Psyllid ID: psy8860

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370----
MSMSDPIADMLTYIRNGQIVNKKKIIMPSSKIKIAIAKVLKDEGYIKDFFIIKCFKNKFELKILLKYYMNRPVIECLKRVSRPGLRIYKNKDNIPKIMNGLGLVIISTASGIITDRKARSMGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSMSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKGINRLMVHRTNLHIYANIISSNAKILISASTLEKEVRLTLNTKLGKGGNTFAASIIGQRIAKKALKIGITKVAFDRSGFRYHGRIKFLADAARKNGLNF
ccccccHHHHHHHHHccEEccccEEEEccHHHHHHHHHHHHHccccEEEEEEEEccccEEEEEEEEEcccccHHHHHHccccccEEEEEccccccHHHccccEEEEEcccccccccccccccccccccccccEEEEEccEEEEEcccEEEEEEEcccEEEEEcccEEEEEEccccHHHHHHHHHHHHHHHcccccccccEEEEEEEEEEEEEEEEcccEEEEEcccccccccccccccEEEcccccEEEEEEccHHHHHHHHHHHHcccccccccccccccEEEcccEEEEEccccccEEEEEHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccEEEEEcccccEEccHHHHHHHHHHHccccc
cccHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEEEEEcccccEEEEEEEcEccccEccccEEEccEccEccEEcHHHcccccccccEEEEEEccEEEEHHHHHHHccccEEcccccEEEEEccEEEEEEccEEEEEEcccccEEEEEccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEccccEEEEEccEEEEEccccccEEEcccccEEEEEEEccEEEEEEccHHHHHHHHHHHHccccccccccccEEEEEccHHHHHHHHHcHccHEEEEHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHccccc
MSMSDPIADMLTYIRNgqivnkkkiimpsSKIKIAIAKVLKDEGYIKDFFIIKCFKNKFELKILLKYYmnrpvieclkrvsrpglriyknkdnipkIMNGLGLVIISTASGIitdrkarsmgkmpifippnvevtlnsnkitlkgplgilkqnknnlvnikndsnVLYFTAINNSRIAKSMSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLIlgfshpilykipfdiicetpsQTEILIKGINKQAVGHVAAEIRRyykpepykgiNRLMVHRTNLHIYANIISSNAKILISASTLEKEVRLTLNTklgkggntfaASIIGQRIAKKALKIGITKvafdrsgfryhgRIKFLADAARKNGLNF
MSMSDPIADMLTYIRNGqivnkkkiimpssKIKIAIAKVLKDEGYIKDFFIIKCFKNKFELKILLKYYMNRPVIECLkrvsrpglriyknkdnipkimNGLGLVIISTASGIITDRKARSMGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSMSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKGINRLMVHRTNLHIYANIISSNAKILISASTLEKEVRLTLntklgkggntfaasiiGQRIAKKALKIGITKvafdrsgfryhGRIKFLADAARKNGLNF
MSMSDPIADMLTYIRNGQIVNkkkiimpsskikiaiakVLKDEGYIKDFFIIKCFKNKFELKILLKYYMNRPVIECLKRVSRPGLRIYKNKDNIPKIMNGLGLVIISTASGIITDRKARSMGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSMSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKGINRLMVHRTNLHIYANIISSNAKILISASTLEKEVRLTLNTKLGKGGNTFAASIIGQRIAKKALKIGITKVAFDRSGFRYHGRIKFLADAARKNGLNF
*******ADMLTYIRNGQIVNKKKIIMPSSKIKIAIAKVLKDEGYIKDFFIIKCFKNKFELKILLKYYMNRPVIECLKRVSRPGLRIYKNKDNIPKIMNGLGLVIISTASGIITDRKARSMGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSMSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKGINRLMVHRTNLHIYANIISSNAKILISASTLEKEVRLTLNTKLGKGGNTFAASIIGQRIAKKALKIGITKVAFDRSGFRYHGRIKFLAD*********
****DPIADMLTYIRNGQIVNKKKIIMPSSKIKIAIAKVLKDEGYIKDFFIIKCFKNKFELKILLKYYMNRPVIECLKRVSRPGLRIYKNKDNIPKIMNGLGLVIISTASGIITDRKARSMGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSMSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKGINRLMVHRTNLHIYANIISSNAKILISASTLEKEVRLTLNTKLGKGGNTFAASIIGQRIAKKALKIGITKVAFDRSGFRYHGRIKFLADAARKNGL**
MSMSDPIADMLTYIRNGQIVNKKKIIMPSSKIKIAIAKVLKDEGYIKDFFIIKCFKNKFELKILLKYYMNRPVIECLKRVSRPGLRIYKNKDNIPKIMNGLGLVIISTASGIITDRKARSMGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSMSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKGINRLMVHRTNLHIYANIISSNAKILISASTLEKEVRLTLNTKLGKGGNTFAASIIGQRIAKKALKIGITKVAFDRSGFRYHGRIKFLADAARKNGLNF
*SMSDPIADMLTYIRNGQIVNKKKIIMPSSKIKIAIAKVLKDEGYIKDFFIIKCFKNKFELKILLKYYMNRPVIECLKRVSRPGLRIYKNKDNIPKIMNGLGLVIISTASGIITDRKARSMGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSMSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKGINRLMVHRTNLHIYANIISSNAKILISASTLEKEVRLTLNTKLGKGGNTFAASIIGQRIAKKALKIGITKVAFDRSGFRYHGRIKFLADAARKN****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMSDPIADMLTYIRNGQIVNKKKIIMPSSKIKIAIAKVLKDEGYIKDFFIIKCFKNKFELKILLKYYMNRPVIECLKRVSRPGLRIYKNKDNIPKIMNGLGLVIISTASGIITDRKARSMGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSMSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKGINRLMVHRTNLHIYANIISSNAKILISASTLEKEVRLTLNTKLGKGGNTFAASIIGQRIAKKALKIGITKVAFDRSGFRYHGRIKFLADAARKNGLNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query374 2.2.26 [Sep-21-2011]
A6T3I9177 50S ribosomal protein L6 yes N/A 0.417 0.881 0.583 9e-51
A4G9S3177 50S ribosomal protein L6 yes N/A 0.417 0.881 0.589 4e-50
B2JI50176 50S ribosomal protein L6 yes N/A 0.414 0.880 0.557 2e-46
Q13TI5176 50S ribosomal protein L6 yes N/A 0.414 0.880 0.551 2e-46
B2T736176 50S ribosomal protein L6 yes N/A 0.414 0.880 0.544 3e-46
Q7NQG7177 50S ribosomal protein L6 yes N/A 0.417 0.881 0.551 1e-45
C1DAT2177 50S ribosomal protein L6 yes N/A 0.417 0.881 0.519 2e-45
Q5P317177 50S ribosomal protein L6 yes N/A 0.417 0.881 0.506 3e-45
Q2L270177 50S ribosomal protein L6 yes N/A 0.417 0.881 0.538 7e-45
Q2SU42176 50S ribosomal protein L6 yes N/A 0.414 0.880 0.551 8e-45
>sp|A6T3I9|RL6_JANMA 50S ribosomal protein L6 OS=Janthinobacterium sp. (strain Marseille) GN=rplF PE=3 SV=1 Back     alignment and function desciption
 Score =  201 bits (510), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 122/156 (78%)

Query: 121 MGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKS 180
           +GKMPI +P   E T+ + +IT+KGPLG L Q+ N LVNI+ND+  L F   N+SR A +
Sbjct: 4   VGKMPIALPSGAEATITAAQITVKGPLGSLTQSLNGLVNIENDNGTLNFKVANDSREANA 63

Query: 181 MSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIIC 240
           MSGT+R+++NNM+ GVTKGFEKKL L+GVG+RA  + + LNL LGFSHP+++++P  +  
Sbjct: 64  MSGTLRALVNNMVNGVTKGFEKKLTLVGVGYRAAAQGDKLNLSLGFSHPVVHQMPQGVKV 123

Query: 241 ETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKG 276
           ETP+QTEILIKGI++Q VG VAAE+R Y +PEPYKG
Sbjct: 124 ETPTQTEILIKGIDRQKVGQVAAEVRAYREPEPYKG 159
This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the tRNA binding site of the peptidyltransferase center.
Janthinobacterium sp. (strain Marseille) (taxid: 375286)
>sp|A4G9S3|RL6_HERAR 50S ribosomal protein L6 OS=Herminiimonas arsenicoxydans GN=rplF PE=3 SV=1 Back     alignment and function description
>sp|B2JI50|RL6_BURP8 50S ribosomal protein L6 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rplF PE=3 SV=1 Back     alignment and function description
>sp|Q13TI5|RL6_BURXL 50S ribosomal protein L6 OS=Burkholderia xenovorans (strain LB400) GN=rplF PE=3 SV=1 Back     alignment and function description
>sp|B2T736|RL6_BURPP 50S ribosomal protein L6 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rplF PE=3 SV=1 Back     alignment and function description
>sp|Q7NQG7|RL6_CHRVO 50S ribosomal protein L6 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rplF PE=3 SV=1 Back     alignment and function description
>sp|C1DAT2|RL6_LARHH 50S ribosomal protein L6 OS=Laribacter hongkongensis (strain HLHK9) GN=rplF PE=3 SV=1 Back     alignment and function description
>sp|Q5P317|RL6_AROAE 50S ribosomal protein L6 OS=Aromatoleum aromaticum (strain EbN1) GN=rplF PE=3 SV=1 Back     alignment and function description
>sp|Q2L270|RL6_BORA1 50S ribosomal protein L6 OS=Bordetella avium (strain 197N) GN=rplF PE=3 SV=1 Back     alignment and function description
>sp|Q2SU42|RL6_BURTA 50S ribosomal protein L6 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rplF PE=3 SV=1 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query374
TIGR_CMR|SO_0246177 SO_0246 "ribosomal protein L6" 0.417 0.881 0.474 1.1e-37
UNIPROTKB|P0AG55177 rplF "50S ribosomal subunit pr 0.417 0.881 0.461 3.5e-36
TIGR_CMR|CPS_0616177 CPS_0616 "ribosomal protein L6 0.417 0.881 0.487 1.9e-35
UNIPROTKB|Q9KNZ9177 rplF "50S ribosomal protein L6 0.417 0.881 0.474 5.2e-33
TIGR_CMR|VC_2581177 VC_2581 "ribosomal protein L6" 0.417 0.881 0.474 5.2e-33
TIGR_CMR|CBU_0253178 CBU_0253 "ribosomal protein L6 0.414 0.870 0.458 8.8e-31
TIGR_CMR|GSU_2842179 GSU_2842 "ribosomal protein L6 0.417 0.871 0.416 2.3e-30
TIGR_CMR|SPO_0500177 SPO_0500 "ribosomal protein L6 0.417 0.881 0.403 2.7e-29
TAIR|locus:2207190223 emb2394 "embryo defective 2394 0.454 0.762 0.389 1.9e-28
TIGR_CMR|CHY_2294182 CHY_2294 "ribosomal protein L6 0.417 0.857 0.403 2.4e-28
TIGR_CMR|SO_0246 SO_0246 "ribosomal protein L6" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
 Score = 404 (147.3 bits), Expect = 1.1e-37, P = 1.1e-37
 Identities = 74/156 (47%), Positives = 113/156 (72%)

Query:   121 MGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKS 180
             + K P+ IP  VEVTLN   +T+KG  G L +  NN VN+  ++ V+ F  +  +  A +
Sbjct:     4 VAKAPVSIPAGVEVTLNEQTLTVKGAKGSLTRVINNAVNVVIENGVIKFLPVEGAVGAWA 63

Query:   181 MSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIIC 240
              +GT R+++NNM++GV++GFE+KL+L+GVG+RAK+    ++L LGFSHP+++K+P  +  
Sbjct:    64 QAGTTRALVNNMVVGVSQGFERKLKLVGVGYRAKLVGADIDLTLGFSHPLVHKLPAGVTA 123

Query:   241 ETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKG 276
             E PSQT+I+++G++KQ +G VAAEIR Y  PEPYKG
Sbjct:   124 ECPSQTDIVLRGVDKQLIGQVAAEIRGYRPPEPYKG 159
GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0006412 "translation" evidence=ISS
UNIPROTKB|P0AG55 rplF "50S ribosomal subunit protein L6" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0616 CPS_0616 "ribosomal protein L6" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KNZ9 rplF "50S ribosomal protein L6" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2581 VC_2581 "ribosomal protein L6" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0253 CBU_0253 "ribosomal protein L6" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2842 GSU_2842 "ribosomal protein L6" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0500 SPO_0500 "ribosomal protein L6" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TAIR|locus:2207190 emb2394 "embryo defective 2394" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2294 CHY_2294 "ribosomal protein L6" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B1JU37RL6_BURCCNo assigned EC number0.54480.41440.8806yesN/A
Q3SLN4RL6_THIDANo assigned EC number0.52630.40370.8579yesN/A
Q2L270RL6_BORA1No assigned EC number0.53840.41710.8813yesN/A
B9MBV2RL6_ACIETNo assigned EC number0.50640.41710.8813yesN/A
A2SLE2RL6_METPPNo assigned EC number0.50640.41710.8813yesN/A
A9IHT3RL6_BORPDNo assigned EC number0.50640.41710.8813yesN/A
A4G9S3RL6_HERARNo assigned EC number0.58970.41710.8813yesN/A
Q62GM0RL6_BURMANo assigned EC number0.54480.41440.8806yesN/A
B1XSR6RL6_POLNSNo assigned EC number0.52560.41710.8813yesN/A
C1DAT2RL6_LARHHNo assigned EC number0.51920.41710.8813yesN/A
Q63Q26RL6_BURPSNo assigned EC number0.54480.41440.8806yesN/A
Q2YAY2RL6_NITMUNo assigned EC number0.50640.41710.8813yesN/A
A0K3P0RL6_BURCHNo assigned EC number0.54480.41440.8806yesN/A
A4JAQ5RL6_BURVGNo assigned EC number0.55760.41440.8806yesN/A
B8GV43RL6_THISHNo assigned EC number0.50640.41710.8813yesN/A
Q31IW7RL6_THICRNo assigned EC number0.51280.41710.8813yesN/A
Q5P317RL6_AROAENo assigned EC number0.50640.41710.8813yesN/A
B2JI50RL6_BURP8No assigned EC number0.55760.41440.8806yesN/A
Q3JMS8RL6_BURP1No assigned EC number0.54480.41440.8806yesN/A
A6T3I9RL6_JANMANo assigned EC number0.58330.41710.8813yesN/A
A3P098RL6_BURP0No assigned EC number0.54480.41440.8806yesN/A
Q39KF2RL6_BURS3No assigned EC number0.54480.41440.8806yesN/A
B2T736RL6_BURPPNo assigned EC number0.54480.41440.8806yesN/A
Q13TI5RL6_BURXLNo assigned EC number0.55120.41440.8806yesN/A
A1V888RL6_BURMSNo assigned EC number0.54480.41440.8806yesN/A
A9BRW6RL6_DELASNo assigned EC number0.51280.41710.8813yesN/A
A4SUX6RL6_POLSQNo assigned EC number0.51280.41710.8813yesN/A
Q1BRW3RL6_BURCANo assigned EC number0.54480.41440.8806yesN/A
B4E5D5RL6_BURCJNo assigned EC number0.54480.41440.8806yesN/A
B1YRP4RL6_BURA4No assigned EC number0.54480.41440.8806yesN/A
A9ADK8RL6_BURM1No assigned EC number0.53200.41440.8806yesN/A
Q7NQG7RL6_CHRVONo assigned EC number0.55120.41710.8813yesN/A
Q0BJ31RL6_BURCMNo assigned EC number0.54480.41440.8806yesN/A
A4XZ75RL6_PSEMYNo assigned EC number0.50640.41710.8813yesN/A
Q2SU42RL6_BURTANo assigned EC number0.55120.41440.8806yesN/A
A1W323RL6_ACISJNo assigned EC number0.50640.41710.8813yesN/A
A3MRW9RL6_BURM7No assigned EC number0.54480.41440.8806yesN/A
Q7VTB6RL6_BORPENo assigned EC number0.50640.41710.8813yesN/A
A2S7J1RL6_BURM9No assigned EC number0.54480.41440.8806yesN/A
A3NEG4RL6_BURP6No assigned EC number0.54480.41440.8806yesN/A
Q12G88RL6_POLSJNo assigned EC number0.51280.41710.8813yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
TIGR03654175 TIGR03654, L6_bact, ribosomal protein L6, bacteria 4e-75
PRK05498178 PRK05498, rplF, 50S ribosomal protein L6; Validate 1e-74
PRK00136130 PRK00136, rpsH, 30S ribosomal protein S8; Validate 1e-59
COG0097178 COG0097, RplF, Ribosomal protein L6P/L9E [Translat 2e-57
CHL00140178 CHL00140, rpl6, ribosomal protein L6; Validated 2e-52
pfam00410129 pfam00410, Ribosomal_S8, Ribosomal protein S8 7e-47
COG0096132 COG0096, RpsH, Ribosomal protein S8 [Translation, 8e-46
CHL00042132 CHL00042, rps8, ribosomal protein S8 3e-40
PRK05593117 PRK05593, rplR, 50S ribosomal protein L18; Reviewe 3e-39
COG0256125 COG0256, RplR, Ribosomal protein L18 [Translation, 3e-30
CHL00139109 CHL00139, rpl18, ribosomal protein L18; Validated 5e-29
pfam00861119 pfam00861, Ribosomal_L18p, Ribosomal L18p/L5e fami 3e-26
TIGR00060114 TIGR00060, L18_bact, ribosomal protein L18, bacter 1e-25
cd00432103 cd00432, Ribosomal_L18_L5e, Ribosomal L18/L5e: L18 1e-25
PRK05518180 PRK05518, rpl6p, 50S ribosomal protein L6P; Review 1e-19
TIGR03653170 TIGR03653, arch_L6P, archaeal ribosomal protein L6 2e-19
pfam0034776 pfam00347, Ribosomal_L6, Ribosomal protein L6 4e-15
PTZ00032211 PTZ00032, PTZ00032, 60S ribosomal protein L18; Pro 1e-14
PRK04034130 PRK04034, rps8p, 30S ribosomal protein S8P; Review 8e-10
pfam0034776 pfam00347, Ribosomal_L6, Ribosomal protein L6 8e-06
PTZ00179189 PTZ00179, PTZ00179, 60S ribosomal protein L9; Prov 2e-05
PTZ00158130 PTZ00158, PTZ00158, 40S ribosomal protein S15A; Pr 2e-05
PTZ00027190 PTZ00027, PTZ00027, 60S ribosomal protein L6; Prov 5e-05
>gnl|CDD|213843 TIGR03654, L6_bact, ribosomal protein L6, bacterial type Back     alignment and domain information 
 Score =  230 bits (588), Expect = 4e-75
 Identities = 81/155 (52%), Positives = 114/155 (73%)

Query: 122 GKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSM 181
           GK PI IP  VEVT++ N +T+KGP G L +  +  V +K +   L  +  N+S+ A+++
Sbjct: 4   GKKPIAIPAGVEVTIDGNVVTVKGPKGELSRTLHPGVTVKVEDGQLTVSRPNDSKEARAL 63

Query: 182 SGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICE 241
            GT R++INNM+IGV++GFEKKL+++GVG+RA+++   LNL LG+SHP+ Y+IP  I  E
Sbjct: 64  HGTTRALINNMVIGVSEGFEKKLEIVGVGYRAQLQGKKLNLSLGYSHPVEYEIPEGITVE 123

Query: 242 TPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKG 276
            P  TEI++KGI+KQ VG VAAEIR + KPEPYKG
Sbjct: 124 VPKPTEIVVKGIDKQLVGQVAAEIRAFRKPEPYKG 158

[Protein synthesis, Ribosomal proteins: synthesis and modification]. Length = 175
>gnl|CDD|235495 PRK05498, rplF, 50S ribosomal protein L6; Validated Back     alignment and domain information
>gnl|CDD|234658 PRK00136, rpsH, 30S ribosomal protein S8; Validated Back     alignment and domain information
>gnl|CDD|223175 COG0097, RplF, Ribosomal protein L6P/L9E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177062 CHL00140, rpl6, ribosomal protein L6; Validated Back     alignment and domain information
>gnl|CDD|215906 pfam00410, Ribosomal_S8, Ribosomal protein S8 Back     alignment and domain information
>gnl|CDD|223174 COG0096, RpsH, Ribosomal protein S8 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|214344 CHL00042, rps8, ribosomal protein S8 Back     alignment and domain information
>gnl|CDD|235524 PRK05593, rplR, 50S ribosomal protein L18; Reviewed Back     alignment and domain information
>gnl|CDD|223334 COG0256, RplR, Ribosomal protein L18 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|214373 CHL00139, rpl18, ribosomal protein L18; Validated Back     alignment and domain information
>gnl|CDD|216159 pfam00861, Ribosomal_L18p, Ribosomal L18p/L5e family Back     alignment and domain information
>gnl|CDD|213499 TIGR00060, L18_bact, ribosomal protein L18, bacterial type Back     alignment and domain information
>gnl|CDD|238246 cd00432, Ribosomal_L18_L5e, Ribosomal L18/L5e: L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit Back     alignment and domain information
>gnl|CDD|235496 PRK05518, rpl6p, 50S ribosomal protein L6P; Reviewed Back     alignment and domain information
>gnl|CDD|234296 TIGR03653, arch_L6P, archaeal ribosomal protein L6P Back     alignment and domain information
>gnl|CDD|215872 pfam00347, Ribosomal_L6, Ribosomal protein L6 Back     alignment and domain information
>gnl|CDD|240235 PTZ00032, PTZ00032, 60S ribosomal protein L18; Provisional Back     alignment and domain information
>gnl|CDD|179721 PRK04034, rps8p, 30S ribosomal protein S8P; Reviewed Back     alignment and domain information
>gnl|CDD|215872 pfam00347, Ribosomal_L6, Ribosomal protein L6 Back     alignment and domain information
>gnl|CDD|140206 PTZ00179, PTZ00179, 60S ribosomal protein L9; Provisional Back     alignment and domain information
>gnl|CDD|185487 PTZ00158, PTZ00158, 40S ribosomal protein S15A; Provisional Back     alignment and domain information
>gnl|CDD|240234 PTZ00027, PTZ00027, 60S ribosomal protein L6; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 374
CHL00140178 rpl6 ribosomal protein L6; Validated 100.0
TIGR03654175 L6_bact ribosomal protein L6, bacterial type. 100.0
PRK05498178 rplF 50S ribosomal protein L6; Validated 100.0
COG0097178 RplF Ribosomal protein L6P/L9E [Translation, ribos 100.0
PRK05518180 rpl6p 50S ribosomal protein L6P; Reviewed 100.0
TIGR03653170 arch_L6P archaeal ribosomal protein L6P. Members o 100.0
KOG3254|consensus211 100.0
PTZ00027190 60S ribosomal protein L6; Provisional 100.0
PTZ00179189 60S ribosomal protein L9; Provisional 100.0
COG0096132 RpsH Ribosomal protein S8 [Translation, ribosomal 100.0
CHL00042132 rps8 ribosomal protein S8 100.0
PRK00136130 rpsH 30S ribosomal protein S8; Validated 100.0
PF00410129 Ribosomal_S8: Ribosomal protein S8; InterPro: IPR0 100.0
CHL00139109 rpl18 ribosomal protein L18; Validated 100.0
PTZ00158130 40S ribosomal protein S15A; Provisional 100.0
PTZ00032211 60S ribosomal protein L18; Provisional 100.0
COG0256125 RplR Ribosomal protein L18 [Translation, ribosomal 100.0
PLN00146130 40S ribosomal protein S15a; Provisional 100.0
TIGR00060114 L18_bact ribosomal protein L18, bacterial type. Th 100.0
PRK05593117 rplR 50S ribosomal protein L18; Reviewed 100.0
PRK04034130 rps8p 30S ribosomal protein S8P; Reviewed 99.97
PF00861119 Ribosomal_L18p: Ribosomal L18p/L5e family; InterPr 99.97
cd00432103 Ribosomal_L18_L5e Ribosomal L18/L5e: L18 (L5e) is 99.96
PRK08569193 rpl18p 50S ribosomal protein L18P; Reviewed 99.96
KOG1754|consensus130 99.86
PF0034777 Ribosomal_L6: Ribosomal protein L6; InterPro: IPR0 99.65
KOG3255|consensus179 99.64
PTZ00069 300 60S ribosomal protein L5; Provisional 99.35
KOG3333|consensus188 99.33
PF0034777 Ribosomal_L6: Ribosomal protein L6; InterPro: IPR0 98.14
TIGR03632108 bact_S11 30S ribosomal protein S11. This model des 97.44
PF00411110 Ribosomal_S11: Ribosomal protein S11; InterPro: IP 97.39
CHL00041116 rps11 ribosomal protein S11 97.3
PRK05309128 30S ribosomal protein S11; Validated 96.93
PTZ00090233 40S ribosomal protein S11; Provisional 96.76
PTZ00129149 40S ribosomal protein S14; Provisional 96.37
TIGR03628114 arch_S11P archaeal ribosomal protein S11P. This mo 96.13
PRK09607132 rps11p 30S ribosomal protein S11P; Reviewed 95.97
KOG0875|consensus264 95.86
COG0100129 RpsK Ribosomal protein S11 [Translation, ribosomal 94.81
KOG0408|consensus190 89.7
>CHL00140 rpl6 ribosomal protein L6; Validated Back     alignment and domain information 
Probab=100.00  E-value=1.5e-55  Score=399.06  Aligned_cols=168  Identities=43%  Similarity=0.724  Sum_probs=164.6

Q ss_pred             cccCCcceeecCCCeEEEEeccEEEEEeCCeEEEEEcCCCeEEEEeCCEEEEEEcCCchhHHHHHHHHHHHHhhcceecc
Q psy8860         118 ARSMGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSMSGTMRSIINNMIIGVT  197 (374)
Q Consensus       118 a~~ig~~~I~IP~~V~v~~~~~~i~vkGp~G~l~~~l~~~v~i~~~~~~l~i~~~~~~k~~~a~~gT~rsli~Nmi~GVt  197 (374)
                      |+|+|+.||+||+||+|+++++.|+|+||+|+|+++|++.+++..++|.+.+..|+++++++|+|||+||||+|||+||+
T Consensus         1 msrig~~~I~IP~~V~v~i~~~~v~vkGp~G~l~~~~~~~v~i~~~~~~i~v~~~~~~k~~~a~~gt~~slI~Nmi~GVt   80 (178)
T CHL00140          1 MSRIGKLPIKIPDNVNVSIDDQIIKVKGPKGTLSRKIPDLITIEIQDNSLFVSKKDESKKARALHGLYRTLINNMVIGVS   80 (178)
T ss_pred             CCcccceeeecCCCCEEEEECCEEEEECCCEEEEEECCCCeEEEEeCCEEEEEcCCCCHHHHHHHHHHHHHHHHHHhhcc
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cceEEEEEEEEEEEEEEEeCcEEEEEecceeeEEEeCCCCcEEEcccCCEEEEEecchhhhhhHHHHHHhhcCCCCcCCc
Q psy8860         198 KGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKGI  277 (374)
Q Consensus       198 ~Gf~~~L~lvGvGyr~~~~g~~L~l~LG~Sh~i~~~IP~gV~v~~~~~t~I~l~G~dke~Vgq~Aa~Ir~~r~pepYkgk  277 (374)
                      +||+++|+++|+||||.++|+.|.++||||||+.++||+||+|+|+++|+|+|+|+|||+|+||||+||+||||||||||
T Consensus        81 ~Gf~~~L~lvGvGyr~~~~g~~l~l~LG~sh~i~~~IP~gv~v~~~~~t~I~i~G~dke~Vgq~AA~Ir~~r~pepYKGK  160 (178)
T CHL00140         81 EGFEKKLELQGVGYRAQVQGKDLILNLGYSHPVKIKIPPGISVEVENNTNITIKGIDKELVGQFAAKIRSVRPPEPYKGK  160 (178)
T ss_pred             cCceEEEEEEEEEEEEEEeCCcEEEEecCCeeEEEECCCCeEEEeCCCCEEEEEECCHHHHHHHHHHHhccCCCCCcCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeeeecc
Q psy8860         278 NRLMVHRT  285 (374)
Q Consensus       278 giL~V~eS  285 (374)
                      ||+|.+|.
T Consensus       161 GI~y~~e~  168 (178)
T CHL00140        161 GIRYKGEV  168 (178)
T ss_pred             cEeECCEE
Confidence            99998873

>TIGR03654 L6_bact ribosomal protein L6, bacterial type Back     alignment and domain information
>PRK05498 rplF 50S ribosomal protein L6; Validated Back     alignment and domain information
>COG0097 RplF Ribosomal protein L6P/L9E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05518 rpl6p 50S ribosomal protein L6P; Reviewed Back     alignment and domain information
>TIGR03653 arch_L6P archaeal ribosomal protein L6P Back     alignment and domain information
>KOG3254|consensus Back     alignment and domain information
>PTZ00027 60S ribosomal protein L6; Provisional Back     alignment and domain information
>PTZ00179 60S ribosomal protein L9; Provisional Back     alignment and domain information
>COG0096 RpsH Ribosomal protein S8 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00042 rps8 ribosomal protein S8 Back     alignment and domain information
>PRK00136 rpsH 30S ribosomal protein S8; Validated Back     alignment and domain information
>PF00410 Ribosomal_S8: Ribosomal protein S8; InterPro: IPR000630 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>CHL00139 rpl18 ribosomal protein L18; Validated Back     alignment and domain information
>PTZ00158 40S ribosomal protein S15A; Provisional Back     alignment and domain information
>PTZ00032 60S ribosomal protein L18; Provisional Back     alignment and domain information
>COG0256 RplR Ribosomal protein L18 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00146 40S ribosomal protein S15a; Provisional Back     alignment and domain information
>TIGR00060 L18_bact ribosomal protein L18, bacterial type Back     alignment and domain information
>PRK05593 rplR 50S ribosomal protein L18; Reviewed Back     alignment and domain information
>PRK04034 rps8p 30S ribosomal protein S8P; Reviewed Back     alignment and domain information
>PF00861 Ribosomal_L18p: Ribosomal L18p/L5e family; InterPro: IPR005484 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd00432 Ribosomal_L18_L5e Ribosomal L18/L5e: L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit Back     alignment and domain information
>PRK08569 rpl18p 50S ribosomal protein L18P; Reviewed Back     alignment and domain information
>KOG1754|consensus Back     alignment and domain information
>PF00347 Ribosomal_L6: Ribosomal protein L6; InterPro: IPR020040 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3255|consensus Back     alignment and domain information
>PTZ00069 60S ribosomal protein L5; Provisional Back     alignment and domain information
>KOG3333|consensus Back     alignment and domain information
>PF00347 Ribosomal_L6: Ribosomal protein L6; InterPro: IPR020040 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR03632 bact_S11 30S ribosomal protein S11 Back     alignment and domain information
>PF00411 Ribosomal_S11: Ribosomal protein S11; InterPro: IPR001971 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>CHL00041 rps11 ribosomal protein S11 Back     alignment and domain information
>PRK05309 30S ribosomal protein S11; Validated Back     alignment and domain information
>PTZ00090 40S ribosomal protein S11; Provisional Back     alignment and domain information
>PTZ00129 40S ribosomal protein S14; Provisional Back     alignment and domain information
>TIGR03628 arch_S11P archaeal ribosomal protein S11P Back     alignment and domain information
>PRK09607 rps11p 30S ribosomal protein S11P; Reviewed Back     alignment and domain information
>KOG0875|consensus Back     alignment and domain information
>COG0100 RpsK Ribosomal protein S11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0408|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
1p85_E176 Real Space Refined Coordinates Of The 50s Subunit F 3e-40
1vs6_G177 Crystal Structure Of The Bacterial Ribosome From Es 3e-40
2gya_E167 Structure Of The 50s Subunit Of A Pre-Translocation 5e-40
1rl6_A177 Ribosomal Protein L6 Length = 177 2e-32
1eg0_J171 Fitting Of Components With Known Structure Into An 2e-32
487d_J164 Seven Ribosomal Proteins Fitted To A Cryo-Electron 4e-31
3bbo_I223 Homology Model For The Spinach Chloroplast 50s Subu 3e-30
1vs5_H130 Crystal Structure Of The Bacterial Ribosome From Es 6e-30
1p6g_H129 Real Space Refined Coordinates Of The 30s Subunit F 2e-29
2gy9_H127 Structure Of The 30s Subunit Of A Pre-Translocation 9e-29
1nwx_E185 Complex Of The Large Ribosomal Subunit From Deinoco 4e-24
1nkw_E212 Crystal Structure Of The Large Ribosomal Subunit Fr 4e-24
1pnu_E177 Crystal Structure Of A Streptomycin Dependent Ribos 5e-24
2j01_H180 Structure Of The Thermus Thermophilus 70s Ribosome 8e-23
3tve_H170 Crystal Structure Analysis Of Ribosomal Decoding. T 9e-23
1sei_A130 Structure Of 30s Ribosomal Protein S8 Length = 130 2e-22
3fin_H160 T. Thermophilus 70s Ribosome In Complex With Mrna, 4e-20
3pyo_G159 Crystal Structure Of A Complex Containing Domain 3 4e-20
3fik_O116 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 7e-18
1p85_M117 Real Space Refined Coordinates Of The 50s Subunit F 8e-18
1ovy_A120 Solution Structure Of Ribosomal Protein L18 From Ba 3e-17
2gya_M113 Structure Of The 50s Subunit Of A Pre-Translocation 7e-17
3bbo_Q161 Homology Model For The Spinach Chloroplast 50s Subu 3e-16
1i94_H138 Crystal Structures Of The Small Ribosomal Subunit W 8e-16
1fka_H138 Fitting Of Components With Known Structure Into An 4e-15
1an7_A136 Ribosomal Protein S8 From Thermus Thermophilus Leng 7e-15
1ily_A90 Solution Structure Of Ribosomal Protein L18 Of Ther 6e-14
3bbn_H134 Homology Model For The Spinach Chloroplast 30s Subu 8e-14
2j01_S112 Structure Of The Thermus Thermophilus 70s Ribosome 2e-13
3mrz_O111 Recognition Of The Amber Stop Codon By Release Fact 2e-13
3fin_S99 T. Thermophilus 70s Ribosome In Complex With Mrna, 4e-12
3pyo_O98 Crystal Structure Of A Complex Containing Domain 3 2e-11
3rf2_A168 Crystal Structure Of 30s Ribosomal Protein S8 From 8e-09
3j21_F184 Promiscuous Behavior Of Proteins In Archaeal Riboso 2e-08
1nkw_M114 Crystal Structure Of The Large Ribosomal Subunit Fr 6e-08
1nwx_M113 Complex Of The Large Ribosomal Subunit From Deinoco 6e-08
1pnu_M111 Crystal Structure Of A Streptomycin Dependent Ribos 7e-08
1s72_E178 Refined Crystal Structure Of The Haloarcula Marismo 2e-05
1ffk_1177 Crystal Structure Of The Large Ribosomal Subunit Fr 5e-05
3g4s_E172 Co-Crystal Structure Of Tiamulin Bound To The Large 5e-05
1s1i_H191 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 6e-04
3jyw_H179 Structure Of The 60s Proteins For Eukaryotic Riboso 6e-04
>pdb|1P85|E Chain E, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 176 Back     alignment and structure 
Iteration: 1

 Score =  162 bits (409), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 108/156 (69%)
Query: 121 MGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKS 180
           + K P+ +P  V+V +N   IT+KG  G L +  N+ V +K+  N L F   +      +
Sbjct: 3   VAKAPVVVPAGVDVKINGQVITIKGKNGELTRTLNDAVEVKHADNTLTFGPRDGYADGWA 62
Query: 181 MSGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIIC 240
            +GT R+++N+M+IGVT+GF KKLQL+GVG+RA ++ N +NL LGFSHP+ +++P  I  
Sbjct: 63  QAGTARALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVINLSLGFSHPVDHQLPAGITA 122
Query: 241 ETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKG 276
           E P+QTEI++KG +KQ +G VAA++R Y +PEPYKG
Sbjct: 123 ECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKG 158
>pdb|1VS6|G Chain G, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 177 Back     alignment and structure
>pdb|2GYA|E Chain E, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 167 Back     alignment and structure
>pdb|1RL6|A Chain A, Ribosomal Protein L6 Length = 177 Back     alignment and structure
>pdb|487D|J Chain J, Seven Ribosomal Proteins Fitted To A Cryo-Electron Microscopic Map Of The Large 50s Subunit At 7.5 Angstroms Resolution Length = 164 Back     alignment and structure
>pdb|3BBO|I Chain I, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 223 Back     alignment and structure
>pdb|1VS5|H Chain H, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 130 Back     alignment and structure
>pdb|1P6G|H Chain H, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 129 Back     alignment and structure
>pdb|2GY9|H Chain H, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 127 Back     alignment and structure
>pdb|1NWX|E Chain E, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Abt-773 Length = 185 Back     alignment and structure
>pdb|1NKW|E Chain E, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 212 Back     alignment and structure
>pdb|1PNU|E Chain E, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 177 Back     alignment and structure
>pdb|2J01|H Chain H, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 180 Back     alignment and structure
>pdb|3TVE|H Chain H, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 50s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Cognate Trna-Leu Complex Length = 170 Back     alignment and structure
>pdb|1SEI|A Chain A, Structure Of 30s Ribosomal Protein S8 Length = 130 Back     alignment and structure
>pdb|3FIN|H Chain H, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 160 Back     alignment and structure
>pdb|3PYO|G Chain G, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 159 Back     alignment and structure
>pdb|3FIK|O Chain O, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 50s Subunit. Length = 116 Back     alignment and structure
>pdb|1P85|M Chain M, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 117 Back     alignment and structure
>pdb|1OVY|A Chain A, Solution Structure Of Ribosomal Protein L18 From Bacillus Stearothermophilus Length = 120 Back     alignment and structure
>pdb|2GYA|M Chain M, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 113 Back     alignment and structure
>pdb|3BBO|Q Chain Q, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 161 Back     alignment and structure
>pdb|1I94|H Chain H, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 138 Back     alignment and structure
>pdb|1FKA|H Chain H, Structure Of Functionally Activated Small Ribosomal Subunit At 3.3 A Resolution Length = 138 Back     alignment and structure
>pdb|1AN7|A Chain A, Ribosomal Protein S8 From Thermus Thermophilus Length = 136 Back     alignment and structure
>pdb|1ILY|A Chain A, Solution Structure Of Ribosomal Protein L18 Of Thermus Thermophilus Length = 90 Back     alignment and structure
>pdb|3BBN|H Chain H, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 134 Back     alignment and structure
>pdb|2J01|S Chain S, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 112 Back     alignment and structure
>pdb|3MRZ|O Chain O, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3ms0. Molecule A In The Same Asymmetric Unit Is Deposited As 3mr8 (50s) And 3ms1 (30s). Length = 111 Back     alignment and structure
>pdb|3FIN|S Chain S, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 99 Back     alignment and structure
>pdb|3PYO|O Chain O, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 98 Back     alignment and structure
>pdb|3RF2|A Chain A, Crystal Structure Of 30s Ribosomal Protein S8 From Aquifex Aeolicus Length = 168 Back     alignment and structure
>pdb|3J21|F Chain F, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 184 Back     alignment and structure
>pdb|1NKW|M Chain M, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 114 Back     alignment and structure
>pdb|1NWX|M Chain M, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Abt-773 Length = 113 Back     alignment and structure
>pdb|1PNU|M Chain M, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 111 Back     alignment and structure
>pdb|1S72|E Chain E, Refined Crystal Structure Of The Haloarcula Marismortui Large Ribosomal Subunit At 2.4 Angstrom Resolution Length = 178 Back     alignment and structure
>pdb|1FFK|1 Chain 1, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 177 Back     alignment and structure
>pdb|3G4S|E Chain E, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 172 Back     alignment and structure
>pdb|1S1I|H Chain H, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h. Length = 191 Back     alignment and structure
>pdb|3JYW|H Chain H, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 179 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query374
3r8s_G176 50S ribosomal protein L6; protein biosynthesis, RN 9e-74
1rl6_A177 Protein (ribosomal protein L6); RNA-binding protei 2e-71
3bbo_I223 Ribosomal protein L6; large ribosomal subunit, spi 5e-71
3v2d_H180 50S ribosomal protein L6; ribosome associated inhi 6e-69
1nkw_E212 50S ribosomal protein L6; ribosome, large subunit, 9e-69
2zjr_E185 50S ribosomal protein L6; ribosome, large ribosoma 2e-68
1s03_H129 30S ribosomal protein S8; protein-RNA complex, SPC 2e-59
1sei_A130 Ribosomal protein S8; prokaryotic, rRNA-binding; 1 7e-58
2vqe_H138 30S ribosomal protein S8, 30S ribosomal protein S6 1e-55
3bbn_H134 Ribosomal protein S8; small ribosomal subunit, spi 6e-54
3rf2_A168 30S ribosomal protein S8; RNA-binding protein, hyp 7e-51
1vq8_E178 50S ribosomal protein L6P; ribosome 50S, protein-p 3e-50
1i6u_A130 30S ribosomal protein S8P; protein-RNA interaction 5e-48
3u5c_W130 40S ribosomal protein S22-A; translation, ribosome 2e-45
2xzm_H130 Ribosomal protein S8 containing protein; ribosome, 1e-44
3u5e_H191 L8, RP24, YL11, 60S ribosomal protein L9-A; transl 5e-43
3r8s_O116 50S ribosomal protein L18; protein biosynthesis, R 9e-43
3iz5_F190 60S ribosomal protein L9 (L6P); eukaryotic ribosom 4e-41
2zkr_e192 60S ribosomal protein L9; protein-RNA complex, 60S 6e-40
3bbo_Q161 Ribosomal protein L18; large ribosomal subunit, sp 8e-39
4a17_E188 RPL9, 60S ribosomal protein L9; eukaryotic ribosom 8e-38
1ovy_A120 50S ribosomal protein L18; ribosome; NMR {Geobacil 1e-37
2zjr_L114 50S ribosomal protein L18; ribosome, large ribosom 2e-36
3v2d_S112 50S ribosomal protein L18; ribosome associated inh 3e-36
1vq8_N187 50S ribosomal protein L18P; ribosome 50S, protein- 3e-21
2cql_A100 OK/SW-CL.103, 60S ribosomal protein L9; N-terminal 2e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
>3r8s_G 50S ribosomal protein L6; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 1p85_E 1p86_E 2awb_G 2aw4_G 2i2v_G 2j28_G 2i2t_G* 2qao_G* 2qba_G* 2qbc_G* 2qbe_G 2qbg_G 2qbi_G* 2qbk_G* 2qov_G 2qox_G 2qoz_G* 2qp1_G* 2rdo_G 2vhm_G ... Length = 176 Back     alignment and structure
 Score =  225 bits (577), Expect = 9e-74
 Identities = 72/155 (46%), Positives = 107/155 (69%)

Query: 122 GKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSM 181
            K P+ +P  V+V +N   IT+KG  G L +  N+ V +K+  N L F   +      + 
Sbjct: 4   AKAPVVVPAGVDVKINGQVITIKGKNGELTRTLNDAVEVKHADNTLTFGPRDGYADGWAQ 63

Query: 182 SGTMRSIINNMIIGVTKGFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICE 241
           +GT R+++N+M+IGVT+GF KKLQL+GVG+RA ++ N +NL LGFSHP+ +++P  I  E
Sbjct: 64  AGTARALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVINLSLGFSHPVDHQLPAGITAE 123

Query: 242 TPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKG 276
            P+QTEI++KG +KQ +G VAA++R Y +PEPYKG
Sbjct: 124 CPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKG 158
>1rl6_A Protein (ribosomal protein L6); RNA-binding protein, gentamicin resistance, alpha/beta protein; 2.00A {Geobacillus stearothermophilus} SCOP: d.141.1.1 d.141.1.1 PDB: 1giy_H 1ml5_h* 1c04_B 1yl3_H 2b66_H 2b9n_H 2b9p_H 1eg0_J 487d_J Length = 177 Back     alignment and structure
>3bbo_I Ribosomal protein L6; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 223 Back     alignment and structure
>3v2d_H 50S ribosomal protein L6; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_F 2hgj_H 2hgq_H 2hgu_H 1vsa_F 2j03_H 2jl6_H 2jl8_H 2v47_H 2v49_H 2wdi_H 2wdj_H 2wdl_H 2wdn_H 2wh2_H 2wh4_H 2wrj_H 2wrl_H 2wro_H 2wrr_H ... Length = 180 Back     alignment and structure
>1nkw_E 50S ribosomal protein L6; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} SCOP: i.1.1.2 PDB: 1sm1_E* Length = 212 Back     alignment and structure
>2zjr_E 50S ribosomal protein L6; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: d.141.1.1 d.141.1.1 PDB: 1nwx_E* 1xbp_E* 2zjp_E* 2zjq_E 1nwy_E 3cf5_E* 3dll_E* 3pio_E* 3pip_E* 1pnu_E 1pny_E 1vor_H 1vou_H 1vow_H 1voy_H 1vp0_H Length = 185 Back     alignment and structure
>1s03_H 30S ribosomal protein S8; protein-RNA complex, SPC operon, transcription-RN; 2.70A {Escherichia coli} SCOP: d.140.1.1 PDB: 1p6g_H 1p87_H 2avy_H 2aw7_H 2i2p_H 2i2u_H 2qal_H* 2qan_H* 2qb9_H* 2qbb_H* 2qbd_H 2qbf_H 2qbh_H* 2qbj_H* 2qou_H* 2qow_H* 2qoy_H* 2qp0_H* 2vho_H 2vhp_H ... Length = 129 Back     alignment and structure
>1sei_A Ribosomal protein S8; prokaryotic, rRNA-binding; 1.90A {Geobacillus stearothermophilus} SCOP: d.140.1.1 Length = 130 Back     alignment and structure
>2vqe_H 30S ribosomal protein S8, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: d.140.1.1 PDB: 1eg0_E* 1fka_H 1gix_K* 1hnw_H* 1hnx_H* 1hnz_H* 1hr0_H 1ibk_H* 1ibl_H* 1ibm_H 1j5e_H 1jgo_K* 1jgp_K* 1jgq_K* 1ml5_K* 1n32_H* 1n33_H* 1n34_H 1n36_H 1pns_H ... Length = 138 Back     alignment and structure
>3bbn_H Ribosomal protein S8; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 134 Back     alignment and structure
>3rf2_A 30S ribosomal protein S8; RNA-binding protein, hyperthermophilic bacterium, ribosome; 2.16A {Aquifex aeolicus} Length = 168 Back     alignment and structure
>1vq8_E 50S ribosomal protein L6P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.141.1.1 d.141.1.1 PDB: 1vq4_E* 1vq5_E* 1vq6_E* 1vq7_E* 1s72_E* 1vq9_E* 1vqk_E* 1vql_E* 1vqm_E* 1vqn_E* 1vqo_E* 1vqp_E* 1yhq_E* 1yi2_E* 1yij_E* 1yit_E* 1yj9_E* 1yjn_E* 1yjw_E* 2otj_E* ... Length = 178 Back     alignment and structure
>1i6u_A 30S ribosomal protein S8P; protein-RNA interactions, ribosome, RNA, X-RAY crystallography; 2.60A {Methanocaldococcus jannaschii} SCOP: d.140.1.1 Length = 130 Back     alignment and structure
>3u5c_W 40S ribosomal protein S22-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_H 3o30_O 3o2z_O 3u5g_W 1s1h_H 3jyv_H* 3iz6_H 2zkq_h Length = 130 Back     alignment and structure
>2xzm_H Ribosomal protein S8 containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_H Length = 130 Back     alignment and structure
>3u5e_H L8, RP24, YL11, 60S ribosomal protein L9-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_F 1s1i_H 3izs_F* 3j16_F 3o5h_I 3o58_I 3u5i_H 3jyw_H Length = 191 Back     alignment and structure
>3r8s_O 50S ribosomal protein L18; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 3fik_O 2wwq_O 3oat_O* 3oas_O* 3ofd_O 3ofc_O 3ofr_O* 3ofz_O* 3og0_O 3ofq_O 3r8t_O 3i1n_O 1p85_M 1p86_M 1vs8_O 1vs6_O 2aw4_O 2awb_O 1vt2_O 2i2v_O ... Length = 116 Back     alignment and structure
>2zkr_e 60S ribosomal protein L9; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 192 Back     alignment and structure
>3bbo_Q Ribosomal protein L18; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 161 Back     alignment and structure
>4a17_E RPL9, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_E 4a1c_E 4a1e_E Length = 188 Back     alignment and structure
>1ovy_A 50S ribosomal protein L18; ribosome; NMR {Geobacillus stearothermophilus} SCOP: c.55.4.1 Length = 120 Back     alignment and structure
>2zjr_L 50S ribosomal protein L18; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: c.55.4.1 PDB: 1sm1_M* 2zjp_L* 2zjq_L 1nkw_M 3cf5_L* 3dll_L* 3pio_L* 3pip_L* 1nwy_M* 1nwx_M* 1xbp_M* 1pnu_M 1pny_M 1vor_P 1vou_P 1vow_P 1voy_P 1vp0_P Length = 114 Back     alignment and structure
>3v2d_S 50S ribosomal protein L18; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_M 2hgj_R 2hgq_R 2hgu_R 1vsa_M 2j03_S 2jl6_S 2jl8_S 2v47_S 2v49_S 2wdi_S 2wdj_S 2wdl_S 2wdn_S 2wh2_S 2wh4_S 2wrj_S 2wrl_S 2wro_S 2wrr_S ... Length = 112 Back     alignment and structure
>1vq8_N 50S ribosomal protein L18P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.55.4.1 PDB: 1vq4_N* 1vq5_N* 1vq6_N* 1vq7_N* 1s72_N* 1vq9_N* 1vqk_N* 1vql_N* 1vqm_N* 1vqn_N* 1vqo_N* 1vqp_N* 1yhq_N* 1yi2_N* 1yij_N* 1yit_N* 1yj9_N* 1yjn_N* 1yjw_N* 2otj_N* ... Length = 187 Back     alignment and structure
>2cql_A OK/SW-CL.103, 60S ribosomal protein L9; N-terminal domain, alpha and beta (A+B), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.141.1.1 Length = 100 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query374
1rl6_A177 Protein (ribosomal protein L6); RNA-binding protei 100.0
3v2d_H180 50S ribosomal protein L6; ribosome associated inhi 100.0
1nkw_E212 50S ribosomal protein L6; ribosome, large subunit, 100.0
3r8s_G176 50S ribosomal protein L6; protein biosynthesis, RN 100.0
3bbo_I223 Ribosomal protein L6; large ribosomal subunit, spi 100.0
2zjr_E185 50S ribosomal protein L6; ribosome, large ribosoma 100.0
1vq8_E178 50S ribosomal protein L6P; ribosome 50S, protein-p 100.0
3j21_F184 50S ribosomal protein L6P; archaea, archaeal, KINK 100.0
2zkr_e192 60S ribosomal protein L9; protein-RNA complex, 60S 100.0
3iz5_F190 60S ribosomal protein L9 (L6P); eukaryotic ribosom 100.0
4a17_E188 RPL9, 60S ribosomal protein L9; eukaryotic ribosom 100.0
3u5e_H191 L8, RP24, YL11, 60S ribosomal protein L9-A; transl 100.0
1sei_A130 Ribosomal protein S8; prokaryotic, rRNA-binding; 1 100.0
1s03_H129 30S ribosomal protein S8; protein-RNA complex, SPC 100.0
2vqe_H138 30S ribosomal protein S8, 30S ribosomal protein S6 100.0
3bbn_H134 Ribosomal protein S8; small ribosomal subunit, spi 100.0
3rf2_A168 30S ribosomal protein S8; RNA-binding protein, hyp 100.0
1i6u_A130 30S ribosomal protein S8P; protein-RNA interaction 100.0
2xzm_H130 Ribosomal protein S8 containing protein; ribosome, 100.0
3r8s_O116 50S ribosomal protein L18; protein biosynthesis, R 100.0
3bbo_Q161 Ribosomal protein L18; large ribosomal subunit, sp 100.0
3u5c_W130 40S ribosomal protein S22-A; translation, ribosome 100.0
3v2d_S112 50S ribosomal protein L18; ribosome associated inh 100.0
1ovy_A120 50S ribosomal protein L18; ribosome; NMR {Geobacil 99.98
2zjr_L114 50S ribosomal protein L18; ribosome, large ribosom 99.97
1vq8_N187 50S ribosomal protein L18P; ribosome 50S, protein- 99.96
3j21_O203 50S ribosomal protein L18P; archaea, archaeal, KIN 99.95
2zkr_n 297 60S ribosomal protein L5; protein-RNA complex, 60S 99.91
2cql_A100 OK/SW-CL.103, 60S ribosomal protein L9; N-terminal 99.91
3u5e_D 297 60S ribosomal protein L5; translation, ribosome, r 99.86
4a17_M 301 RPL5, 60S ribosomal protein L5; eukaryotic ribosom 99.85
3iz5_Q 304 60S ribosomal protein L5 (L18P); eukaryotic riboso 99.78
2vqe_K129 30S ribosomal protein S11, 30S ribosomal protein S 96.87
3r8n_K117 30S ribosomal protein S11; protein biosynthesis, R 96.74
3j20_M137 30S ribosomal protein S11P; archaea, archaeal, KIN 96.47
3bbn_K140 Ribosomal protein S11; small ribosomal subunit, sp 96.28
2xzm_K151 RPS14E; ribosome, translation; 3.93A {Tetrahymena 96.11
3u5c_O137 RP59A, 40S ribosomal protein S14-A; translation, r 95.7
>1rl6_A Protein (ribosomal protein L6); RNA-binding protein, gentamicin resistance, alpha/beta protein; 2.00A {Geobacillus stearothermophilus} SCOP: d.141.1.1 d.141.1.1 PDB: 1giy_H 1ml5_h* 1c04_B 1yl3_H 2b66_H 2b9n_H 2b9p_H 1eg0_J 487d_J Back     alignment and structure
Probab=100.00  E-value=1.2e-58  Score=416.80  Aligned_cols=167  Identities=41%  Similarity=0.639  Sum_probs=158.6

Q ss_pred             ccCCcceeecCCCeEEEEeccEEEEEeCCeEEEEEcCCCeEEEEeCCEEEEEEcCCchhHHHHHHHHHHHHhhcceeccc
Q psy8860         119 RSMGKMPIFIPPNVEVTLNSNKITLKGPLGILKQNKNNLVNIKNDSNVLYFTAINNSRIAKSMSGTMRSIINNMIIGVTK  198 (374)
Q Consensus       119 ~~ig~~~I~IP~~V~v~~~~~~i~vkGp~G~l~~~l~~~v~i~~~~~~l~i~~~~~~k~~~a~~gT~rsli~Nmi~GVt~  198 (374)
                      ||+|++||.||+||+|+++++.|+|+||+|+|+++|++.+++..+++.+.++.|+++++++|+|||+||||+|||+|||+
T Consensus         1 srigk~pI~IP~gV~V~i~~~~VtVkGpkG~L~~~~~~~v~i~~~~~~l~v~~~~~~k~~~a~~Gt~rsli~Nmi~GVt~   80 (177)
T 1rl6_A            1 SRVGKKPIEIPAGVTVTVNGNTVTVKGPKGELTRTFHPDMTITVEGNVITVTRPSDEKHHRALHGTTRSLLANMVEGVSK   80 (177)
T ss_dssp             ------CEECCTTCEEEEETTEEEEEETTEEEEEECCTTCEEEEETTEEEEECSCCSHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CcccccceEcCCCCEEEEeCCEEEEECCCeEEEEEcCCCEEEEEeCCEEEEEcCCCCHHHHHHHHHHHHHHhCEEEeEcC
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceEEEEEEEEEEEEEEEeCcEEEEEecceeeEEEeCCCCcEEEcccCCEEEEEecchhhhhhHHHHHHhhcCCCCcCCce
Q psy8860         199 GFEKKLQLIGVGFRAKIEKNYLNLILGFSHPILYKIPFDIICETPSQTEILIKGINKQAVGHVAAEIRRYYKPEPYKGIN  278 (374)
Q Consensus       199 Gf~~~L~lvGvGyr~~~~g~~L~l~LG~Sh~i~~~IP~gV~v~~~~~t~I~l~G~dke~Vgq~Aa~Ir~~r~pepYkgkg  278 (374)
                      ||+++|+++|+||||+++|+.|.++||||||+.++||+||+++++++|+|+|+|+|||.||||||+||+|||||||||||
T Consensus        81 Gf~~~L~lvGvGyra~~~G~~l~l~LG~Shpv~~~iP~gi~v~v~~~t~I~v~G~Dkq~Vgq~AA~Ir~~R~PepYKGKG  160 (177)
T 1rl6_A           81 GYEKALELVGVGYRASKQGKKLVLSVGYSHPVEIEPEEGLEIEVPSQTKIIVKGADKQRVGELAANIRAVRPPEPYKGKG  160 (177)
T ss_dssp             CEEEEEEEESTTCEEEEETTEEEEESSSSSCEEECCCTTEEEEEEETTEEEEEESCHHHHHHHHHHHHTTSCCCTTTCCE
T ss_pred             CcEEEEEEEeeceEEEecCCEEEEEecCCccEEEeCCCCcEEEECCCCEEEEEeCCHHHHHHHHHHHhccCCCCCcCCCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeeecc
Q psy8860         279 RLMVHRT  285 (374)
Q Consensus       279 iL~V~eS  285 (374)
                      |+|.+|.
T Consensus       161 I~y~~E~  167 (177)
T 1rl6_A          161 IRYEGEL  167 (177)
T ss_dssp             EEETTCC
T ss_pred             EeECCeE
Confidence            9998874
>3v2d_H 50S ribosomal protein L6; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_F 2hgj_H 2hgq_H 2hgu_H 1vsa_F 2j03_H 2jl6_H 2jl8_H 2v47_H 2v49_H 2wdi_H 2wdj_H 2wdl_H 2wdn_H 2wh2_H 2wh4_H 2wrj_H 2wrl_H 2wro_H 2wrr_H ... Back     alignment and structure
>1nkw_E 50S ribosomal protein L6; ribosome, large subunit, X- RAY structure, peptidyl-transferase, peptide bond formation; 3.10A {Deinococcus radiodurans} SCOP: i.1.1.2 PDB: 1sm1_E* Back     alignment and structure
>3r8s_G 50S ribosomal protein L6; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 1p85_E 1p86_E 2awb_G 2aw4_G 2i2v_G 2j28_G 2i2t_G* 2qao_G* 2qba_G* 2qbc_G* 2qbe_G 2qbg_G 2qbi_G* 2qbk_G* 2qov_G 2qox_G 2qoz_G* 2qp1_G* 2rdo_G 2vhm_G ... Back     alignment and structure
>3bbo_I Ribosomal protein L6; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2zjr_E 50S ribosomal protein L6; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: d.141.1.1 d.141.1.1 PDB: 1nwx_E* 1xbp_E* 2zjp_E* 2zjq_E 1nwy_E 3cf5_E* 3dll_E* 3pio_E* 3pip_E* 1pnu_E 1pny_E 1vor_H 1vou_H 1vow_H 1voy_H 1vp0_H Back     alignment and structure
>1vq8_E 50S ribosomal protein L6P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.141.1.1 d.141.1.1 PDB: 1vq4_E* 1vq5_E* 1vq6_E* 1vq7_E* 1s72_E* 1vq9_E* 1vqk_E* 1vql_E* 1vqm_E* 1vqn_E* 1vqo_E* 1vqp_E* 1yhq_E* 1yi2_E* 1yij_E* 1yit_E* 1yj9_E* 1yjn_E* 1yjw_E* 2otj_E* ... Back     alignment and structure
>3j21_F 50S ribosomal protein L6P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2zkr_e 60S ribosomal protein L9; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>4a17_E RPL9, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_E 4a1c_E 4a1e_E Back     alignment and structure
>3u5e_H L8, RP24, YL11, 60S ribosomal protein L9-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_F 1s1i_H 3izs_F* 3j16_F 3o5h_I 3o58_I 3u5i_H 4b6a_H 3jyw_H Back     alignment and structure
>1sei_A Ribosomal protein S8; prokaryotic, rRNA-binding; 1.90A {Geobacillus stearothermophilus} SCOP: d.140.1.1 Back     alignment and structure
>1s03_H 30S ribosomal protein S8; protein-RNA complex, SPC operon, transcription-RN; 2.70A {Escherichia coli} SCOP: d.140.1.1 PDB: 1p6g_H 1p87_H 2avy_H 2aw7_H 2i2p_H 2i2u_H 2qal_H* 2qan_H* 2qb9_H* 2qbb_H* 2qbd_H 2qbf_H 2qbh_H* 2qbj_H* 2qou_H* 2qow_H* 2qoy_H* 2qp0_H* 2vho_H 2vhp_H ... Back     alignment and structure
>2vqe_H 30S ribosomal protein S8, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: d.140.1.1 PDB: 1eg0_E* 1fka_H 1gix_K* 1hnw_H* 1hnx_H* 1hnz_H* 1hr0_H 1ibk_H* 1ibl_H* 1ibm_H 1j5e_H 1jgo_K* 1jgp_K* 1jgq_K* 1ml5_K* 1n32_H* 1n33_H* 1n34_H 1n36_H 1pns_H ... Back     alignment and structure
>3bbn_H Ribosomal protein S8; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>3rf2_A 30S ribosomal protein S8; RNA-binding protein, hyperthermophilic bacterium, ribosome; 2.16A {Aquifex aeolicus} Back     alignment and structure
>1i6u_A 30S ribosomal protein S8P; protein-RNA interactions, ribosome, RNA, X-RAY crystallography; 2.60A {Methanocaldococcus jannaschii} SCOP: d.140.1.1 Back     alignment and structure
>2xzm_H Ribosomal protein S8 containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_H Back     alignment and structure
>3r8s_O 50S ribosomal protein L18; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 3fik_O 3j19_O 2wwq_O 3oat_O* 3oas_O* 3ofd_O 3ofc_O 3ofr_O* 3ofz_O* 3og0_O 3ofq_O 3r8t_O 3i1n_O 1p85_M 1p86_M 1vs8_O 1vs6_O 2aw4_O 2awb_O 1vt2_O ... Back     alignment and structure
>3bbo_Q Ribosomal protein L18; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>3u5c_W 40S ribosomal protein S22-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_H 3o30_O 3o2z_O 3u5g_W 1s1h_H 3jyv_H* 3iz6_H 2zkq_h Back     alignment and structure
>3v2d_S 50S ribosomal protein L18; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_M 2hgj_R 2hgq_R 2hgu_R 1vsa_M 2j03_S 2jl6_S 2jl8_S 2v47_S 2v49_S 2wdi_S 2wdj_S 2wdl_S 2wdn_S 2wh2_S 2wh4_S 2wrj_S 2wrl_S 2wro_S 2wrr_S ... Back     alignment and structure
>1ovy_A 50S ribosomal protein L18; ribosome; NMR {Geobacillus stearothermophilus} SCOP: c.55.4.1 Back     alignment and structure
>2zjr_L 50S ribosomal protein L18; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: c.55.4.1 PDB: 1sm1_M* 2zjp_L* 2zjq_L 1nkw_M 3cf5_L* 3dll_L* 3pio_L* 3pip_L* 1nwy_M* 1nwx_M* 1xbp_M* 1pnu_M 1pny_M 1vor_P 1vou_P 1vow_P 1voy_P 1vp0_P Back     alignment and structure
>1vq8_N 50S ribosomal protein L18P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.55.4.1 PDB: 1vq4_N* 1vq5_N* 1vq6_N* 1vq7_N* 1s72_N* 1vq9_N* 1vqk_N* 1vql_N* 1vqm_N* 1vqn_N* 1vqo_N* 1vqp_N* 1yhq_N* 1yi2_N* 1yij_N* 1yit_N* 1yj9_N* 1yjn_N* 1yjw_N* 2otj_N* ... Back     alignment and structure
>3j21_O 50S ribosomal protein L18P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2zkr_n 60S ribosomal protein L5; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2cql_A OK/SW-CL.103, 60S ribosomal protein L9; N-terminal domain, alpha and beta (A+B), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.141.1.1 Back     alignment and structure
>3u5e_D 60S ribosomal protein L5; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_D 4b6a_D 3izc_Q 3izs_Q 3o58_E 3o5h_E 3jyw_E 1s1i_E Back     alignment and structure
>4a17_M RPL5, 60S ribosomal protein L5; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_M 4a1c_M 4a1e_M Back     alignment and structure
>2vqe_K 30S ribosomal protein S11, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: c.55.4.1 PDB: 1gix_N* 1hnw_K* 1hnx_K* 1hnz_K* 1hr0_K 1ibk_K* 1ibl_K* 1ibm_K 1j5e_K 1jgo_N* 1jgp_N* 1jgq_N* 1ml5_N* 1n32_K* 1n33_K* 1n34_K 1n36_K 1xmo_K* 1xmq_K* 1xnq_K* ... Back     alignment and structure
>3j20_M 30S ribosomal protein S11P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3bbn_K Ribosomal protein S11; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
>2xzm_K RPS14E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_K 3j0o_K 3j0l_K 2zkq_k 3iz6_K 3jyv_K* Back     alignment and structure
>3u5c_O RP59A, 40S ribosomal protein S14-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_K 3o30_H 3o2z_H 3u5g_O 1s1h_K 3jyv_K* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 374
d1seia_130 d.140.1.1 (A:) Ribosomal protein S8 {Bacillus stea 6e-33
d1an7a_136 d.140.1.1 (A:) Ribosomal protein S8 {Thermus therm 3e-32
d2gy9h1126 d.140.1.1 (H:3-128) Ribosomal protein S8 {Escheric 8e-31
d2j01s186 c.55.4.1 (S:23-108) Ribosomal protein L18 (L18p) { 8e-29
d2qamg295 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escheri 1e-27
d2j01h289 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus 2e-27
d1i6ua_129 d.140.1.1 (A:) Ribosomal protein S8 {Archaeon Meth 4e-27
d1rl6a289 d.141.1.1 (A:82-170) Ribosomal protein L6 {Bacillu 6e-27
d1ovya_97 c.55.4.1 (A:) Ribosomal protein L18 (L18p) {Bacill 1e-25
d2zjre190 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinoco 1e-25
d2gycm1113 c.55.4.1 (M:3-115) Ribosomal protein L18 (L18p) {E 8e-24
d2zjre278 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococc 7e-22
d2qamg181 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherich 1e-21
d2zjrl1104 c.55.4.1 (L:8-111) Ribosomal protein L18 (L18p) {D 1e-21
d1rl6a175 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus 2e-20
d2j01h171 d.141.1.1 (H:12-82) Ribosomal protein L6 {Thermus 5e-19
d1vqoe179 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon 8e-18
d1vqon1186 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {A 4e-16
d2cqla187 d.141.1.1 (A:1-87) Ribosomal protein L6 {Human (Ho 9e-16
>d1seia_ d.140.1.1 (A:) Ribosomal protein S8 {Bacillus stearothermophilus [TaxId: 1422]} Length = 130 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S8
superfamily: Ribosomal protein S8
family: Ribosomal protein S8
domain: Ribosomal protein S8
species: Bacillus stearothermophilus [TaxId: 1422]

 Score =  117 bits (295), Expect = 6e-33
 Identities = 59/120 (49%), Positives = 87/120 (72%), Gaps = 1/120 (0%)

Query: 3   MSDPIADMLTYIRNGQIVNKKKIIMPSSKIKIAIAKVLKDEGYIKDFFIIKCFKNKFELK 62
           M+DPIADMLT IRN  +V  +K+ +P+SKIK  IA++LK EG+I+D+  I+    +  L+
Sbjct: 2   MTDPIADMLTAIRNANMVRHEKLEVPASKIKREIAEILKREGFIRDYEYIE-DNKQGILR 60

Query: 63  ILLKYYMNRPVIECLKRVSRPGLRIYKNKDNIPKIMNGLGLVIISTASGIITDRKARSMG 122
           I LKY  N  VI  LKR+S+PGLR+Y     +P+++NGLG+ I+ST+ G++TD++AR  G
Sbjct: 61  IFLKYGPNERVITGLKRISKPGLRVYVKAHEVPRVLNGLGIAILSTSQGVLTDKEARQKG 120
>d1an7a_ d.140.1.1 (A:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} Length = 136 Back     information, alignment and structure
>d2gy9h1 d.140.1.1 (H:3-128) Ribosomal protein S8 {Escherichia coli [TaxId: 562]} Length = 126 Back     information, alignment and structure
>d2j01s1 c.55.4.1 (S:23-108) Ribosomal protein L18 (L18p) {Thermus thermophilus [TaxId: 274]} Length = 86 Back     information, alignment and structure
>d2qamg2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]} Length = 95 Back     information, alignment and structure
>d2j01h2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} Length = 89 Back     information, alignment and structure
>d1i6ua_ d.140.1.1 (A:) Ribosomal protein S8 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 129 Back     information, alignment and structure
>d1rl6a2 d.141.1.1 (A:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Length = 89 Back     information, alignment and structure
>d1ovya_ c.55.4.1 (A:) Ribosomal protein L18 (L18p) {Bacillus stearothermophilus [TaxId: 1422]} Length = 97 Back     information, alignment and structure
>d2zjre1 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]} Length = 90 Back     information, alignment and structure
>d2gycm1 c.55.4.1 (M:3-115) Ribosomal protein L18 (L18p) {Escherichia coli [TaxId: 562]} Length = 113 Back     information, alignment and structure
>d2zjre2 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]} Length = 78 Back     information, alignment and structure
>d2qamg1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]} Length = 81 Back     information, alignment and structure
>d2zjrl1 c.55.4.1 (L:8-111) Ribosomal protein L18 (L18p) {Deinococcus radiodurans [TaxId: 1299]} Length = 104 Back     information, alignment and structure
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Length = 75 Back     information, alignment and structure
>d2j01h1 d.141.1.1 (H:12-82) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} Length = 71 Back     information, alignment and structure
>d1vqoe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 79 Back     information, alignment and structure
>d1vqon1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 186 Back     information, alignment and structure
>d2cqla1 d.141.1.1 (A:1-87) Ribosomal protein L6 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query374
d1seia_130 Ribosomal protein S8 {Bacillus stearothermophilus 100.0
d2gy9h1126 Ribosomal protein S8 {Escherichia coli [TaxId: 562 100.0
d1an7a_136 Ribosomal protein S8 {Thermus thermophilus [TaxId: 100.0
d1i6ua_129 Ribosomal protein S8 {Archaeon Methanococcus janna 100.0
d2gycm1113 Ribosomal protein L18 (L18p) {Escherichia coli [Ta 100.0
d1ovya_97 Ribosomal protein L18 (L18p) {Bacillus stearotherm 100.0
d1rl6a289 Ribosomal protein L6 {Bacillus stearothermophilus 100.0
d2j01h289 Ribosomal protein L6 {Thermus thermophilus [TaxId: 99.98
d2zjre190 Ribosomal protein L6 {Deinococcus radiodurans [Tax 99.97
d2qamg295 Ribosomal protein L6 {Escherichia coli [TaxId: 562 99.97
d2j01s186 Ribosomal protein L18 (L18p) {Thermus thermophilus 99.97
d2zjrl1104 Ribosomal protein L18 (L18p) {Deinococcus radiodur 99.97
d1vqon1186 Ribosomal protein L18 (L18p) {Archaeon Haloarcula 99.94
d2qamg181 Ribosomal protein L6 {Escherichia coli [TaxId: 562 99.89
d1rl6a175 Ribosomal protein L6 {Bacillus stearothermophilus 99.88
d1vqoe179 Ribosomal protein L6 {Archaeon Haloarcula marismor 99.87
d2zjre278 Ribosomal protein L6 {Deinococcus radiodurans [Tax 99.86
d2cqla187 Ribosomal protein L6 {Human (Homo sapiens) [TaxId: 99.85
d2j01h171 Ribosomal protein L6 {Thermus thermophilus [TaxId: 99.79
d1vqoe293 Ribosomal protein L6 {Archaeon Haloarcula marismor 99.64
d2uubk1119 Ribosomal protein S11 {Thermus thermophilus [TaxId 97.27
d2qalk1117 Ribosomal protein S11 {Escherichia coli [TaxId: 56 97.13
>d1seia_ d.140.1.1 (A:) Ribosomal protein S8 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S8
superfamily: Ribosomal protein S8
family: Ribosomal protein S8
domain: Ribosomal protein S8
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=100.00  E-value=1.9e-39  Score=276.92  Aligned_cols=123  Identities=49%  Similarity=0.813  Sum_probs=116.9

Q ss_pred             CcchHHHHHHhhhhhhccCCceEEeecchhHHHHHHHHHhCCCcceEEEEeccCCeeEEEEEEEeecCcceeeeeeeecc
Q psy8860           3 MSDPIADMLTYIRNGQIVNKKKIIMPSSKIKIAIAKVLKDEGYIKDFFIIKCFKNKFELKILLKYYMNRPVIECLKRVSR   82 (374)
Q Consensus         3 ~~d~iad~lt~IrNa~~a~~~~v~~p~sk~~~~il~iL~~eGyI~~~~~~~~~~~~~~i~v~LKY~~~~pvi~~~~~iSk   82 (374)
                      |+||||||||+||||++++|.+|.+|+||++.+||++|++||||++|++.++ .....++|.|||.+++|+|+.++++|+
T Consensus         2 m~D~iaD~lt~IrNA~~a~k~~V~ip~Skl~~~il~vL~~eGyI~~f~~~~~-~~~~~i~v~Lk~~~~~~~i~~~~~vSk   80 (130)
T d1seia_           2 MTDPIADMLTAIRNANMVRHEKLEVPASKIKREIAEILKREGFIRDYEYIED-NKQGILRIFLKYGPNERVITGLKRISK   80 (130)
T ss_dssp             CSHHHHHHHHHHHHHHHTTCSEEEEECCHHHHHHHHHHHHTTSEEEEEEEES-SSCEEEEEEECBSSSSBSCCCEEECCB
T ss_pred             ccchHHHHHHHHHHHHHcCCCEEEecCcHHHHHHHHHHHHhcccceeEEeec-cCCceEEEEecccCCccccccceeccc
Confidence            6899999999999999999999999999999999999999999999999885 455789999999999999999999999


Q ss_pred             CCCcccccCCCcccccCCceEEEEEcCCcccccccccc--CCccee
Q psy8860          83 PGLRIYKNKDNIPKIMNGLGLVIISTASGIITDRKARS--MGKMPI  126 (374)
Q Consensus        83 P~~Rvy~~~~~l~~~~~g~G~~ivSTs~Gvmt~~ea~~--ig~~~I  126 (374)
                      ||+|+|++.++||++.+|+|++|||||+|||||+||++  +|++-+
T Consensus        81 pg~r~y~~~~~l~~~~~g~G~~IvSTskGimt~~eA~~~~iGGell  126 (130)
T d1seia_          81 PGLRVYVKAHEVPRVLNGLGIAILSTSQGVLTDKEARQKGTGGEII  126 (130)
T ss_dssp             TTBCCEECGGGCCCCCTTSCEEEEEETTEEEEHHHHHHHTCCEEEE
T ss_pred             CCeEEEcchhhhhhhhhhceEEEEECCCCeeeHHHHHHhCCCcEEE
Confidence            99999999999999999999999999999999999995  887655
>d2gy9h1 d.140.1.1 (H:3-128) Ribosomal protein S8 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1an7a_ d.140.1.1 (A:) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i6ua_ d.140.1.1 (A:) Ribosomal protein S8 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gycm1 c.55.4.1 (M:3-115) Ribosomal protein L18 (L18p) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ovya_ c.55.4.1 (A:) Ribosomal protein L18 (L18p) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rl6a2 d.141.1.1 (A:82-170) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j01h2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2zjre1 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2qamg2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j01s1 c.55.4.1 (S:23-108) Ribosomal protein L18 (L18p) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2zjrl1 c.55.4.1 (L:8-111) Ribosomal protein L18 (L18p) {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1vqon1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2qamg1 d.141.1.1 (G:1-81) Ribosomal protein L6 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rl6a1 d.141.1.1 (A:7-81) Ribosomal protein L6 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vqoe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2zjre2 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2cqla1 d.141.1.1 (A:1-87) Ribosomal protein L6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j01h1 d.141.1.1 (H:12-82) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vqoe2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2uubk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qalk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure