Psyllid ID: psy89

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
DFTQTQNHHLGLRIGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYW
cccccccccccEEEcccccccEEEEccccccccccccEEEEEEEcccccccccccEEEccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHcc
ccccccccccccccccccEEEEEEEEEccccccccccEEEEEEEccccccccccEEEEccccccccEccccEEccHHHcccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHc
dftqtqnhhlglrigyghgypqrcgfknptntpwesgsyKLRMIfkddypstppkckfepplfhpnvypsgtvCLSLLdeekdwkpaiTIKQILLGIQDllnepnikdpaqaeaytiyw
dftqtqnhhlglriGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWKPAITIKQILLGIQDllnepnikdpaqaeaytiyw
DFTQTQNHHLGLRIGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYW
********HLGLRIGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWKPAITIKQILLGIQDLLNEPNI********YTI**
***********LRIGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYW
********HLGLRIGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYW
*****QNHHLGLRIGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DFTQTQNHHLGLRIGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query119 2.2.26 [Sep-21-2011]
Q28CQ4158 SUMO-conjugating enzyme U yes N/A 0.798 0.601 0.810 4e-42
P63282158 SUMO-conjugating enzyme U N/A N/A 0.798 0.601 0.810 4e-42
Q2EF73158 SUMO-conjugating enzyme U N/A N/A 0.798 0.601 0.810 4e-42
P63281158 SUMO-conjugating enzyme U yes N/A 0.798 0.601 0.810 4e-42
P63280158 SUMO-conjugating enzyme U yes N/A 0.798 0.601 0.810 4e-42
P63279158 SUMO-conjugating enzyme U yes N/A 0.798 0.601 0.810 4e-42
P63283158 SUMO-conjugating enzyme U yes N/A 0.798 0.601 0.810 4e-42
Q9W6H5158 SUMO-conjugating enzyme U yes N/A 0.798 0.601 0.810 5e-42
Q9DDJ0157 SUMO-conjugating enzyme U yes N/A 0.798 0.605 0.810 6e-42
Q6Y1Z4158 SUMO-conjugating enzyme U N/A N/A 0.798 0.601 0.8 8e-42
>sp|Q28CQ4|UBC9_XENTR SUMO-conjugating enzyme UBC9 OS=Xenopus tropicalis GN=ube2i PE=2 SV=1 Back     alignment and function desciption
 Score =  169 bits (428), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 86/95 (90%)

Query: 24  CGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD 83
           C       TPWE G +KLRM+FKDDYPS+PPKCKFEPPLFHPNVYPSGTVCLS+L+E+KD
Sbjct: 43  CAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102

Query: 84  WKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY 118
           W+PAITIKQILLGIQ+LLNEPNI+DPAQAEAYTIY
Sbjct: 103 WRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIY 137
Accepts the ubiquitin-like proteins sumo1, sumo2 and sumo3 from the uble1a-uble1b E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as ranbp2 or cbx4. Essential for nuclear architecture and chromosome segregation.
Xenopus tropicalis (taxid: 8364)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|P63282|UBC9_XENLA SUMO-conjugating enzyme UBC9 OS=Xenopus laevis GN=ube2i PE=1 SV=1 Back     alignment and function description
>sp|Q2EF73|UBC9_SPETR SUMO-conjugating enzyme UBC9 OS=Spermophilus tridecemlineatus GN=UBE2I PE=1 SV=1 Back     alignment and function description
>sp|P63281|UBC9_RAT SUMO-conjugating enzyme UBC9 OS=Rattus norvegicus GN=Ube2i PE=1 SV=1 Back     alignment and function description
>sp|P63280|UBC9_MOUSE SUMO-conjugating enzyme UBC9 OS=Mus musculus GN=Ube2i PE=1 SV=1 Back     alignment and function description
>sp|P63279|UBC9_HUMAN SUMO-conjugating enzyme UBC9 OS=Homo sapiens GN=UBE2I PE=1 SV=1 Back     alignment and function description
>sp|P63283|UBC9_CHICK SUMO-conjugating enzyme UBC9 OS=Gallus gallus GN=UBE2I PE=2 SV=1 Back     alignment and function description
>sp|Q9W6H5|UBC9A_DANRE SUMO-conjugating enzyme UBC9-A OS=Danio rerio GN=ube2ia PE=1 SV=1 Back     alignment and function description
>sp|Q9DDJ0|UBC9B_DANRE SUMO-conjugating enzyme UBC9-B OS=Danio rerio GN=ube2ib PE=1 SV=1 Back     alignment and function description
>sp|Q6Y1Z4|UBC9_PAGMA SUMO-conjugating enzyme UBC9 OS=Pagrus major GN=ube2i PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
350407955 653 PREDICTED: hypothetical protein LOC10074 0.798 0.145 0.873 1e-47
383848689 708 PREDICTED: uncharacterized protein LOC10 0.798 0.134 0.873 2e-47
307170257 612 SUMO-conjugating enzyme UBC9 [Camponotus 0.806 0.156 0.864 1e-44
241834470174 ubiquitin protein ligase, putative [Ixod 0.798 0.545 0.873 4e-44
442756711159 Putative ubiquitin protein ligase [Ixode 0.798 0.597 0.873 8e-44
170038178158 ubiquitin-conjugating enzyme E2 i [Culex 0.815 0.613 0.865 1e-43
389611065159 lesswright [Papilio polytes] 0.798 0.597 0.884 2e-43
149287016159 putative ubiquitin-conjugating enzyme [O 0.798 0.597 0.884 2e-43
209972750160 ubiquitin-conjugating enzyme E2 [Scylla 0.798 0.593 0.884 3e-43
340721877159 PREDICTED: SUMO-conjugating enzyme UBC9- 0.798 0.597 0.873 3e-43
>gi|350407955|ref|XP_003488254.1| PREDICTED: hypothetical protein LOC100741621 [Bombus impatiens] Back     alignment and taxonomy information
 Score =  193 bits (491), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 87/95 (91%)

Query: 24  CGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD 83
           C      +TPWE G YKLRMIFKDDYPS+PPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD
Sbjct: 537 CAIPGKKSTPWEGGLYKLRMIFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD 596

Query: 84  WKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY 118
           W+PAITIKQILLGIQDLLNEPN+KDPAQAEAYTIY
Sbjct: 597 WRPAITIKQILLGIQDLLNEPNVKDPAQAEAYTIY 631

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383848689|ref|XP_003699980.1| PREDICTED: uncharacterized protein LOC100881261 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307170257|gb|EFN62617.1| SUMO-conjugating enzyme UBC9 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|241834470|ref|XP_002414996.1| ubiquitin protein ligase, putative [Ixodes scapularis] gi|215509208|gb|EEC18661.1| ubiquitin protein ligase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|442756711|gb|JAA70514.1| Putative ubiquitin protein ligase [Ixodes ricinus] Back     alignment and taxonomy information
>gi|170038178|ref|XP_001846929.1| ubiquitin-conjugating enzyme E2 i [Culex quinquefasciatus] gi|167881742|gb|EDS45125.1| ubiquitin-conjugating enzyme E2 i [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|389611065|dbj|BAM19143.1| lesswright [Papilio polytes] Back     alignment and taxonomy information
>gi|149287016|gb|ABR23407.1| putative ubiquitin-conjugating enzyme [Ornithodoros parkeri] Back     alignment and taxonomy information
>gi|209972750|gb|ACJ03792.1| ubiquitin-conjugating enzyme E2 [Scylla paramamosain] gi|291062115|gb|ADD73553.1| ubiquitin-conjugating enzyme [Macrobrachium nipponense] Back     alignment and taxonomy information
>gi|340721877|ref|XP_003399340.1| PREDICTED: SUMO-conjugating enzyme UBC9-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
FB|FBgn0010602159 lwr "lesswright" [Drosophila m 0.798 0.597 0.873 3.9e-44
UNIPROTKB|B0QYN7184 UBE2I "SUMO-conjugating enzyme 0.806 0.521 0.812 4.5e-43
UNIPROTKB|F1P5D0162 UBE2I "SUMO-conjugating enzyme 0.798 0.586 0.810 6.6e-42
UNIPROTKB|P63283158 UBE2I "SUMO-conjugating enzyme 0.798 0.601 0.810 6.6e-42
UNIPROTKB|A6H744158 UBE2I "Uncharacterized protein 0.798 0.601 0.810 6.6e-42
UNIPROTKB|H3BQQ9137 UBE2I "SUMO-conjugating enzyme 0.798 0.693 0.810 6.6e-42
UNIPROTKB|P63279158 UBE2I "SUMO-conjugating enzyme 0.798 0.601 0.810 6.6e-42
UNIPROTKB|I3LSZ1158 UBE2I "Uncharacterized protein 0.798 0.601 0.810 6.6e-42
UNIPROTKB|P63282158 ube2i "SUMO-conjugating enzyme 0.798 0.601 0.810 6.6e-42
MGI|MGI:107365158 Ube2i "ubiquitin-conjugating e 0.798 0.601 0.810 6.6e-42
FB|FBgn0010602 lwr "lesswright" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 465 (168.7 bits), Expect = 3.9e-44, P = 3.9e-44
 Identities = 83/95 (87%), Positives = 87/95 (91%)

Query:    24 CGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD 83
             C      +TPWE G YKLRMIFKDDYP++PPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD
Sbjct:    43 CAIPGKKSTPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD 102

Query:    84 WKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY 118
             W+PAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY
Sbjct:   103 WRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY 137
GO:0019789 "SUMO ligase activity" evidence=IGI;ISS
GO:0031072 "heat shock protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=IDA
GO:0016925 "protein sumoylation" evidence=ISS;IMP
GO:0006464 "cellular protein modification process" evidence=IGI;IPI
GO:0005515 "protein binding" evidence=IPI
GO:0006606 "protein import into nucleus" evidence=IMP;IPI
GO:0007352 "zygotic specification of dorsal/ventral axis" evidence=IGI
GO:0007143 "female meiosis" evidence=IGI
GO:0016321 "female meiosis chromosome segregation" evidence=IGI
GO:0035172 "hemocyte proliferation" evidence=IMP
GO:0035207 "negative regulation of hemocyte proliferation" evidence=IMP
GO:0035204 "negative regulation of lamellocyte differentiation" evidence=IMP
GO:0045751 "negative regulation of Toll signaling pathway" evidence=IMP
GO:0006959 "humoral immune response" evidence=IMP
GO:0007391 "dorsal closure" evidence=IMP
GO:0071560 "cellular response to transforming growth factor beta stimulus" evidence=IGI
GO:0000940 "condensed chromosome outer kinetochore" evidence=IDA
GO:0000780 "condensed nuclear chromosome, centromeric region" evidence=IDA
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
UNIPROTKB|B0QYN7 UBE2I "SUMO-conjugating enzyme UBC9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5D0 UBE2I "SUMO-conjugating enzyme UBC9" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P63283 UBE2I "SUMO-conjugating enzyme UBC9" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6H744 UBE2I "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H3BQQ9 UBE2I "SUMO-conjugating enzyme UBC9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P63279 UBE2I "SUMO-conjugating enzyme UBC9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSZ1 UBE2I "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P63282 ube2i "SUMO-conjugating enzyme UBC9" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
MGI|MGI:107365 Ube2i "ubiquitin-conjugating enzyme E2I" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O09181UBC9_MESAU6, ., 3, ., 2, ., -0.75780.79830.6012N/AN/A
Q9DDJ0UBC9B_DANRE6, ., 3, ., 2, ., -0.81050.79830.6050yesN/A
P63280UBC9_MOUSE6, ., 3, ., 2, ., -0.81050.79830.6012yesN/A
Q2EF73UBC9_SPETR6, ., 3, ., 2, ., -0.81050.79830.6012N/AN/A
Q42551SCE1_ARATH6, ., 3, ., 2, ., -0.58940.79830.5937yesN/A
P40984UBC9_SCHPO6, ., 3, ., 2, ., -0.67700.80670.6114yesN/A
P63279UBC9_HUMAN6, ., 3, ., 2, ., -0.81050.79830.6012yesN/A
Q6Y1Z4UBC9_PAGMA6, ., 3, ., 2, ., -0.80.79830.6012N/AN/A
P50623UBC9_YEAST6, ., 3, ., 2, ., -0.50520.79830.6050yesN/A
P63283UBC9_CHICK6, ., 3, ., 2, ., -0.81050.79830.6012yesN/A
P63282UBC9_XENLA6, ., 3, ., 2, ., -0.81050.79830.6012N/AN/A
P63281UBC9_RAT6, ., 3, ., 2, ., -0.81050.79830.6012yesN/A
Q95017UBC9_CAEEL6, ., 3, ., 2, ., -0.76840.79830.5722yesN/A
Q9W6H5UBC9A_DANRE6, ., 3, ., 2, ., -0.81050.79830.6012yesN/A
Q28CQ4UBC9_XENTR6, ., 3, ., 2, ., -0.81050.79830.6012yesN/A
Q9NGP4UBC9_DICDI6, ., 3, ., 2, ., -0.64130.77310.5786yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2.19LOW CONFIDENCE prediction!
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 2e-42
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 5e-39
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 3e-38
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 5e-38
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 3e-18
PLN00172147 PLN00172, PLN00172, ubiquitin conjugating enzyme; 2e-17
TIGR015311464 TIGR01531, glyc_debranch, glycogen debranching enz 5e-04
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information 
 Score =  135 bits (342), Expect = 2e-42
 Identities = 48/95 (50%), Positives = 64/95 (67%), Gaps = 1/95 (1%)

Query: 24  CGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD 83
                P  TP+E G +KL + F +DYP  PPK KF   ++HPNV PSG +CL +L +E +
Sbjct: 31  VTIIGPEGTPYEGGVFKLDIEFPEDYPFKPPKVKFTTKIYHPNVDPSGEICLDILKDE-N 89

Query: 84  WKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY 118
           W PA+TI+Q+LL IQ LL+EPN +DP  AEA  +Y
Sbjct: 90  WSPALTIEQVLLSIQSLLSEPNPEDPLNAEAAKLY 124

Proteins destined for proteasome-mediated degradation may be ubiquitinated. Ubiquitination follows conjugation of ubiquitin to a conserved cysteine residue of UBC homologues. TSG101 is one of several UBC homologues that lacks this active site cysteine. Length = 139
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|233451 TIGR01531, glyc_debranch, glycogen debranching enzymye Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 119
KOG0417|consensus148 100.0
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 100.0
KOG0419|consensus152 100.0
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 100.0
PLN00172147 ubiquitin conjugating enzyme; Provisional 100.0
KOG0425|consensus171 100.0
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 100.0
KOG0418|consensus200 100.0
KOG0424|consensus158 100.0
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 100.0
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 100.0
KOG0421|consensus175 100.0
KOG0426|consensus165 100.0
KOG0422|consensus153 100.0
KOG0416|consensus189 99.97
KOG0420|consensus184 99.97
KOG0423|consensus223 99.96
KOG0427|consensus161 99.93
KOG0894|consensus 244 99.91
KOG0428|consensus 314 99.79
KOG0429|consensus 258 99.75
KOG0895|consensus 1101 99.65
KOG0896|consensus138 99.57
KOG0895|consensus 1101 99.45
KOG0897|consensus122 98.73
PF14461133 Prok-E2_B: Prokaryotic E2 family B 98.71
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 98.55
KOG2391|consensus 365 97.85
PF14462122 Prok-E2_E: Prokaryotic E2 family E 95.57
PF14457162 Prok-E2_A: Prokaryotic E2 family A 95.3
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 94.8
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 94.79
smart00591107 RWD domain in RING finger and WD repeat containing 93.38
KOG3357|consensus167 88.47
>KOG0417|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.6e-45  Score=247.89  Aligned_cols=115  Identities=30%  Similarity=0.654  Sum_probs=106.4

Q ss_pred             ccccCCCcccEEeeCCCceeeEEEEeCCCCCCCCCCeEEEEEEeCCCCCCCCCeeEEcCCcccccccCCCeEEccCCCCC
Q psy89             2 FTQTQNHHLGLRIGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEE   81 (119)
Q Consensus         2 ~~~~~~~~~~v~~~~~~~~~W~~~i~gp~~tpyegg~f~~~i~~p~~yP~~pP~v~f~t~i~HpnV~~~G~vcl~~l~~~   81 (119)
                      +.+++.+.+....+++|+++|+++|.||.|||||||+|++.|.||++||++||+|+|+|+||||||++.|+||+++|.. 
T Consensus        13 l~~dp~~~~~~~~~~dnl~~w~a~I~GP~~SpYEgG~F~l~I~~p~~YP~~PPkV~F~TkIyHPNI~~~G~IclDILk~-   91 (148)
T KOG0417|consen   13 LLRDPPPGCSAGPVGDNLFHWQATILGPPGSPYEGGVFFLEIHFPEDYPFKPPKVRFLTKIYHPNIDSNGRICLDILKD-   91 (148)
T ss_pred             HhcCCCCCCccCCCCCceeeEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCceEeecccccCCcCccccchHHhhhc-
Confidence            3444555555556688999999999999999999999999999999999999999999999999999999999999996 


Q ss_pred             CCCCCcCCHHHHHHHHHHHhcCCCCCCCcCHHHHhhc
Q psy89            82 KDWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY  118 (119)
Q Consensus        82 ~~W~p~~~l~~vl~~i~~~l~~p~~~~p~n~~aa~~y  118 (119)
                       +|+|+++|.+||++|+++|.+||+++|++.++|++|
T Consensus        92 -~WsPAl~i~~VllsI~sLL~~PnpddPL~~~ia~~~  127 (148)
T KOG0417|consen   92 -QWSPALTISKVLLSICSLLSDPNPDDPLVPDIAELY  127 (148)
T ss_pred             -cCChhhHHHHHHHHHHHHhcCCCCCccccHHHHHHH
Confidence             899999999999999999999999999999999876

>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419|consensus Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0425|consensus Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>KOG0418|consensus Back     alignment and domain information
>KOG0424|consensus Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0421|consensus Back     alignment and domain information
>KOG0426|consensus Back     alignment and domain information
>KOG0422|consensus Back     alignment and domain information
>KOG0416|consensus Back     alignment and domain information
>KOG0420|consensus Back     alignment and domain information
>KOG0423|consensus Back     alignment and domain information
>KOG0427|consensus Back     alignment and domain information
>KOG0894|consensus Back     alignment and domain information
>KOG0428|consensus Back     alignment and domain information
>KOG0429|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG0896|consensus Back     alignment and domain information
>KOG0895|consensus Back     alignment and domain information
>KOG0897|consensus Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information
>KOG2391|consensus Back     alignment and domain information
>PF14462 Prok-E2_E: Prokaryotic E2 family E Back     alignment and domain information
>PF14457 Prok-E2_A: Prokaryotic E2 family A Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>KOG3357|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
1z5s_A158 Crystal Structure Of A Complex Between Ubc9, Sumo-1 3e-43
2o25_C160 Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi 3e-43
1kps_A159 Structural Basis For E2-Mediated Sumo Conjugation R 3e-43
3a4s_A163 The Crystal Structure Of The Sld2:ubc9 Complex Leng 4e-43
1u9a_A160 Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 4e-43
2grn_A161 Crystal Structure Of Human Rangap1-Ubc9 Length = 16 4e-43
2gro_A161 Crystal Structure Of Human Rangap1-Ubc9-N85q Length 1e-42
2grr_A161 Crystal Structure Of Human Rangap1-Ubc9-D127s Lengt 2e-42
2grq_A161 Crystal Structure Of Human Rangap1-Ubc9-D127a Lengt 2e-42
2grp_A161 Crystal Structure Of Human Rangap1-Ubc9-Y87a Length 2e-42
2uyz_A158 Non-Covalent Complex Between Ubc9 And Sumo1 Length 3e-42
3uio_A158 Complex Between Human Rangap1-Sumo2, Ubc9 And The I 4e-42
3rcz_B163 Rad60 Sld2 Ubc9 Complex Length = 163 7e-35
3ong_B159 Crystal Structure Of Uba2ufd-ubc9: Insights Into E1 1e-24
2gjd_A157 Distinct Functional Domains Of Ubc9 Dictate Cell Su 1e-24
2aak_A152 Ubiquitin Conjugating Enzyme From Arabidopsis Thali 1e-18
1ayz_A169 Crystal Structure Of The Saccharomyces Cerevisiae U 6e-18
1jas_A152 Hsubc2b Length = 152 8e-18
1q34_A163 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 1e-17
1z3d_A157 Protein Crystal Growth Improvement Leading To The 2 1e-17
2ucz_A165 Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomy 1e-16
2pwq_A216 Crystal Structure Of A Putative Ubiquitin Conjugati 4e-16
2f4z_A193 Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw 1e-15
4ii2_C163 Crystal Structure Of Ubiquitin Activating Enzyme 1 3e-15
3rz3_A183 Human Cdc34 E2 In Complex With Cc0651 Inhibitor Len 4e-15
2ob4_A180 Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 1 4e-15
2e2c_A156 E2-C, An Ubiquitin Conjugating Enzyme Required For 4e-15
2ayv_A166 Crystal Structure Of A Putative Ubiquitin-Conjugati 7e-15
3hct_B155 Crystal Structure Of Traf6 In Complex With Ubc13 In 8e-15
2c2v_B154 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 9e-15
4epo_B155 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 1e-14
1j7d_B152 Crystal Structure Of Hmms2-Hubc13 Length = 152 1e-14
3tgd_A152 Crystal Structure Of The Human Ubiquitin-Conjugatin 1e-14
3l1y_A157 Crystal Structure Of Human Ubc4 E2 Conjugating Enzy 1e-14
3von_C148 Crystalstructure Of The Ubiquitin Protease Length = 1e-14
2esk_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil 1e-14
2eso_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 1e-14
3eb6_B149 Structure Of The Ciap2 Ring Domain Bound To Ubch5b 1e-14
3l1z_A157 Crystal Structure Of The U-Box Domain Of Human E4b 1e-14
2c4o_B165 Crystal Structure Of Human Ubiquitin-Conjugating En 1e-14
1ur6_A147 Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp 1e-14
3e95_A151 Crystal Structure Of The Plasmodium Falciparum Ubiq 1e-14
2r0j_A149 Crystal Structure Of The Putative Ubiquitin Conjuga 1e-14
1yh2_A169 Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 1e-14
1x23_A155 Crystal Structure Of Ubch5c Length = 155 1e-14
3rpg_A149 Bmi1RING1B-Ubch5c Complex Structure Length = 149 1e-14
2fuh_A146 Solution Structure Of The Ubch5cUB NON-Covalent Com 1e-14
2esq_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 2e-14
2esp_A149 Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta 3e-14
2oxq_A152 Structure Of The Ubch5 :chip U-Box Complex Length = 3e-14
1z2u_A150 The 1.1a Crystallographic Structure Of Ubiquitin- C 3e-14
1jat_A155 Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng 6e-14
1jbb_A153 Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 7e-14
1qcq_A148 Ubiquitin Conjugating Enzyme Length = 148 1e-13
4ddg_A 399 Crystal Structure Of Human Otub1UBCH5B~UBUB Length 1e-13
3a33_A150 Ubch5b~ubiquitin Conjugate Length = 150 1e-13
3ugb_A147 Ubch5c~ubiquitin Conjugate Length = 147 2e-13
2c4o_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 2e-13
1y8x_A160 Structural Basis For Recruitment Of Ubc12 By An E2- 4e-13
3oj4_A153 Crystal Structure Of The A20 Znf4, Ubiquitin And Ub 4e-13
2yho_B149 The Idol-Ube2d Complex Mediates Sterol-Dependent De 5e-13
3fsh_A168 Crystal Structure Of The Ubiquitin Conjugating Enzy 5e-13
2c4p_A165 Crystal Structure Of Human Ubiquitin-Conjugating En 5e-13
2cyx_A170 Structure Of Human Ubiquitin-Conjugating Enzyme E2 5e-13
2kly_A167 Solution Structure Of Human Ubiquitin Conjugating E 5e-13
4gpr_A151 Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin 6e-13
3h8k_A164 Crystal Structure Of Ube2g2 Complxed With The G2br 7e-13
3jvz_A146 E2~ubiquitin-Hect Length = 146 7e-13
1zdn_A158 Ubiquitin-Conjugating Enzyme E2s Length = 158 7e-13
2gmi_A152 Mms2UBC13~UBIQUITIN Length = 152 7e-13
4auq_A147 Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 1e-12
1pzv_A164 Crystal Structures Of Two Ubc (E2) Enzymes Of The U 1e-12
1y6l_A149 Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 3e-12
2awf_A172 Structure Of Human Ubiquitin-Conjugating Enzyme E2 3e-12
3sqv_C156 Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin L 4e-12
1c4z_D154 Structure Of E6ap: Insights Into Ubiquitination Pat 4e-12
4fh1_A153 S. Cerevisiae Ubc13-N79a Length = 153 4e-12
1fxt_A149 Structure Of A Conjugating Enzyme-Ubiquitin Thioles 4e-12
1tte_A215 The Structure Of A Class Ii Ubiquitin-Conjugating E 5e-12
2nvu_C180 Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 5e-12
4ap4_B153 Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le 1e-11
3bzh_A194 Crystal Structure Of Human Ubiquitin-Conjugating En 1e-11
1wzv_A155 Crystal Structure Of Ubch8 Length = 155 2e-11
2kjh_A152 Nmr Based Structural Model Of The Ubch8-Ubiquitin C 2e-11
1i7k_A179 Crystal Structure Of Human Mitotic-Specific Ubiquit 3e-11
1yrv_A169 Novel Ubiquitin-Conjugating Enzyme Length = 169 3e-10
3o2u_A190 S. Cerevisiae Ubc12 Length = 190 5e-10
2onu_A152 Plasmodium Falciparum Ubiquitin Conjugating Enzyme 1e-09
2fo3_A125 Plasmodium Vivax Ubiquitin Conjugating Enzyme E2 Le 6e-09
3ceg_A 323 Crystal Structure Of The Ubc Domain Of Baculoviral 1e-08
2z5d_A179 Human Ubiquitin-Conjugating Enzyme E2 H Length = 17 1e-08
3k9p_A217 The Crystal Structure Of E2-25k And Ubiquitin Compl 3e-08
1yf9_A171 Structural Analysis Of Leishmania Major Ubiquitin C 3e-08
2bep_A159 Crystal Structure Of Ubiquitin Conjugating Enzyme E 3e-08
3e46_A253 Crystal Structure Of Ubiquitin-Conjugating Enzyme E 3e-08
3k9o_A201 The Crystal Structure Of E2-25k And Ubb+1 Complex L 3e-08
1yla_A202 Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington 4e-08
2h2y_A136 Crystal Structure Of Ubiquitin Conjugating Enzyme E 5e-08
2edi_A173 Solution Structure Of The Uq_con Domain From Human 9e-08
3fn1_B167 E2-Ring Expansion Of The Nedd8 Cascade Confers Spec 9e-08
2a7l_A136 Structure Of The Human Hypothetical Ubiquitin-Conju 7e-07
2y9p_A172 Pex4p-Pex22p Mutant Ii Structure Length = 172 3e-05
2y9o_A172 Pex4p-Pex22p Mutant I Structure Length = 172 3e-05
2y9m_A172 Pex4p-Pex22p Structure Length = 172 4e-05
2q0v_A156 Crystal Structure Of Ubiquitin Conjugating Enzyme E 4e-05
3e95_C158 Crystal Structure Of The Plasmodium Falciparum Ubiq 4e-05
4ds2_A167 Ubiquitin Conjugating Enzyme (Putative) From Trypan 2e-04
2f4w_A187 Human Ubiquitin-Conjugating Enzyme E2 J2 Length = 1 7e-04
>pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 Back     alignment and structure 
Iteration: 1

 Score =  169 bits (428), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 86/95 (90%)
Query: 24  CGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD 83
           C       TPWE G +KLRM+FKDDYPS+PPKCKFEPPLFHPNVYPSGTVCLS+L+E+KD
Sbjct: 43  CAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKD 102
Query: 84  WKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY 118
           W+PAITIKQILLGIQ+LLNEPNI+DPAQAEAYTIY
Sbjct: 103 WRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIY 137
>pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 Back     alignment and structure
>pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 Back     alignment and structure
>pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 Back     alignment and structure
>pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 Back     alignment and structure
>pdb|2GRO|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q Length = 161 Back     alignment and structure
>pdb|2GRR|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s Length = 161 Back     alignment and structure
>pdb|2GRQ|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a Length = 161 Back     alignment and structure
>pdb|2GRP|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a Length = 161 Back     alignment and structure
>pdb|2UYZ|A Chain A, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 158 Back     alignment and structure
>pdb|3UIO|A Chain A, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Containing Ir2 Motif Ii Length = 158 Back     alignment and structure
>pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 Back     alignment and structure
>pdb|3ONG|B Chain B, Crystal Structure Of Uba2ufd-ubc9: Insights Into E1-e2 Interactions In Sumo Pathways Length = 159 Back     alignment and structure
>pdb|2GJD|A Chain A, Distinct Functional Domains Of Ubc9 Dictate Cell Survival And Resistance To Genotoxic Stress Length = 157 Back     alignment and structure
>pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 Back     alignment and structure
>pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 Back     alignment and structure
>pdb|1JAS|A Chain A, Hsubc2b Length = 152 Back     alignment and structure
>pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 Back     alignment and structure
>pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 Back     alignment and structure
>pdb|2UCZ|A Chain A, Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomyces Cerevisiae Length = 165 Back     alignment and structure
>pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 Back     alignment and structure
>pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 Back     alignment and structure
>pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 Back     alignment and structure
>pdb|3RZ3|A Chain A, Human Cdc34 E2 In Complex With Cc0651 Inhibitor Length = 183 Back     alignment and structure
>pdb|2OB4|A Chain A, Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 180 Back     alignment and structure
>pdb|2E2C|A Chain A, E2-C, An Ubiquitin Conjugating Enzyme Required For The Destruction Of Mitotic Cyclins Length = 156 Back     alignment and structure
>pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 Back     alignment and structure
>pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 155 Back     alignment and structure
>pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 154 Back     alignment and structure
>pdb|4EPO|B Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 155 Back     alignment and structure
>pdb|1J7D|B Chain B, Crystal Structure Of Hmms2-Hubc13 Length = 152 Back     alignment and structure
>pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 Back     alignment and structure
>pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|3VON|C Chain C, Crystalstructure Of The Ubiquitin Protease Length = 148 Back     alignment and structure
>pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 Back     alignment and structure
>pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 Back     alignment and structure
>pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 Back     alignment and structure
>pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 Back     alignment and structure
>pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 Back     alignment and structure
>pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 Back     alignment and structure
>pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 Back     alignment and structure
>pdb|1YH2|A Chain A, Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 Back     alignment and structure
>pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 Back     alignment and structure
>pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 Back     alignment and structure
>pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 Back     alignment and structure
>pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 Back     alignment and structure
>pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 Back     alignment and structure
>pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 Back     alignment and structure
>pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 Back     alignment and structure
>pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 155 Back     alignment and structure
>pdb|1JBB|A Chain A, Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 Back     alignment and structure
>pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme Length = 148 Back     alignment and structure
>pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 Back     alignment and structure
>pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 Back     alignment and structure
>pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 Back     alignment and structure
>pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 Back     alignment and structure
>pdb|1Y8X|A Chain A, Structural Basis For Recruitment Of Ubc12 By An E2-Binding Domain In Nedd8's E1 Length = 160 Back     alignment and structure
>pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 Back     alignment and structure
>pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 Back     alignment and structure
>pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 Back     alignment and structure
>pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 Back     alignment and structure
>pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 Back     alignment and structure
>pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 Back     alignment and structure
>pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 Back     alignment and structure
>pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 Back     alignment and structure
>pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 Back     alignment and structure
>pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 Back     alignment and structure
>pdb|2GMI|A Chain A, Mms2UBC13~UBIQUITIN Length = 152 Back     alignment and structure
>pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 Back     alignment and structure
>pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 Back     alignment and structure
>pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 Back     alignment and structure
>pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 Back     alignment and structure
>pdb|3SQV|C Chain C, Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin Ligase, Nlel, With A Human E2, Ubch7 Length = 156 Back     alignment and structure
>pdb|1C4Z|D Chain D, Structure Of E6ap: Insights Into Ubiquitination Pathway Length = 154 Back     alignment and structure
>pdb|4FH1|A Chain A, S. Cerevisiae Ubc13-N79a Length = 153 Back     alignment and structure
>pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 Back     alignment and structure
>pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 Back     alignment and structure
>pdb|2NVU|C Chain C, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 180 Back     alignment and structure
>pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 Back     alignment and structure
>pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 Back     alignment and structure
>pdb|1WZV|A Chain A, Crystal Structure Of Ubch8 Length = 155 Back     alignment and structure
>pdb|2KJH|A Chain A, Nmr Based Structural Model Of The Ubch8-Ubiquitin Complex Length = 152 Back     alignment and structure
>pdb|1I7K|A Chain A, Crystal Structure Of Human Mitotic-Specific Ubiquitin- Conjugating Enzyme, Ubch10 Length = 179 Back     alignment and structure
>pdb|1YRV|A Chain A, Novel Ubiquitin-Conjugating Enzyme Length = 169 Back     alignment and structure
>pdb|3O2U|A Chain A, S. Cerevisiae Ubc12 Length = 190 Back     alignment and structure
>pdb|2ONU|A Chain A, Plasmodium Falciparum Ubiquitin Conjugating Enzyme Pf10_0330, Putative Homologue Of Human Ube2h Length = 152 Back     alignment and structure
>pdb|2FO3|A Chain A, Plasmodium Vivax Ubiquitin Conjugating Enzyme E2 Length = 125 Back     alignment and structure
>pdb|3CEG|A Chain A, Crystal Structure Of The Ubc Domain Of Baculoviral Iap Repeat- Containing Protein 6 Length = 323 Back     alignment and structure
>pdb|2Z5D|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 H Length = 179 Back     alignment and structure
>pdb|3K9P|A Chain A, The Crystal Structure Of E2-25k And Ubiquitin Complex Length = 217 Back     alignment and structure
>pdb|1YF9|A Chain A, Structural Analysis Of Leishmania Major Ubiquitin Conjugating Enzyme E2 Length = 171 Back     alignment and structure
>pdb|2BEP|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2-25k Length = 159 Back     alignment and structure
>pdb|3E46|A Chain A, Crystal Structure Of Ubiquitin-Conjugating Enzyme E2-25kda (Huntington Interacting Protein 2) M172a Mutant Length = 253 Back     alignment and structure
>pdb|3K9O|A Chain A, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 201 Back     alignment and structure
>pdb|1YLA|A Chain A, Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington Interacting Protein 2) Length = 202 Back     alignment and structure
>pdb|2H2Y|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2 From Plasmodium Falciparum Length = 136 Back     alignment and structure
>pdb|2EDI|A Chain A, Solution Structure Of The Uq_con Domain From Human Nedd8- Conjugating Enzyme Nce2 Length = 173 Back     alignment and structure
>pdb|3FN1|B Chain B, E2-Ring Expansion Of The Nedd8 Cascade Confers Specificity To Cullin Modification Length = 167 Back     alignment and structure
>pdb|2A7L|A Chain A, Structure Of The Human Hypothetical Ubiquitin-Conjugating Enzyme, Loc55284 Length = 136 Back     alignment and structure
>pdb|2Y9P|A Chain A, Pex4p-Pex22p Mutant Ii Structure Length = 172 Back     alignment and structure
>pdb|2Y9O|A Chain A, Pex4p-Pex22p Mutant I Structure Length = 172 Back     alignment and structure
>pdb|2Y9M|A Chain A, Pex4p-Pex22p Structure Length = 172 Back     alignment and structure
>pdb|2Q0V|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2, Putative, From Plasmodium Falciparum Length = 156 Back     alignment and structure
>pdb|3E95|C Chain C, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 158 Back     alignment and structure
>pdb|4DS2|A Chain A, Ubiquitin Conjugating Enzyme (Putative) From Trypanosoma Cruzi Length = 167 Back     alignment and structure
>pdb|2F4W|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 J2 Length = 187 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 6e-53
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 3e-52
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 1e-51
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 1e-46
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 3e-46
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 3e-45
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 4e-45
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 5e-45
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 3e-44
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 3e-38
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 2e-36
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 3e-36
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 1e-35
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 4e-34
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 6e-34
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 6e-34
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 1e-33
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 1e-33
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 2e-33
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 2e-33
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 2e-33
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 2e-33
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 5e-33
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 5e-33
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 5e-33
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 5e-33
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 8e-33
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 1e-32
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 1e-32
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 3e-32
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 3e-32
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 2e-31
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 3e-31
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 8e-31
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 1e-30
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 3e-30
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 3e-30
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 4e-30
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 4e-30
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 5e-30
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 8e-30
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 2e-29
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 3e-29
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 5e-29
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 2e-28
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 2e-27
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 3e-27
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 4e-24
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 3e-23
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 1e-21
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
 Score =  162 bits (412), Expect = 6e-53
 Identities = 48/96 (50%), Positives = 66/96 (68%)

Query: 23  RCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEK 82
             G      T W  G Y + + + ++YPS PPK KF    +HPNVYPSGT+CLS+L+E++
Sbjct: 42  EAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQ 101

Query: 83  DWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY 118
           DW+PAIT+KQI+LG+QDLL+ PN   PAQ  A+  +
Sbjct: 102 DWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRSF 137
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 100.0
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 100.0
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 100.0
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 100.0
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 100.0
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 100.0
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 100.0
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 100.0
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 100.0
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 100.0
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 100.0
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 100.0
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 100.0
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 100.0
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 100.0
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 100.0
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 100.0
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 100.0
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 100.0
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 100.0
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 100.0
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 100.0
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 100.0
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 100.0
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 100.0
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 100.0
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 100.0
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 100.0
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 100.0
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 100.0
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 100.0
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 100.0
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 100.0
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 100.0
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 100.0
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 100.0
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 100.0
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 100.0
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 100.0
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 100.0
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 100.0
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 100.0
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 100.0
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 100.0
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 100.0
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 100.0
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 100.0
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 100.0
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 100.0
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.98
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.97
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.88
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 99.84
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 99.61
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 99.57
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 95.35
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 93.85
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 93.66
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 92.62
3zqs_A186 E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A 92.29
2dax_A152 Protein C21ORF6; RWD domain, alpha+beta sandwich f 91.08
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 91.06
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 90.76
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
Probab=100.00  E-value=7.2e-42  Score=234.53  Aligned_cols=112  Identities=30%  Similarity=0.618  Sum_probs=104.3

Q ss_pred             cCCCcccEEeeCCCceeeEEEEeCCCCCCCCCCeEEEEEEeCCCCCCCCCeeEEcCCcccccccCCCeEEccCCCCCCCC
Q psy89             5 TQNHHLGLRIGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKDW   84 (119)
Q Consensus         5 ~~~~~~~v~~~~~~~~~W~~~i~gp~~tpyegg~f~~~i~~p~~yP~~pP~v~f~t~i~HpnV~~~G~vcl~~l~~~~~W   84 (119)
                      .+...+.+.++++|+++|+++|.||+|||||||.|+++|.||++||++||+|+|.|+|+||||+.+|+||+++|.  ++|
T Consensus        16 ~~~~~i~~~~~~~~l~~w~~~i~Gp~~tpyegg~f~~~i~fp~~YP~~PP~v~f~t~i~HPnv~~~G~iCl~iL~--~~W   93 (149)
T 2r0j_A           16 EPPPGIMAVPVPENYRHFNILINGPDGTPYEGGTYKLELFLPEQYPMEPPKVRFLTKIYHPNIDKLGRICLDILK--DKW   93 (149)
T ss_dssp             SCCTTEEEEEETTEEEEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEECSCCCBTTBCTTCBBCCGGGT--TTC
T ss_pred             CCCCCEEEEECCCcccEEEEEEECCCCCCcCCCEEEEEEeCCcccCCCCCeeEeccCCccCCCCCCCEEechhcC--CCC
Confidence            334445555677899999999999999999999999999999999999999999999999999999999999998  499


Q ss_pred             CCcCCHHHHHHHHHHHhcCCCCCCCcCHHHHhhc
Q psy89            85 KPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY  118 (119)
Q Consensus        85 ~p~~~l~~vl~~i~~~l~~p~~~~p~n~~aa~~y  118 (119)
                      +|+++|.+||.+|+++|.+|++++|+|.+||++|
T Consensus        94 ~p~~~i~~vl~~i~~ll~~p~~~~p~n~~aa~~~  127 (149)
T 2r0j_A           94 SPALQIRTVLLSIQALLSSPEPDDPLDSKVAEHF  127 (149)
T ss_dssp             CTTSCHHHHHHHHHHHHHSCCTTSCSSCHHHHHH
T ss_pred             CCCCcHHHHHHHHHHHHhCCCCCCchhHHHHHHH
Confidence            9999999999999999999999999999999876
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} Back     alignment and structure
>2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 119
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 9e-23
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 2e-22
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 4e-22
d2ucza_164 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 2e-21
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 9e-21
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-20
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 1e-20
d1y8xa1157 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, 1e-20
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 4e-20
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 1e-19
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 2e-19
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 3e-19
d1yrva1148 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U 8e-19
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-18
d1j7db_149 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H 2e-18
d1z3da1149 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U 2e-18
d1i7ka_146 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 2e-17
d1wzva1150 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U 3e-17
d1c4zd_144 d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H 3e-17
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 3e-17
d2bepa1154 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 1e-16
d1fzya_149 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 1e-16
d2z5da1152 d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, 9e-16
d1s1qa_141 d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 1e-15
d1yf9a1158 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, 1e-15
d1yh2a1154 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U 1e-15
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 3e-15
d1zdna1151 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U 3e-15
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 3e-14
d1uzxa_152 d.20.1.2 (A:) Vacuolar protein sorting-associated 5e-14
d1zuoa1162 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme 3e-11
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]

 Score = 84.3 bits (208), Expect = 9e-23
 Identities = 23/96 (23%), Positives = 41/96 (42%)

Query: 23  RCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEK 82
                 P ++  E+  Y L +    +YP +PPK  F   +  P V P+     +     +
Sbjct: 41  NGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLR 100

Query: 83  DWKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY 118
           DWK A T++ +LL ++  +  P  K   Q +    +
Sbjct: 101 DWKRAYTMETLLLDLRKEMATPANKKLRQPKEGETF 136
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 100.0
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 100.0
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 100.0
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 100.0
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 100.0
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 100.0
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 100.0
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 100.0
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.97
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.97
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 99.82
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 99.75
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 93.54
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 92.35
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 90.48
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 89.83
d1ukxa_137 EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu 87.01
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), ubch10 [TaxId: 9606]

Probab=100.00  E-value=1.6e-40  Score=225.64  Aligned_cols=113  Identities=30%  Similarity=0.544  Sum_probs=105.1

Q ss_pred             ccCCCcccEEeeCCCceeeEEEEeCCCCCCCCCCeEEEEEEeCCCCCCCCCeeEEcCCcccccccCCCeEEccCCCCCCC
Q psy89             4 QTQNHHLGLRIGYGHGYPQRCGFKNPTNTPWESGSYKLRMIFKDDYPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDEEKD   83 (119)
Q Consensus         4 ~~~~~~~~v~~~~~~~~~W~~~i~gp~~tpyegg~f~~~i~~p~~yP~~pP~v~f~t~i~HpnV~~~G~vcl~~l~~~~~   83 (119)
                      +.+...+.+...++|+++|+++|.||+||||+||+|+++|.||++||++||+|+|+|+++||||+++|.+|++++..  .
T Consensus        15 ~~~~~~i~~~~~~~d~~~w~~~i~gp~~tpy~gg~f~~~i~fp~~YP~~pP~v~f~t~i~HPnV~~~G~icl~~l~~--~   92 (146)
T d1i7ka_          15 MSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNISLDILKE--K   92 (146)
T ss_dssp             HHCCTTEEEEEETTEEEEEEEEEEBCTTSTTBTCEEEEEEECCTTTTTSCCEEEESSCCCSTTBCTTCBBCCGGGTT--T
T ss_pred             hCCCCCEEEEEcCCcccEEEEEEecCccccccCCEEEEEEEecCCCCcCCceeeecCCCCcccCCCCCccccccccc--c
Confidence            34445555567788999999999999999999999999999999999999999999999999999999999999985  9


Q ss_pred             CCCcCCHHHHHHHHHHHhcCCCCCCCcCHHHHhhc
Q psy89            84 WKPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIY  118 (119)
Q Consensus        84 W~p~~~l~~vl~~i~~~l~~p~~~~p~n~~aa~~y  118 (119)
                      |+|++++++||.+|+++|.+|++++|+|.|||++|
T Consensus        93 W~p~~~i~~il~~i~~ll~~p~~~~p~n~~aa~l~  127 (146)
T d1i7ka_          93 WSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELW  127 (146)
T ss_dssp             CCTTCCHHHHHHHHHHHHHSCCTTSCSCHHHHHHT
T ss_pred             CCCCcCHHHHHHHHHHHHhCCCCCCchhHHHHHHh
Confidence            99999999999999999999999999999999876
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure