Psyllid ID: psy9046

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MGTLIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIALYVLEQDGDMFSVNNITVCEFQLSVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTPCSHFRVNIKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDSDENPHLTYKILSGNDDDVFAVDDTGILTIQGPLAKGKTVYNLLVQVSD
cEEEEEEEEEEcccccccccccccccccEEEEEEcccccccEEEEEEEEEccccEEEEEEEcccccEEEEcccccEEEEEEEEEEcccccEEEEEEEcccccccEEEEEEEEEEccccccEEEEEEEEEEcccccccccccEEEEEEEccccccccEEEEEEEcccccccccEEEEEEEccccccEEEcccEEEEEcccccccccEEEEEEEEEc
ccEEEEEEEEccccccccccccccccccEEEEEccccccccEEEEEEEEcccccEEEEEEEccccEEEEEccccEEEEEcccHHccccEEEEEEEEccccccccccccccEcccccccccEEEEEEEEEEccccccccccccEEEEEccccccccEEEEEEEEEcccccccEEEEEEEcccccccEEEcccEEEEEEcccccHcccEEEEEEEEc
MGTLIISIidvndippefeppwtrdepnylleieeeqpigsllgkftaldkdssIALYVLEqdgdmfsvnnitvcefqLSVDLAAADNFQseynatikenspgdtKVVLVSaedastpcshfrvnikvldvndnrpefksktYRTSIQeniiitpsptlltleatdsdenphltykilsgndddvfavddtgiltiqgplakgktvYNLLVQVSD
MGTLIIsiidvndippefeppwTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIALYVLEQDGDMFSVNNITVCEFQLSVDLAAADNFQSEYnatikenspgDTKVVLVSAedastpcshfrvnikvldvndnrpefksktyrtsiqeniiitpsptlLTLEATDSDENPHLTYKILSGNDDDVFAVDDTGILtiqgplakgktvynllvqvsd
MGTLIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIALYVLEQDGDMFSVNNITVCEFQLSVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTPCSHFRVNIKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDSDENPHLTYKILSGNDDDVFAVDDTGILTIQGPLAKGKTVYNLLVQVSD
***LIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIALYVLEQDGDMFSVNNITVCEFQLSVDLAAADNFQSEYNATI*******TKVVLVSAEDASTPCSHFRVNIKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLT******************************************************
MGTLIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIALYVLEQDGDMFSVNNITVCEFQLSVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTPCSHFRVNIKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDSDENPHLTYKILSGNDDDVFAVDDTGILTIQGPLAKGKTVYNLLVQVSD
MGTLIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIALYVLEQDGDMFSVNNITVCEFQLSVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTPCSHFRVNIKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDSDENPHLTYKILSGNDDDVFAVDDTGILTIQGPLAKGKTVYNLLVQVSD
MGTLIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIALYVLEQDGDMFSVNNITVCEFQLSVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTPCSHFRVNIKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDSDENPHLTYKILSGNDDDVFAVDDTGILTIQGPLAKGKTVYNLLVQVSD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTLIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIALYVLEQDGDMFSVNNITVCEFQLSVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTPCSHFRVNIKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDSDENPHLTYKILSGNDDDVFAVDDTGILTIQGPLAKGKTVYNLLVQVSD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query215 2.2.26 [Sep-21-2011]
Q2PZL6 4981 Protocadherin Fat 4 OS=Mu yes N/A 0.869 0.037 0.336 3e-17
Q6V0I7 4981 Protocadherin Fat 4 OS=Ho yes N/A 0.865 0.037 0.334 1e-15
Q9VGG5 1975 Cadherin-87A OS=Drosophil yes N/A 0.762 0.083 0.295 2e-13
Q9H251 3354 Cadherin-23 OS=Homo sapie no N/A 0.809 0.051 0.344 5e-13
Q99PF4 3354 Cadherin-23 OS=Mus muscul no N/A 0.874 0.056 0.330 3e-12
P58365 3317 Cadherin-23 OS=Rattus nor no N/A 0.874 0.056 0.330 4e-11
Q8BNA6 4555 Protocadherin Fat 3 OS=Mu no N/A 0.879 0.041 0.285 6e-11
Q8TDW7 4589 Protocadherin Fat 3 OS=Ho no N/A 0.879 0.041 0.289 1e-10
Q6V1P9 2916 Protocadherin-23 OS=Homo no N/A 0.902 0.066 0.294 2e-10
Q8R508 4555 Protocadherin Fat 3 OS=Ra no N/A 0.879 0.041 0.280 3e-10
>sp|Q2PZL6|FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus GN=Fat4 PE=1 SV=2 Back     alignment and function desciption
 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/217 (33%), Positives = 102/217 (47%), Gaps = 30/217 (13%)

Query: 6    ISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSS----IALYVLE 61
            I+I DVND  P F        P Y  +I E+   GSL+    A D DS     I+  V E
Sbjct: 1829 ITISDVNDHTPRFS------RPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEE 1882

Query: 62   QDGDMFSVNNITVCEFQLSVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTPCSH 121
             DGD     N+    F L+    A D    +Y             ++ V AED     + 
Sbjct: 1883 DDGDGVFFLNLVTGVFNLT---RALDYETQQY------------YILTVRAEDGGGQSTT 1927

Query: 122  FRVNIKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDSDE--NPHLTYKILS 179
             R    +LDVNDN P F   +Y TS+ EN+ +    T+L    TD+D+  N  L+Y I S
Sbjct: 1928 IRAYFNILDVNDNPPVFSMSSYSTSLMENLPL--GSTVLVFNVTDADDGVNSQLSYSIAS 1985

Query: 180  GNDDDVFAVDDTGIL-TIQGPLAKGKTVYNLLVQVSD 215
            G+    FAVD  G+L T++    + ++ YNL++QV D
Sbjct: 1986 GDSLGQFAVDKHGVLKTLKALDRESQSFYNLVIQVHD 2022
May function in the regulation of planar cell polarity. Cadherins are cell-cell interaction molecules.
Mus musculus (taxid: 10090)
>sp|Q6V0I7|FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens GN=FAT4 PE=1 SV=2 Back     alignment and function description
>sp|Q9VGG5|CAD87_DROME Cadherin-87A OS=Drosophila melanogaster GN=Cad87A PE=1 SV=4 Back     alignment and function description
>sp|Q9H251|CAD23_HUMAN Cadherin-23 OS=Homo sapiens GN=CDH23 PE=1 SV=2 Back     alignment and function description
>sp|Q99PF4|CAD23_MOUSE Cadherin-23 OS=Mus musculus GN=Cdh23 PE=1 SV=2 Back     alignment and function description
>sp|P58365|CAD23_RAT Cadherin-23 OS=Rattus norvegicus GN=Cdh23 PE=2 SV=1 Back     alignment and function description
>sp|Q8BNA6|FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus GN=Fat3 PE=1 SV=2 Back     alignment and function description
>sp|Q8TDW7|FAT3_HUMAN Protocadherin Fat 3 OS=Homo sapiens GN=FAT3 PE=2 SV=2 Back     alignment and function description
>sp|Q6V1P9|PCD23_HUMAN Protocadherin-23 OS=Homo sapiens GN=DCHS2 PE=2 SV=1 Back     alignment and function description
>sp|Q8R508|FAT3_RAT Protocadherin Fat 3 OS=Rattus norvegicus GN=Fat3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
332019447 1629 Cadherin-87A [Acromyrmex echinatior] 0.995 0.131 0.292 1e-25
307207662 1705 Cadherin-87A [Harpegnathos saltator] 0.995 0.125 0.292 2e-25
322792776 1463 hypothetical protein SINV_01844 [Solenop 0.995 0.146 0.289 2e-25
307178971 1772 Cadherin-87A [Camponotus floridanus] 0.995 0.120 0.282 1e-24
383851146 1889 PREDICTED: cadherin-87A-like [Megachile 0.823 0.093 0.346 2e-23
345494251 1595 PREDICTED: cadherin-87A-like [Nasonia vi 0.832 0.112 0.328 1e-22
340729964 1903 PREDICTED: cadherin-87A-like [Bombus ter 0.832 0.094 0.343 1e-22
350402296 1897 PREDICTED: cadherin-87A-like [Bombus imp 0.832 0.094 0.343 1e-22
91078062 1887 PREDICTED: similar to conserved hypothet 0.995 0.113 0.302 3e-22
328782343 1904 PREDICTED: cadherin-87A-like [Apis melli 0.823 0.092 0.331 7e-22
>gi|332019447|gb|EGI59930.1| Cadherin-87A [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 91/311 (29%), Positives = 137/311 (44%), Gaps = 97/311 (31%)

Query: 2    GTLIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIALYVLE 61
            G L+++IIDVN + PEF  PWTR+ P YL+E++EEQP G+++G FTA D DS+IA Y ++
Sbjct: 723  GKLVVTIIDVNHMAPEFLKPWTRENPRYLIEMQEEQPTGAVVGAFTATDADSNIAGYAID 782

Query: 62   QDGDMFSVNNIT-------VCEF----QLSVDLAAADN---------------------- 88
                 F+++NIT       V ++    QL   + A D+                      
Sbjct: 783  PPSPYFNIDNITGIVRTSQVIDYEETKQLEFTVVAYDSGVPQLSTTAKVTVTVINVNDQD 842

Query: 89   --FQSE-YNATIKENSP------------------GDTKVVLVSAEDASTPCSH------ 121
              F+ E YNA++KENSP                  GD    L+    A     H      
Sbjct: 843  PKFEKELYNASVKENSPPGTRVIVVKATDGDEGPFGDVSYSLIGEHAADFNIGHETGEIT 902

Query: 122  ----------------------------------FRVNIKVLDVNDNRPEFKSKTYRTSI 147
                                                V +K++D NDNRP F   +YR S+
Sbjct: 903  VGGATVLDREVTPEITITVMASDGAHINSRRSTTVPVVVKLIDENDNRPIFSQHSYRASV 962

Query: 148  QENIIITPSPTLLTLEATDSDE--NPHLTYKILSGNDDDVFAVD-DTGILTIQGPLAKGK 204
             EN+ + P   +L + A D DE  N  + Y I++GN+++ F+++ +TGIL     L    
Sbjct: 963  AENLSVNPPAPILQVRAADQDEGINGEVWYTIINGNENESFSLNRETGILYPAAALLGRA 1022

Query: 205  TVYNLLVQVSD 215
              Y + V+  D
Sbjct: 1023 GSYRIEVEARD 1033

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307207662|gb|EFN85300.1| Cadherin-87A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322792776|gb|EFZ16609.1| hypothetical protein SINV_01844 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307178971|gb|EFN67487.1| Cadherin-87A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383851146|ref|XP_003701100.1| PREDICTED: cadherin-87A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345494251|ref|XP_001605047.2| PREDICTED: cadherin-87A-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340729964|ref|XP_003403262.1| PREDICTED: cadherin-87A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350402296|ref|XP_003486436.1| PREDICTED: cadherin-87A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|91078062|ref|XP_971507.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270002730|gb|EEZ99177.1| cadherin 23 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328782343|ref|XP_392736.4| PREDICTED: cadherin-87A-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
UNIPROTKB|F1NLP0 4964 FAT4 "Uncharacterized protein" 0.865 0.037 0.316 1.2e-16
UNIPROTKB|Q9H251 3354 CDH23 "Cadherin-23" [Homo sapi 0.874 0.056 0.353 1.2e-16
UNIPROTKB|F1LY95 3251 F1LY95 "Uncharacterized protei 0.925 0.061 0.292 2.4e-16
MGI|MGI:3045256 4981 Fat4 "FAT tumor suppressor hom 0.865 0.037 0.330 5e-16
MGI|MGI:1890219 3354 Cdh23 "cadherin 23 (otocadheri 0.874 0.056 0.348 6.8e-16
UNIPROTKB|E1B949 4983 FAT4 "Uncharacterized protein" 0.865 0.037 0.325 1e-15
RGD|1564291 4981 Fat4 "FAT tumor suppressor hom 0.865 0.037 0.325 1.3e-15
UNIPROTKB|Q6V0I7 4981 FAT4 "Protocadherin Fat 4" [Ho 0.865 0.037 0.330 3.6e-15
UNIPROTKB|F1LPE5 3271 Cdh23 "Cadherin-23" [Rattus no 0.874 0.057 0.348 4.7e-15
UNIPROTKB|F1M2P9 3306 Cdh23 "Cadherin-23" [Rattus no 0.874 0.056 0.348 4.8e-15
UNIPROTKB|F1NLP0 FAT4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 226 (84.6 bits), Expect = 1.2e-16, P = 1.2e-16
 Identities = 68/215 (31%), Positives = 108/215 (50%)

Query:     9 IDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSI---ALYVLEQDGD 65
             I V+D+     P +++  P Y  +I E+   GSL+    A D DS I     Y + +D +
Sbjct:  1807 ITVSDVNDHI-PKFSK--PVYSFDIPEDATPGSLVAAILATDDDSGINGEITYTVSEDDE 1863

Query:    66 --MFSVNNITVCEFQLSVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTPCSHFR 123
               MF +N +T   F L+    A D    +Y             ++ + AED     +  R
Sbjct:  1864 EGMFFLNPVTGV-FNLT---RALDYEAQQYY------------ILTIRAEDGGGQFATIR 1907

Query:   124 VNIKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDSDE--NPHLTYKILSGN 181
             V   +LD+NDN P F   +Y TS+ EN+   P   +L    TD+D+  N  L++ I SG+
Sbjct:  1908 VYFNILDINDNPPVFSMTSYSTSLMENL--APGSAILNFSVTDADDGSNSQLSFSIASGD 1965

Query:   182 DDDVFAVDDTGILTIQGPLAK-GKTVYNLLVQVSD 215
                 F +D++G+L+IQ PL +  ++ Y+L+VQV D
Sbjct:  1966 SMGHFGIDNSGVLSIQQPLDRESQSFYSLVVQVHD 2000
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0007156 "homophilic cell adhesion" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
UNIPROTKB|Q9H251 CDH23 "Cadherin-23" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LY95 F1LY95 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:3045256 Fat4 "FAT tumor suppressor homolog 4 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:1890219 Cdh23 "cadherin 23 (otocadherin)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1B949 FAT4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1564291 Fat4 "FAT tumor suppressor homolog 4 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6V0I7 FAT4 "Protocadherin Fat 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPE5 Cdh23 "Cadherin-23" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M2P9 Cdh23 "Cadherin-23" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 3e-10
pfam0002892 pfam00028, Cadherin, Cadherin domain 2e-07
smart0011281 smart00112, CA, Cadherin repeats 2e-06
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 3e-05
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information 
 Score = 54.6 bits (132), Expect = 3e-10
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 8/79 (10%)

Query: 142 TYRTSIQENIIITPSPT-LLTLEATDSDE--NPHLTYKILSGNDDDVFAVD-DTGILTIQ 197
           +Y  S+ EN    P  T +LT+ ATD D   N  +TY I+SGN+D +F++D  TG +T  
Sbjct: 1   SYEVSVPEN---APPGTVVLTVSATDPDSGENGEVTYSIVSGNEDGLFSIDPSTGEITTA 57

Query: 198 GPL-AKGKTVYNLLVQVSD 215
            PL  + ++ Y L V  +D
Sbjct: 58  KPLDREEQSSYTLTVTATD 76

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 215
KOG4289|consensus 2531 100.0
KOG4289|consensus 2531 100.0
KOG1219|consensus 4289 100.0
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.98
KOG1219|consensus 4289 99.98
KOG1834|consensus 952 99.83
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.72
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.65
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.63
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.48
KOG1834|consensus 952 99.08
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 98.79
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 97.87
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.11
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.03
PF13750158 Big_3_3: Bacterial Ig-like domain (group 3) 96.88
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 96.64
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 96.17
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 95.79
PF0534549 He_PIG: Putative Ig domain; InterPro: IPR008009 Th 93.55
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 93.05
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 84.18
KOG3597|consensus 442 82.58
PF1224560 Big_3_2: Bacterial Ig-like domain (group 3); Inter 80.37
>KOG4289|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.7e-38  Score=282.41  Aligned_cols=191  Identities=29%  Similarity=0.430  Sum_probs=178.1

Q ss_pred             CeEEEEEEEecCCCCCccCCCCCCCCCceEEEEecCCCCCcEEEEEEEEeCCCCce---eEEEecCC--CcEEEeCCccc
Q psy9046           1 MGTLIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIA---LYVLEQDG--DMFSVNNITVC   75 (215)
Q Consensus         1 t~~v~I~V~DvND~~P~f~~~~~~~~~~~~~~V~E~~~~g~~v~~v~a~D~D~~~~---~y~i~~~~--~~F~id~~tg~   75 (215)
                      |++|+|.|+|+|||.|+|      ++..|.-++.||.++|..|.++.|+|.|.+.+   .|++..|+  ..|.|++.+|.
T Consensus       252 tttv~V~V~D~nDhsPvF------Eq~~Y~e~lREn~evGy~vLtvrAtD~Dsp~Nani~Yrl~eg~~~~~f~in~rSGv  325 (2531)
T KOG4289|consen  252 TTTVTVLVLDTNDHSPVF------EQDEYREELRENLEVGYEVLTVRATDGDSPPNANIRYRLLEGNAKNVFEINPRSGV  325 (2531)
T ss_pred             eeEEEEEEeecCCCCccc------chhHHHHHHhhccccCceEEEEEeccCCCCCCCceEEEecCCCccceeEEcCccce
Confidence            689999999999999999      79999999999999999999999999999876   59997764  79999999998


Q ss_pred             eEEEEEEEecCCCcceeeEEEEecCCCCCeEEEEEEEEeCCCC--ceEEEEEEEEeeCCCCCCccCCCceEEEEecCCCC
Q psy9046          76 EFQLSVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTP--CSHFRVNIKVLDVNDNRPEFKSKTYRTSIQENIII  153 (215)
Q Consensus        76 ~~~~~~~~~ld~e~~~~~~~~~~e~~~~~~~~l~v~a~D~~~~--~~~~~v~I~V~DvNdn~P~f~~~~~~~~v~E~~~~  153 (215)
                      |.+-.   ++|||....|+             |.|.|+|.|.+  ..++.|.|+|.|+|||+|+|..+.|.++|.|+..+
T Consensus       326 I~T~a---~lDRE~~~~y~-------------L~VeAsDqG~~pgp~Ta~V~itV~D~NDNaPqFse~~Yvvqv~Edvt~  389 (2531)
T KOG4289|consen  326 ISTRA---PLDREELESYQ-------------LDVEASDQGRPPGPRTAMVEITVEDENDNAPQFSEKRYVVQVREDVTP  389 (2531)
T ss_pred             eeccC---ccCHHhhhheE-------------EEEEeccCCCCCCCceEEEEEEEEecCCCCccccccceEEEecccCCC
Confidence            55443   79999999999             79999999876  56999999999999999999999999999999986


Q ss_pred             CCCCEEEEEEEEeCCC--CCeEEEEEeeCCCCCcEEEcC-CeeEEEcccCCCCccEEEEEEEEEC
Q psy9046         154 TPSPTLLTLEATDSDE--NPHLTYKILSGNDDDVFAVDD-TGILTIQGPLAKGKTVYNLLVQVSD  215 (215)
Q Consensus       154 g~~~~i~~v~a~D~D~--~~~i~y~i~~~~~~~~F~Id~-~G~i~~~~~ld~~~~~y~l~V~a~D  215 (215)
                      +  +.|++|+|+|.|.  |+.++|+|.+|+..+.|.||. +|+|.+..+||.+...|++.|+|+|
T Consensus       390 ~--avvlrV~AtDrD~g~Ng~VHYsi~Sgn~~G~f~id~~tGel~vv~plD~e~~~ytl~IrAqD  452 (2531)
T KOG4289|consen  390 P--AVVLRVTATDRDKGTNGKVHYSIASGNGRGQFYIDSLTGELDVVEPLDFENSEYTLRIRAQD  452 (2531)
T ss_pred             C--ceEEEEEecccCCCcCceEEEEeeccCccccEEEecccceEEEeccccccCCeeEEEEEccc
Confidence            6  9999999999999  999999999999999999999 9999999999988779999999987

>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF13750 Big_3_3: Bacterial Ig-like domain (group 3) Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information
>PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>KOG3597|consensus Back     alignment and domain information
>PF12245 Big_3_2: Bacterial Ig-like domain (group 3); InterPro: IPR022038 This family of proteins is found in bacteria Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
3qrb_A213 Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Lengt 1e-05
3lng_A215 Crystal Structure Of E-Cadherin Ec12 Aa Extension L 2e-05
3lnf_A213 Crystal Structure Of E-Cadherin Ec12 K14ew2a Length 2e-05
3q2l_A213 Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 2e-05
3lne_A213 Crystal Structure Of E-Cadherin Ec12 K14e Length = 2e-05
1ff5_A219 Structure Of E-Cadherin Double Domain Length = 219 2e-05
3q2n_A213 Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 2e-05
3lnh_A213 Crystal Structure Of E-Cadherin Ec12 W2a Length = 2 2e-05
1q1p_A212 E-Cadherin Activation Length = 212 2e-05
3lni_A213 Crystal Structure Of E-Cadherin Ec12 E89a Length = 2e-05
2qvf_B213 Mouse E-cadherin Domains 1,2 Length = 213 2e-05
1edh_A226 E-Cadherin Domains 1 And 2 In Complex With Calcium 2e-05
3q2v_A 550 Crystal Structure Of Mouse E-Cadherin Ectodomain Le 2e-05
3ppe_A203 Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Leng 3e-05
1l3w_A 546 C-Cadherin Ectodomain Length = 546 4e-05
2o72_A213 Crystal Structure Analysis Of Human E-Cadherin (1-2 5e-05
1q55_A 880 W-Shaped Trans Interactions Of Cadherins Model Base 5e-05
3q2w_A 559 Crystal Structure Of Mouse N-Cadherin Ectodomain Le 6e-05
3q2w_A 559 Crystal Structure Of Mouse N-Cadherin Ectodomain Le 1e-04
2qvi_A215 Crystal Structure Of N-Cadherin Domains Ec12 Length 1e-04
1ncj_A215 N-Cadherin, Two-Domain Fragment Length = 215 2e-04
3ubh_A419 Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le 5e-04
>pdb|3QRB|A Chain A, Crystal Structure Of E-Cadherin Ec1-2 P5a P6a Length = 213 Back     alignment and structure 
Iteration: 1

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (54%), Gaps = 14/102 (13%)
Query: 126 IKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDSDE-----NPHLTYKILSG 180
           I V D NDNRPEF  + +  S+ E  +  P  +++ + ATD+D+     N  + Y I+S 
Sbjct: 96  ITVTDQNDNRPEFTQEVFEGSVAEGAV--PGTSVMKVSATDADDDVNTYNAAIAYTIVSQ 153
Query: 181 NDD----DVFAVD-DTGILTI--QGPLAKGKTVYNLLVQVSD 215
           + +    ++F V+ DTG++++   G   +    Y L+VQ +D
Sbjct: 154 DPELPHKNMFTVNRDTGVISVLTSGLDRESYPTYTLVVQAAD 195
>pdb|3LNG|A Chain A, Crystal Structure Of E-Cadherin Ec12 Aa Extension Length = 215 Back     alignment and structure
>pdb|3LNF|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14ew2a Length = 213 Back     alignment and structure
>pdb|3Q2L|A Chain A, Mouse E-Cadherin Ec1-2 V81d Mutant Length = 213 Back     alignment and structure
>pdb|3LNE|A Chain A, Crystal Structure Of E-Cadherin Ec12 K14e Length = 213 Back     alignment and structure
>pdb|1FF5|A Chain A, Structure Of E-Cadherin Double Domain Length = 219 Back     alignment and structure
>pdb|3Q2N|A Chain A, Mouse E-Cadherin Ec1-2 L175d Mutant Length = 213 Back     alignment and structure
>pdb|3LNH|A Chain A, Crystal Structure Of E-Cadherin Ec12 W2a Length = 213 Back     alignment and structure
>pdb|1Q1P|A Chain A, E-Cadherin Activation Length = 212 Back     alignment and structure
>pdb|3LNI|A Chain A, Crystal Structure Of E-Cadherin Ec12 E89a Length = 213 Back     alignment and structure
>pdb|2QVF|B Chain B, Mouse E-cadherin Domains 1,2 Length = 213 Back     alignment and structure
>pdb|1EDH|A Chain A, E-Cadherin Domains 1 And 2 In Complex With Calcium Length = 226 Back     alignment and structure
>pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 Back     alignment and structure
>pdb|3PPE|A Chain A, Crystal Structure Of Chicken Ve-Cadherin Ec1-2 Length = 203 Back     alignment and structure
>pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 Back     alignment and structure
>pdb|2O72|A Chain A, Crystal Structure Analysis Of Human E-Cadherin (1-213) Length = 213 Back     alignment and structure
>pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 Back     alignment and structure
>pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 Back     alignment and structure
>pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 Back     alignment and structure
>pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 Back     alignment and structure
>pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 Back     alignment and structure
>pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 4e-28
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 1e-13
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 3e-06
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 3e-25
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-22
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-21
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-07
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 1e-24
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 4e-19
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 1e-09
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-24
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-23
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-21
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-16
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-05
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-24
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 7e-24
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 5e-21
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 1e-04
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-23
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-21
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 6e-21
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-08
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 4e-22
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 2e-10
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 1e-21
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-20
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-19
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 1e-04
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 6e-18
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 3e-12
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 9e-18
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 3e-08
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 3e-17
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 4e-06
2qvi_A 215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 6e-05
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 7e-17
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 3e-08
3ppe_A 203 Vascular endothelial cadherin; extracellular cadhe 6e-06
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 2e-16
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 7e-06
3k5r_A 218 Cadherin 13; mouse, structural protein; 2.00A {Mus 9e-05
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 6e-16
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 6e-06
3qrb_A 213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 1e-05
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 1e-13
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 1e-11
2x2u_A 246 Proto-oncogene tyrosine-protein kinase receptor RE 3e-04
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 1e-13
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 2e-05
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 3e-13
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 9e-06
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 2e-07
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 1e-06
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 5e-06
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 6e-06
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 8e-06
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 8e-06
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 4e-05
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 6e-04
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
 Score =  106 bits (268), Expect = 4e-28
 Identities = 49/236 (20%), Positives = 88/236 (37%), Gaps = 51/236 (21%)

Query: 3   TLIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSIA------ 56
             II + D+ND  PEF          Y   + E   +G+ +   TA D D  +       
Sbjct: 91  EFIIKVQDINDNAPEFL------NGPYHATVPEMSILGTSVTNVTATDADDPVYGNSAKL 144

Query: 57  LYVLEQDGDMFSVN----NITVCEFQLSVDLAAAD-NFQSEYNATIKENSPGDTKVVLVS 111
           +Y + +    FS+      I      +       D   + EY              V++ 
Sbjct: 145 VYSILEGQPYFSIEPETAIIKTALPNM-------DREAKEEYL-------------VVIQ 184

Query: 112 AEDASTPC----SHFRVNIKVLDVNDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDS 167
           A+D             + + + DVNDN P+F    Y  S+ E+  +     +  ++A D 
Sbjct: 185 AKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPED--VVLGTAIGRVKANDQ 242

Query: 168 DENP--HLTYKILSGNDDDVFAVD-----DTGILTIQGPLA-KGKTVYNLLVQVSD 215
           D       +Y I+ G+   +F +        G++ ++ PL  + K  Y L V+ ++
Sbjct: 243 DIGENAQSSYDIIDGDGTALFEITSDAQAQDGVIRLRKPLDFETKKSYTLKVEAAN 298
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 100.0
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 100.0
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 100.0
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 100.0
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 100.0
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 100.0
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 100.0
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 100.0
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 100.0
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 100.0
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 100.0
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 100.0
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 100.0
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 100.0
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 100.0
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 100.0
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 100.0
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 100.0
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 100.0
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.97
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 99.97
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.97
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.95
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.94
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.94
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.93
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.93
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.89
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.89
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.88
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.88
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.88
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.87
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.87
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.85
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.85
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.83
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.79
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.68
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.66
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.65
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.61
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.61
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.6
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.58
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.57
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.55
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.52
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.49
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.49
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.48
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.45
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.41
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.23
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.04
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 95.97
2yhg_A437 SDE_182CT, cellulose-binding protein; hydrolase, g 91.89
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 89.88
2yrl_A102 KIAA1837 protein; PKD domain, NPPSFA, national pro 87.71
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 86.88
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=3.2e-43  Score=290.05  Aligned_cols=191  Identities=26%  Similarity=0.442  Sum_probs=171.7

Q ss_pred             eEEEEEEEecCCCCCccCCCCCCCCCceEEEEecCCCCCcEEEEEEEEeCCC---Cc---eeEEEecCCCcEEEeCCccc
Q psy9046           2 GTLIISIIDVNDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDS---SI---ALYVLEQDGDMFSVNNITVC   75 (215)
Q Consensus         2 ~~v~I~V~DvND~~P~f~~~~~~~~~~~~~~V~E~~~~g~~v~~v~a~D~D~---~~---~~y~i~~~~~~F~id~~tg~   75 (215)
                      ++|+|.|.|+|||+|.|      ....|.++|+|++++|+.|+++.|+|+|.   |.   ..|+|.+++.+|.|++.+|.
T Consensus        90 ~~v~I~V~DvNDn~P~F------~~~~y~~~v~E~~~~gt~v~~v~A~D~D~~~~G~n~~i~Y~i~~~~~~F~Id~~tG~  163 (322)
T 2a62_A           90 SEFIIKVQDINDNAPEF------LNGPYHATVPEMSILGTSVTNVTATDADDPVYGNSAKLVYSILEGQPYFSIEPETAI  163 (322)
T ss_dssp             EEECEECCCCSCSCBCC------SSSEEEEEECSSCCTTCBCCCCCCCBCSCSSSTTSSCEEEEEEECTTTEEECTTTCC
T ss_pred             EEEEEEEEecCCCCCcc------CCCceEEEEeCCCCCCCEEEEEEEEeCCCCCCCccEEEEEEEccCCCCEEEecCCCE
Confidence            57899999999999999      58899999999999999999999999995   43   47999988999999999998


Q ss_pred             eEEEEEEEecCCCcceeeEEEEecCCCCCeEEEEEEEEeCCCC----ceEEEEEEEEeeCCCCCCccCCCceEEEEecCC
Q psy9046          76 EFQLSVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTP----CSHFRVNIKVLDVNDNRPEFKSKTYRTSIQENI  151 (215)
Q Consensus        76 ~~~~~~~~~ld~e~~~~~~~~~~e~~~~~~~~l~v~a~D~~~~----~~~~~v~I~V~DvNdn~P~f~~~~~~~~v~E~~  151 (215)
                      +.+...  .||||....|.             |.|.|+|++.|    +++++|+|+|.|+|||+|.|.+..|.+.|.|++
T Consensus       164 i~~~~~--~LD~E~~~~y~-------------l~V~a~D~g~p~~~~s~~~~v~I~V~DvNDn~P~F~~~~y~~~v~En~  228 (322)
T 2a62_A          164 IKTALP--NMDREAKEEYL-------------VVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPEDV  228 (322)
T ss_dssp             EEECSS--CCCGGGCSEEE-------------EEEEEEESCSSSSCCBCCEEEEEEECCCCCCCCCCSCSEEEEEECSCC
T ss_pred             EEeccc--CCCcccCCeEE-------------EEEEEEECCCCCCCceeEEEEEEEEEecCCCCCeecCCCceeEeECCC
Confidence            655412  79999999998             79999998864    688999999999999999999999999999999


Q ss_pred             CCCCCCEEEEEEEEeCCC--CCeEEEEEeeCCCCCcEEEc----C-CeeEEEcccCCCC-ccEEEEEEEEEC
Q psy9046         152 IITPSPTLLTLEATDSDE--NPHLTYKILSGNDDDVFAVD----D-TGILTIQGPLAKG-KTVYNLLVQVSD  215 (215)
Q Consensus       152 ~~g~~~~i~~v~a~D~D~--~~~i~y~i~~~~~~~~F~Id----~-~G~i~~~~~ld~~-~~~y~l~V~a~D  215 (215)
                      ++|  +.|+++.|+|+|.  |+.++|+|..++..+.|.|+    + +|.|++.++||+| ...|.|+|+|+|
T Consensus       229 ~~g--t~v~~v~A~D~D~g~n~~i~Y~i~~g~~~~~F~I~~d~~~~tG~i~~~~~LD~E~~~~y~l~V~A~D  298 (322)
T 2a62_A          229 VLG--TAIGRVKANDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGVIRLRKPLDFETKKSYTLKVEAAN  298 (322)
T ss_dssp             SSC--CEEEEEECCCSSCGGGTCCEEEEC---CCSSBCCBCCTTTSEEEEEBCSCCCCSSCCEEEEEEEEEC
T ss_pred             CCC--cEEEEEEEEeCCCCCCceEEEEEECCCCCCcEEEeccCCCceEEEEECCcCCcccCCeEEEEEEEEE
Confidence            988  9999999999998  88999999988878899998    4 8999999999965 789999999998
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure
>2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>2yrl_A KIAA1837 protein; PKD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 215
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 8e-06
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 2e-05
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 2e-04
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 2e-04
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 0.003
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 0.002
d1l3wa5107 b.1.6.1 (A:434-540) C-cadherin ectodomain {African 0.002
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 0.003
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score = 41.5 bits (96), Expect = 8e-06
 Identities = 19/90 (21%), Positives = 30/90 (33%), Gaps = 6/90 (6%)

Query: 132 NDNRPEFKSKTYRTSIQENIIITPSPTLLTLEATDSDENPHLTYKILSGNDDDVFAVD-- 189
           NDN P F  KTY   + EN I      L   +              +  N+   F +   
Sbjct: 2   NDNAPIFDPKTYTALVPENEIGFEVQRLSVTDLDMPGTPAWQAVYKIRVNEGGFFNITTD 61

Query: 190 ----DTGILTIQGPLAKGKTVYNLLVQVSD 215
                  + T +G   + +  Y L + V +
Sbjct: 62  PESNQGILTTAKGLDFELRKQYVLQITVEN 91
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.83
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.82
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.81
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.8
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.78
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.77
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.76
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.76
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.72
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.7
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.68
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.66
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.6
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.32
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.32
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.28
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.27
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.27
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.24
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.2
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 92.57
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 90.02
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: E-cadherin (epithelial)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.83  E-value=7e-21  Score=131.62  Aligned_cols=98  Identities=26%  Similarity=0.314  Sum_probs=84.3

Q ss_pred             CCCCCccCCCCCCCCCceEEEEecCCCCCcEEEEEEEEeCCCCc------eeEEEecC------CCcEEEeCCccceEEE
Q psy9046          12 NDIPPEFEPPWTRDEPNYLLEIEEEQPIGSLLGKFTALDKDSSI------ALYVLEQD------GDMFSVNNITVCEFQL   79 (215)
Q Consensus        12 ND~~P~f~~~~~~~~~~~~~~V~E~~~~g~~v~~v~a~D~D~~~------~~y~i~~~------~~~F~id~~tg~~~~~   79 (215)
                      |||+|+|      .+..|.+.|+|+.++|+.|+++.|+|+|.|.      ..|+|..+      ..+|.|++.+|.+.++
T Consensus         1 NDn~P~F------~~~~y~~~V~E~~~~gt~v~~v~A~D~D~g~~~~n~~v~y~i~~~~~~~~~~~~F~i~~~tG~i~~~   74 (112)
T d1edha2           1 NDNRPEF------TQEVFEGSVAEGAVPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVL   74 (112)
T ss_dssp             SCCCCEE------SCSEEEEEEETTCCTTCEEEECCEECCSCTTTCSTTCCEEEEEEEESCCSCSCSEEECTTTCEEEEC
T ss_pred             CCCCCcc------CCCEEEEEEECCCCCCCEEEEEEEEecccCCccccceEEEEEecCCccccceeEEEEecccceEEEE
Confidence            8999999      5899999999999999999999999999753      36998542      3689999999986554


Q ss_pred             EEEEecCCCcceeeEEEEecCCCCCeEEEEEEEEeCCCC--ceEEEEEEEEee
Q psy9046          80 SVDLAAADNFQSEYNATIKENSPGDTKVVLVSAEDASTP--CSHFRVNIKVLD  130 (215)
Q Consensus        80 ~~~~~ld~e~~~~~~~~~~e~~~~~~~~l~v~a~D~~~~--~~~~~v~I~V~D  130 (215)
                      +.  .||||....|.             |.|.|+|.+.|  +++++|.|+|+|
T Consensus        75 ~~--~lD~E~~~~y~-------------l~V~a~D~g~~~~~~~~~v~I~V~D  112 (112)
T d1edha2          75 TS--GLDRESYPTYT-------------LVVQAADLQGEGLSTTAKAVITVKD  112 (112)
T ss_dssp             SS--CCCTTTCCEEE-------------EEEEEETGGGTSCEEEEEEEEEEEC
T ss_pred             ec--ccccccCcEEE-------------EEEEEEECCCCccEEEEEEEEEEEC
Confidence            43  69999999998             78999998876  788899999987
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure