM+IKRL+DL CYRG+RHR+ LP RGQRT+TNARTRKGPR+ Sbjct: 61 AKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRK 114
>pdb|3FIH|M Chain M, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 113 Back     alignment and structure
>pdb|3OFO|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To Erythromycin. This File Contains The 30s Subunit Of The First 70s Ribosome. Length = 114 Back     alignment and structure
>pdb|2GY9|M Chain M, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 115 Back     alignment and structure
>pdb|1P6G|M Chain M, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 117 Back     alignment and structure
>pdb|1FJG|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 126 Back     alignment and structure
>pdb|1I94|M Chain M, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 125 Back     alignment and structure
>pdb|3MR8|M Chain M, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mr8 Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 3ms1. Molecule B In The Same Asymmetric Unit Is Deposited As 3mrz (50s) And 3ms0 (30s). Length = 117 Back     alignment and structure
>pdb|3PYN|M Chain M, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 30s Subunit Of The First 70s Ribosome. Length = 116 Back     alignment and structure
>pdb|3BBN|M Chain M, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 145 Back     alignment and structure
>pdb|3J20|O Chain O, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (30s Ribosomal Subunit) Length = 148 Back     alignment and structure
>pdb|1S1H|M Chain M, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 132 Back     alignment and structure
>pdb|3IZB|M Chain M, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 146 Back     alignment and structure
>pdb|3JYV|M Chain M, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 130 Back     alignment and structure
>pdb|2ZKQ|MM Chain m, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 152 Back     alignment and structure
>pdb|3IZ6|M Chain M, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 152 Back     alignment and structure
>pdb|2XZM|M Chain M, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 155 Back     alignment and structure
>pdb|3ZEY|M Chain M, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 153 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
3r8n_M114 30S ribosomal protein S13; protein biosynthesis, R 6e-65
2vqe_M126 30S ribosomal protein S13, 30S ribosomal protein S 1e-63
3bbn_M145 Ribosomal protein S13; small ribosomal subunit, sp 5e-53
3u5c_S146 40S ribosomal protein S18-A, 40S ribosomal protein 4e-47
3iz6_M152 40S ribosomal protein S18 (S13P); eukaryotic ribos 6e-45
2xzm_M155 RPS18E; ribosome, translation; 3.93A {Tetrahymena 1e-43
>2vqe_M 30S ribosomal protein S13, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.156.1.1 PDB: 1gix_P* 1hnw_M* 1hnx_M* 1hnz_M* 1hr0_M 1ibk_M* 1ibl_M* 1ibm_M 1j5e_M 1jgo_P* 1jgp_P* 1jgq_P* 1mj1_P* 1ml5_P* 1n32_M* 1n33_M* 1n34_M 1n36_M 1xmo_M* 1xmq_M* ... Length = 126 Back     alignment and structure
>3bbn_M Ribosomal protein S13; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 145 Back     alignment and structure
>3u5c_S 40S ribosomal protein S18-A, 40S ribosomal protein S17-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_M 3o30_L 3o2z_L 3u5g_S 1s1h_M 3jyv_M* 2zkq_m Length = 146 Back     alignment and structure
>3iz6_M 40S ribosomal protein S18 (S13P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 152 Back     alignment and structure
>2xzm_M RPS18E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_M Length = 155 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
2vqe_M126 30S ribosomal protein S13, 30S ribosomal protein S 100.0
3r8n_M114 30S ribosomal protein S13; protein biosynthesis, R 100.0
2xzm_M155 RPS18E; ribosome, translation; 3.93A {Tetrahymena 100.0
3j20_O148 30S ribosomal protein S13P; archaea, archaeal, KIN 100.0
3iz6_M152 40S ribosomal protein S18 (S13P); eukaryotic ribos 100.0
3u5c_S146 40S ribosomal protein S18-A, 40S ribosomal protein 100.0
3bbn_M145 Ribosomal protein S13; small ribosomal subunit, sp 100.0
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 96.86
1k3x_A262 Endonuclease VIII; hydrolase/DNA, hydrolase-DNA co 96.73
1ee8_A266 MUTM (FPG) protein; beta sandwich, zinc finger, he 96.72
1k82_A268 Formamidopyrimidine-DNA glycosylase; protein-DNA c 96.71
2xzf_A271 Formamidopyrimidine-DNA glycosylase; hydrolase-DNA 96.7
3u6p_A273 Formamidopyrimidine-DNA glycosylase; DNA glycosyla 96.69
3w0f_A287 Endonuclease 8-like 3; helix two turns helix, zinc 96.63
3twl_A310 Formamidopyrimidine-DNA glycosylase 1; helix two t 96.56
3vk8_A295 Probable formamidopyrimidine-DNA glycosylase; DNA 96.53
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 94.29
3fut_A271 Dimethyladenosine transferase; methyltransferase, 92.92
2a1j_A63 DNA repair endonuclease XPF; XPF, xeroderma pigmen 92.88
1tdh_A364 NEI endonuclease VIII-like 1; helix two turns heli 92.32
1kft_A78 UVRC, excinuclease ABC subunit C; helix-hairpin-he 92.22
3arc_U97 Photosystem II 12 kDa extrinsic protein; PSII, mem 91.42
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 91.23
1s5l_U134 Photosystem II 12 kDa extrinsic protein; photosynt 89.24
1z00_B84 DNA repair endonuclease XPF; helix-hairpin-helix, 89.23
1z00_A89 DNA excision repair protein ERCC-1; helix-hairpin- 87.7
2a1j_B91 DNA excision repair protein ERCC-1; XPF, xeroderma 87.44
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 86.44
3fhf_A214 Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel 86.29
2duy_A75 Competence protein comea-related protein; helix-ha 86.08
3fhg_A207 Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel 86.03
1x2i_A75 HEF helicase/nuclease; alpha helix, helix-hairpin- 85.8
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 85.77
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 83.85
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 81.41
3vdp_A212 Recombination protein RECR; zinc finger, DNA repai 81.1
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 80.76
2edu_A98 Kinesin-like protein KIF22; kinesin-like DNA bindi 80.16
3n0u_A219 Probable N-glycosylase/DNA lyase; structural genom 80.07
>2vqe_M 30S ribosomal protein S13, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.156.1.1 PDB: 1gix_P* 1hnw_M* 1hnx_M* 1hnz_M* 1hr0_M 1ibk_M* 1ibl_M* 1ibm_M 1j5e_M 1jgo_P* 1jgp_P* 1jgq_P* 1mj1_P* 1ml5_P* 1n32_M* 1n33_M* 1n34_M 1n36_M 1xmo_M* 1xmq_M* ... Back     alignment and structure
Probab=100.00  E-value=2.1e-56  Score=314.79  Aligned_cols=121  Identities=53%  Similarity=0.934  Sum_probs=117.6

Q ss_pred             CceeeCccCCCCeeeeeehhcccccCHHHHHHHHHHhCCCCCcccCCCCHHHHHHHHHHHh-hcccchhhHHHHHHHHHH
Q psy8858           1 MTRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEIS-KFIIEGDLRREFSMNIKR   79 (121)
Q Consensus         1 mv~i~~~~~~~~k~v~~aLt~I~GIG~~~A~~Ic~~lGi~p~~~~~~Ls~~qi~~L~~~l~-~~~i~~~L~~~~~~~I~r   79 (121)
                      |+||+|+|||++|.|++||++|||||+++|..||+.+||||++++++||++|+++|.++|+ +|.+|+||++++++||+|
T Consensus         1 m~rI~g~~i~~~k~v~~aLt~I~GIG~~~A~~I~~~~gi~~~~r~~~Lt~~ei~~l~~~i~~~~~ve~dLrr~~~~nIkR   80 (126)
T 2vqe_M            1 MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKR   80 (126)
T ss_dssp             -CCCSTTCCCCSSBHHHHHTTSSSCCSHHHHHHTTTTTCCTTSBGGGCCHHHHHHHHHHHHTTSCCHHHHHHHHHHHHHH
T ss_pred             CceEeCccCCCCcEeeeehhccccccHHHHHHHHHHcCCCcccccCcCCHHHHHHHHHHHHHhCcchhHHHHHHHHHHHH
Confidence            8999999999999999999999999999999999999999999999999999999999996 699999999999999999


Q ss_pred             HHhhccccccccCCCCCcCCccccccccccCCCCcccccccC
Q psy8858          80 LIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLRK  121 (121)
Q Consensus        80 l~~i~~yRG~RH~~gLpVRGQRT~tNart~k~~~~~~~~~~~  121 (121)
                      |++|+||||+||.+|||||||||||||||+|+++++|+++||
T Consensus        81 L~~I~~YRG~RH~~GLPVRGQRTkTNaRTrkg~~~~v~~kkk  122 (126)
T 2vqe_M           81 LMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKK  122 (126)
T ss_dssp             HHHTTCHHHHHHHTTCCSSSCCCSSCCHHHHCSCCCCCCCCS
T ss_pred             HHHHHHHhhhhhccCCcCCCccCccccccCCCcccccccccC
Confidence            999999999999999999999999999999999999998775



>2xzm_M RPS18E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_M Back     alignment and structure
>3j20_O 30S ribosomal protein S13P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3iz6_M 40S ribosomal protein S18 (S13P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3u5c_S 40S ribosomal protein S18-A, 40S ribosomal protein S17-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_M 3o30_L 3o2z_L 3u5g_S 1s1h_M 3jyv_M* 2zkq_m Back     alignment and structure
>3bbn_M Ribosomal protein S13; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>1k3x_A Endonuclease VIII; hydrolase/DNA, hydrolase-DNA complex; HET: BRU PED; 1.25A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 PDB: 1k3w_A* 1q39_A 2ea0_A* 2oq4_A* 1q3c_A 2opf_A* 1q3b_A* Back     alignment and structure
>1ee8_A MUTM (FPG) protein; beta sandwich, zinc finger, helix two-turns helix, riken STR genomics/proteomics initiative, RSGI, structural genomics; 1.90A {Thermus thermophilus} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 Back     alignment and structure
>1k82_A Formamidopyrimidine-DNA glycosylase; protein-DNA complex, DNA repair, beta sandwich, zinc finger, helix two-turns helix, hydrolase/DNA complex; HET: PED; 2.10A {Escherichia coli} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 Back     alignment and structure
>2xzf_A Formamidopyrimidine-DNA glycosylase; hydrolase-DNA complex; HET: VET; 1.80A {Lactococcus lactis subsp} PDB: 1pm5_A* 1xc8_A* 1pji_A* 2xzu_A* 3c58_A* 1tdz_A* 1nnj_A 1kfv_A 1pjj_A* Back     alignment and structure
>3u6p_A Formamidopyrimidine-DNA glycosylase; DNA glycosylase, DNA repair, sequence context; HET: DNA 08Q; 1.60A {Geobacillus stearothermophilus} PDB: 3u6d_A* 3u6c_A* 3u6l_A* 3u6m_A* 3u6o_A* 3u6e_A* 3u6q_A* 3u6s_A* 3gp1_A* 3sbj_A* 2f5q_A* 2f5s_A* 3gq4_A* 3gpy_A* 2f5n_A 2f5o_A 2f5p_A 3sau_A* 3sar_A* 3sav_A* ... Back     alignment and structure
>3w0f_A Endonuclease 8-like 3; helix two turns helix, zinc finger, DNA binding, hydrolase; 2.00A {Mus musculus} Back     alignment and structure
>3twl_A Formamidopyrimidine-DNA glycosylase 1; helix two turns helix, zinc-LESS finger, hydrolase, DNA DAMA repair, DNA-binding, glycosidase, lyase; 1.70A {Arabidopsis thaliana} PDB: 3twm_A* 3twk_A Back     alignment and structure
>3vk8_A Probable formamidopyrimidine-DNA glycosylase; DNA glycosylase, hneil1 ortholog, DNA lesion, thymine glycol zincless finger; HET: DNA CTG; 2.00A {Acanthamoeba polyphaga mimivirus} PDB: 3vk7_A* 3a42_A 3a46_A* 3a45_A* Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* Back     alignment and structure
>1tdh_A NEI endonuclease VIII-like 1; helix two turns helix, zinc-LESS finger, hydrolase; 2.10A {Homo sapiens} SCOP: a.156.1.2 b.113.1.1 g.39.1.8 Back     alignment and structure
>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Back     alignment and structure
>3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* Back     alignment and structure
>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase; 2.00A {Methanocaldococcus jannaschii} PDB: 3knt_A* Back     alignment and structure
>2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 Back     alignment and structure
>3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3vdp_A Recombination protein RECR; zinc finger, DNA repair, DNA binding; 2.45A {Thermoanaerobacter tengcongensis} PDB: 3vdu_A 3ve5_D Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 Back     alignment and structure
>3n0u_A Probable N-glycosylase/DNA lyase; structural genomics, ISFI, DNA repair, 8-oxoguanine, base EX repair, PSI-2, protein structure initiative; 1.50A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
d2gy9m1114 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escheri 6e-44
d2uubm1125 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus 4e-40
d2hkja178 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit m 0.003
>d2gy9m1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} Length = 114 Back     information, alignment and structure

class: All alpha proteins
fold: S13-like H2TH domain
superfamily: S13-like H2TH domain
family: Ribosomal protein S13
domain: Ribosomal protein S13
species: Escherichia coli [TaxId: 562]
 Score =  137 bits (346), Expect = 6e-44
 Identities = 66/112 (58%), Positives = 93/112 (83%)

Query: 3   RIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEISK 62
           RI GINIP+++H +I LT+IYG+G++R+K I     I+   KI +L++ +++ LR+E++K
Sbjct: 2   RIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAK 61

Query: 63  FIIEGDLRREFSMNIKRLIDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRR 114
           F++EGDLRRE SM+IKRL+DL CYRG+RHR+ LP RGQRT+TNARTRKGPR+
Sbjct: 62  FVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRK 113


>d2uubm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} Length = 125 Back     information, alignment and structure
>d2hkja1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d2uubm1125 Ribosomal protein S13 {Thermus thermophilus [TaxId 100.0
d2gy9m1114 Ribosomal protein S13 {Escherichia coli [TaxId: 56 100.0
d2hkja178 Topoisomerase VI-B subunit middle domain {Archaeon 98.63
d1k3xa189 Endonuclease VIII {Escherichia coli [TaxId: 562]} 97.95
d1r2za194 DNA repair protein MutM (Fpg) {Bacillus stearother 97.85
d1ee8a189 DNA repair protein MutM (Fpg) {Thermus thermophilu 97.85
d1k82a188 DNA repair protein MutM (Fpg) {Escherichia coli [T 97.85
d1tdza188 DNA repair protein MutM (Fpg) {Lactococcus lactis 97.82
d2bgwa170 DNA repair endonuclease XPF {Aeropyrum pernix [Tax 95.47
d1pzna161 DNA repair protein Rad51, N-terminal domain {Archa 95.43
d2i0za2169 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 95.41
d2fmpa257 DNA polymerase beta {Human (Homo sapiens) [TaxId: 95.38
d2bcqa257 DNA polymerase lambda {Human (Homo sapiens) [TaxId 95.34
d1tdha1115 Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapi 95.34
d2i1qa160 DNA repair protein Rad51, N-terminal domain {Archa 95.08
d1jmsa360 Terminal deoxynucleotidyl transferase {Mouse (Mus 95.01
d2axtu198 Photosystem II 12 kDa extrinsic protein PsbU {Ther 93.83
d2gqfa2148 Hypothetical protein HI0933 {Haemophilus influenza 93.83
d1bvsa271 DNA helicase RuvA subunit, middle domain {Mycobact 93.14
d1ixra173 DNA helicase RuvA subunit, middle domain {Thermus 92.99
d2a1ja162 DNA repair endonuclease XPF {Human (Homo sapiens) 92.9
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia c 92.78
d2a1jb178 DNA excision repair protein ERCC-1 {Human (Homo sa 92.21
d1cuka278 DNA helicase RuvA subunit, middle domain {Escheric 92.14
d1x2ia168 ATP-dependent RNA helicase PF2015 {Pyrococcus furi 90.5
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 89.57
d1vdda_199 Recombination protein RecR {Deinococcus radioduran 87.78
d1bvsa271 DNA helicase RuvA subunit, middle domain {Mycobact 86.14
d1ixra173 DNA helicase RuvA subunit, middle domain {Thermus 83.93
d1cuka278 DNA helicase RuvA subunit, middle domain {Escheric 83.93
d2duya165 Uncharacterized protein TTHA1967 {Thermus thermoph 81.54
>d2uubm1 a.156.1.1 (M:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: S13-like H2TH domain
superfamily: S13-like H2TH domain
family: Ribosomal protein S13
domain: Ribosomal protein S13
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=4.6e-54  Score=301.32  Aligned_cols=120  Identities=53%  Similarity=0.931  Sum_probs=116.7

Q ss_pred             ceeeCccCCCCeeeeeehhcccccCHHHHHHHHHHhCCCCCcccCCCCHHHHHHHHHHH-hhcccchhhHHHHHHHHHHH
Q psy8858           2 TRIVGINIPNNQHIIIGLTAIYGIGRSRAKKICEVTKISTTKKIKDLNDNELEKLREEI-SKFIIEGDLRREFSMNIKRL   80 (121)
Q Consensus         2 v~i~~~~~~~~k~v~~aLt~I~GIG~~~A~~Ic~~lGi~p~~~~~~Ls~~qi~~L~~~l-~~~~i~~~L~~~~~~~I~rl   80 (121)
                      .||+|+|||++|+|.+||++|||||+++|.+||+.+||||++++++||++|++.|.+++ ++|.+|+||++.+.+||+||
T Consensus         1 aRI~g~di~~~K~v~~ALt~I~GIG~~~A~~Ic~~lgId~~~k~~~Lt~~qi~~I~~~i~~~~~i~~~L~~~~~~dIkrl   80 (125)
T d2uubm1           1 ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRL   80 (125)
T ss_dssp             CCCSTTCCCCSSBHHHHHTTSTTCCHHHHHHHHHTTTCCTTSBGGGCCHHHHHHHHHHHHHHSCCTTHHHHHHHHHHHHH
T ss_pred             CcccCccCCCCCEEEEeeeeeeCcCHHHHHHHHHHcCCCcccccccccHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHH
Confidence            48999999999999999999999999999999999999999999999999999999999 57999999999999999999


Q ss_pred             HhhccccccccCCCCCcCCccccccccccCCCCcccccccC
Q psy8858          81 IDLSCYRGIRHRKSLPCRGQRTRTNARTRKGPRRAAQSLRK  121 (121)
Q Consensus        81 ~~i~~yRG~RH~~gLpVRGQRT~tNart~k~~~~~~~~~~~  121 (121)
                      ++|+||||+||.+|||||||||||||||+|+.+++|+++|+
T Consensus        81 ~~i~~yRG~RH~~gLpvRGQRT~tN~rt~kg~~~~v~~kk~  121 (125)
T d2uubm1          81 MDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKK  121 (125)
T ss_dssp             HHTTCHHHHHHHHTCCSSSCCCSSCCHHHHCSCCCCCCCSS
T ss_pred             HHhhhhhhhhhcCCCCCCCCCCCCCccccCCCccccccccC
Confidence            99999999999999999999999999999999999998875



>d2gy9m1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hkja1 a.156.1.3 (A:229-306) Topoisomerase VI-B subunit middle domain {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d1k3xa1 a.156.1.2 (A:125-213) Endonuclease VIII {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r2za1 a.156.1.2 (A:135-228) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ee8a1 a.156.1.2 (A:122-210) DNA repair protein MutM (Fpg) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k82a1 a.156.1.2 (A:129-216) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tdza1 a.156.1.2 (A:132-219) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i0za2 e.74.1.1 (A:193-361) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdha1 a.156.1.2 (A:132-246) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d2gqfa2 e.74.1.1 (A:195-342) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdda_ e.49.1.1 (A:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure