Psyllid ID: psy9164


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380
MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEHGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELKGFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPTATIGPGCRIGPNVTIGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIGWKCVVGQWVRMENITVLGEDVIVQDELYVNGGQVLPHKSIGSSLHMLGEDVIVQDELYVNGGQVLPHKSIGSSVPEPQIIM
cHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHccccccEEEEEccEEccccHHHHHHHHHHccccEEEEEEEEccccccEEEEEccccEEEEEEEccccccccEEEEEEEEccHHHHccccccccccccccHHHHHccccEEEEEEccEEcccccHHHHHHHHHHHHHHcccccccccccccEEEccEEEccccEEccccEEcccEEEccccEEccccEEccEEEccccEEccccEEEccEEccccEEccccEEEcEEEEcccEEcccEEEcccEEEcccEEEccccEEccccEEEccEEccccEEEcccccccccEEEccEEEEcccEEEcccccccccccccccc
cHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHcHHHccEEEEEEEcccccccHHHHHHHHHHHccccccEEEEEccEEccccHHHHHHHHHHcccEEEEEEEEcccccccEEEEEcccccEEEEEEccccccccEEEcEEEEEcHHHHHHcccccccHHHHHHHHHHccccEEEEEcccccHccccHHHHHHHHHHHHHHHcccccHHccccccEcccEEEccccEEccccEEcccEEEcccEEEcccEEEEEEEEEccEEEcccEEEEcEEEEcccEEcccEEEEccEEEccEEEcccEEEcccEEEccEEEEcccEEEccEEEEccEEEEccccEcccEEEccccEEEccEEEEccEEEEcccEEccccccccEcc
MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFsheneplgtagpLALAKDILnksqepffvlnsdiicdfpfkDLVSFhknhgkegTIVVTQVEEPSKYGVVLYNehgciesfiEKPQEFVSNKInagmyifnpsvldrieikptsiekeifplMSKEKQLYAMELKGfwmdvgqprdFLKGMCLYLNSLRQKRpkllkegdgivgnvlvdptatigpgcrigpnvtigpgvvieggvcikrsTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIigwkcvvgqwvrmenitvlgedvivqdelyvnggqvlphksigsslhmlgedvivqdelyvnggqvlphksigssvpepqiim
MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEHGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELKGFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPtatigpgcrigpnvtigpgVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIGWKCVVGQWVRMENITVLGEDVIVQDELYVNGGQVLPHKSIGSSLHMLGEDVIVQDELYVNGGqvlphksigssvpepqiim
MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEHGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELKGFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPTATIGPGCRIGPNVTIGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIGWKCVVGQWVRMENITVLGEDVIVQDELYVNGGQVLPHKSIGSSLHMLGEDVIVQDELYVNGGQVLPHKSIGSSVPEPQIIM
***HQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEHGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELKGFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPTATIGPGCRIGPNVTIGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIGWKCVVGQWVRMENITVLGEDVIVQDELYVNGGQVLPHKSIGSSLHMLGEDVIVQDELYVNGGQVL****************
MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEHGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELKGFWMDVGQPRDFLKGMCLYLNSLRQ*****LKE*DGIVGNVLVDPTATIGPGCRIGPNVTIGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIGWKCVVGQWVRMENITVLGEDVIVQDELYVNGGQVLPHKSIGSSLHMLGEDVIVQDELYVNGGQVLPHKSIGSSVPEPQIIM
MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEHGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELKGFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPTATIGPGCRIGPNVTIGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIGWKCVVGQWVRMENITVLGEDVIVQDELYVNGGQVLPHKSIGSSLHMLGEDVIVQDELYVNGGQVLPHKSIGSSVPEPQIIM
MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEHGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELKGFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPTATIGPGCRIGPNVTIGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIGWKCVVGQWVRMENITVLGEDVIVQDELYVNGGQVLPHKSIGSSLHMLGEDVIVQDELYVNGGQVLPHKSIGSSVPEPQI**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEHGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELKGFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPTATIGPGCRIGPNVTIGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIGWKCVVGQWVRMENITVLGEDVIVQDELYVNGGQVLPHKSIGSSLHMLGEDVIVQDELYVNGGQVLPHKSIGSSVPEPQIIM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query380 2.2.26 [Sep-21-2011]
Q295Y7371 Mannose-1-phosphate guany yes N/A 0.842 0.862 0.725 1e-146
Q7JZB4369 Mannose-1-phosphate guany yes N/A 0.842 0.867 0.731 1e-146
Q8BTZ7360 Mannose-1-phosphate guany yes N/A 0.842 0.888 0.642 1e-130
Q9Y5P6360 Mannose-1-phosphate guany no N/A 0.842 0.888 0.636 1e-130
P0C5I2360 Mannose-1-phosphate guany yes N/A 0.842 0.888 0.639 1e-130
Q6DBU5360 Mannose-1-phosphate guany yes N/A 0.842 0.888 0.639 1e-129
Q2YDJ9360 Mannose-1-phosphate guany yes N/A 0.842 0.888 0.639 1e-128
Q68EY9360 Mannose-1-phosphate guany N/A N/A 0.842 0.888 0.636 1e-127
Q68EQ1360 Mannose-1-phosphate guany yes N/A 0.842 0.888 0.630 1e-126
A2VD83360 Mannose-1-phosphate guany N/A N/A 0.842 0.888 0.625 1e-125
>sp|Q295Y7|GMPPB_DROPS Mannose-1-phosphate guanyltransferase beta OS=Drosophila pseudoobscura pseudoobscura GN=GA10892 PE=3 SV=1 Back     alignment and function desciption
 Score =  518 bits (1334), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 249/343 (72%), Positives = 289/343 (84%), Gaps = 23/343 (6%)

Query: 1   MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLAL 60
           +LLHQ+EALV+AG R+VILAVSYRAEQME EL VE  KLG+ L+FSHE EPLGTAGPLAL
Sbjct: 45  ILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEADKLGVELIFSHETEPLGTAGPLAL 104

Query: 61  AKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEH 120
           AK IL+ S EPFFVLNSD+ICDFPFK LV FH+NHGKEGTIVVT+VEEPSKYGVVLY+E 
Sbjct: 105 AKSILSASPEPFFVLNSDVICDFPFKQLVQFHRNHGKEGTIVVTKVEEPSKYGVVLYDED 164

Query: 121 GCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELK 180
           GCI++FIEKPQEFVSNKINAG+YIFNPSVL+RIE+KPTSIEKE+FP M+++++LYAM+L 
Sbjct: 165 GCIKNFIEKPQEFVSNKINAGIYIFNPSVLERIEVKPTSIEKEVFPAMAEQQELYAMDLT 224

Query: 181 GFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPTATIGPGCRIGPNVT 240
           GFWMD+GQP+DFL GMCLYL+SLRQK+   L  G G+VGNVLVDPTATIG GCRIGPNVT
Sbjct: 225 GFWMDIGQPKDFLTGMCLYLSSLRQKQSPKLYTGPGVVGNVLVDPTATIGEGCRIGPNVT 284

Query: 241 IGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIGW 300
           IGP V+IE GVCIKR+TIL+ AIV+SHSWL+ CI+GW+  VG+WVR+E            
Sbjct: 285 IGPDVIIEDGVCIKRATILKGAIVRSHSWLDSCIVGWRSTVGRWVRIE------------ 332

Query: 301 KCVVGQWVRMENITVLGEDVIVQDELYVNGGQVLPHKSIGSSL 343
                       ITVLGEDVIV+DELYVNGGQVLPHKSI +S+
Sbjct: 333 -----------GITVLGEDVIVKDELYVNGGQVLPHKSIAASV 364





Drosophila pseudoobscura pseudoobscura (taxid: 46245)
EC: 2EC: .EC: 7EC: .EC: 7EC: .EC: 1EC: 3
>sp|Q7JZB4|GMPPB_DROME Mannose-1-phosphate guanyltransferase beta OS=Drosophila melanogaster GN=CG1129 PE=2 SV=1 Back     alignment and function description
>sp|Q8BTZ7|GMPPB_MOUSE Mannose-1-phosphate guanyltransferase beta OS=Mus musculus GN=Gmppb PE=2 SV=1 Back     alignment and function description
>sp|Q9Y5P6|GMPPB_HUMAN Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens GN=GMPPB PE=1 SV=2 Back     alignment and function description
>sp|P0C5I2|GMPPB_PIG Mannose-1-phosphate guanyltransferase beta OS=Sus scrofa GN=GMPPB PE=1 SV=1 Back     alignment and function description
>sp|Q6DBU5|GMPPB_DANRE Mannose-1-phosphate guanyltransferase beta OS=Danio rerio GN=gmppb PE=2 SV=1 Back     alignment and function description
>sp|Q2YDJ9|GMPPB_BOVIN Mannose-1-phosphate guanyltransferase beta OS=Bos taurus GN=GMPPB PE=2 SV=1 Back     alignment and function description
>sp|Q68EY9|GMPBA_XENLA Mannose-1-phosphate guanyltransferase beta-A OS=Xenopus laevis GN=gmppb-a PE=2 SV=1 Back     alignment and function description
>sp|Q68EQ1|GMPPB_XENTR Mannose-1-phosphate guanyltransferase beta OS=Xenopus tropicalis GN=gmppb PE=2 SV=1 Back     alignment and function description
>sp|A2VD83|GMPBB_XENLA Mannose-1-phosphate guanyltransferase beta-B OS=Xenopus laevis GN=gmppb-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query380
195343509369 GM10777 [Drosophila sechellia] gi|194133 0.842 0.867 0.731 1e-145
195453988371 GK12822 [Drosophila willistoni] gi|19417 0.842 0.862 0.728 1e-145
195497164369 GE25436 [Drosophila yakuba] gi|194182088 0.842 0.867 0.728 1e-144
125776883371 GA10892 [Drosophila pseudoobscura pseudo 0.842 0.862 0.725 1e-144
21355443369 CG1129, isoform A [Drosophila melanogast 0.842 0.867 0.731 1e-144
194746556371 GF18913 [Drosophila ananassae] gi|190628 0.842 0.862 0.720 1e-144
357603531325 hypothetical protein KGM_00281 [Danaus p 0.836 0.978 0.727 1e-144
312374083369 hypothetical protein AND_16491 [Anophele 0.842 0.867 0.735 1e-144
289740937370 GDP-mannose pyrophosphorylase [Glossina 0.842 0.864 0.720 1e-144
194898616369 GG12578 [Drosophila erecta] gi|190650568 0.842 0.867 0.728 1e-143
>gi|195343509|ref|XP_002038340.1| GM10777 [Drosophila sechellia] gi|194133361|gb|EDW54877.1| GM10777 [Drosophila sechellia] Back     alignment and taxonomy information
 Score =  522 bits (1345), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 251/343 (73%), Positives = 289/343 (84%), Gaps = 23/343 (6%)

Query: 1   MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLAL 60
           +LLHQ+EALV+AG R+VILAVSYRAEQME EL VE KKLG+ L+FSHE EPLGTAGPLAL
Sbjct: 43  ILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEAKKLGVELIFSHETEPLGTAGPLAL 102

Query: 61  AKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEH 120
           AK IL  S EPFFVLNSD+ICDFPFK LV FH+NHGKEGTIVVT+VEEPSKYGVVLY+E+
Sbjct: 103 AKTILAASSEPFFVLNSDVICDFPFKQLVQFHRNHGKEGTIVVTKVEEPSKYGVVLYDEN 162

Query: 121 GCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELK 180
           GCI++FIEKPQEFVSNKINAG+YIFNPSVLDRIE+KPTSIEKE+FP M+++++LYAM+L 
Sbjct: 163 GCIKNFIEKPQEFVSNKINAGIYIFNPSVLDRIEVKPTSIEKEVFPAMAQQQELYAMDLT 222

Query: 181 GFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPTATIGPGCRIGPNVT 240
           GFWMD+GQP+DFL GMCLYL+SLRQK+   L  G G+VGNVLVDPTA IG GCRIGPNVT
Sbjct: 223 GFWMDIGQPKDFLTGMCLYLSSLRQKQSPKLYTGPGVVGNVLVDPTAKIGEGCRIGPNVT 282

Query: 241 IGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIGW 300
           IGP VVIE GVCIKRSTIL+ AIV+SHSWL+ CI+GW+  VG+WVR+E            
Sbjct: 283 IGPDVVIEDGVCIKRSTILKGAIVRSHSWLDSCIVGWRSTVGRWVRIE------------ 330

Query: 301 KCVVGQWVRMENITVLGEDVIVQDELYVNGGQVLPHKSIGSSL 343
                       ITVLGEDVIV+DELY+NGGQVLPHKSI +S+
Sbjct: 331 -----------GITVLGEDVIVKDELYINGGQVLPHKSIAASV 362




Source: Drosophila sechellia

Species: Drosophila sechellia

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195453988|ref|XP_002074034.1| GK12822 [Drosophila willistoni] gi|194170119|gb|EDW85020.1| GK12822 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195497164|ref|XP_002095987.1| GE25436 [Drosophila yakuba] gi|194182088|gb|EDW95699.1| GE25436 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|125776883|ref|XP_001359425.1| GA10892 [Drosophila pseudoobscura pseudoobscura] gi|195152692|ref|XP_002017270.1| GL21618 [Drosophila persimilis] gi|121990043|sp|Q295Y7.1|GMPPB_DROPS RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate guanylyltransferase beta gi|54639169|gb|EAL28571.1| GA10892 [Drosophila pseudoobscura pseudoobscura] gi|194112327|gb|EDW34370.1| GL21618 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|21355443|ref|NP_649498.1| CG1129, isoform A [Drosophila melanogaster] gi|24644084|ref|NP_730877.1| CG1129, isoform B [Drosophila melanogaster] gi|122129600|sp|Q7JZB4.1|GMPPB_DROME RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate guanylyltransferase beta gi|7296813|gb|AAF52089.1| CG1129, isoform B [Drosophila melanogaster] gi|10727176|gb|AAG22216.1| CG1129, isoform A [Drosophila melanogaster] gi|16768684|gb|AAL28561.1| HL02883p [Drosophila melanogaster] gi|17945978|gb|AAL49033.1| RE49494p [Drosophila melanogaster] gi|220943166|gb|ACL84126.1| CG1129-PA [synthetic construct] gi|220960314|gb|ACL92693.1| CG1129-PA [synthetic construct] Back     alignment and taxonomy information
>gi|194746556|ref|XP_001955746.1| GF18913 [Drosophila ananassae] gi|190628783|gb|EDV44307.1| GF18913 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|357603531|gb|EHJ63816.1| hypothetical protein KGM_00281 [Danaus plexippus] Back     alignment and taxonomy information
>gi|312374083|gb|EFR21727.1| hypothetical protein AND_16491 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|289740937|gb|ADD19216.1| GDP-mannose pyrophosphorylase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|194898616|ref|XP_001978865.1| GG12578 [Drosophila erecta] gi|190650568|gb|EDV47823.1| GG12578 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query380
UNIPROTKB|Q295Y7371 GA10892 "Mannose-1-phosphate g 0.784 0.803 0.768 5.3e-127
FB|FBgn0037279369 CG1129 [Drosophila melanogaste 0.784 0.807 0.778 5.3e-127
UNIPROTKB|F6X690387 GMPPB "Uncharacterized protein 0.9 0.883 0.644 4.6e-121
MGI|MGI:2660880360 Gmppb "GDP-mannose pyrophospho 0.784 0.827 0.678 1.5e-113
UNIPROTKB|F1SPR4360 GMPPB "Mannose-1-phosphate gua 0.784 0.827 0.678 1.5e-113
UNIPROTKB|E2R2I6360 GMPPB "Uncharacterized protein 0.784 0.827 0.678 1.9e-113
RGD|1560458360 Gmppb "GDP-mannose pyrophospho 0.784 0.827 0.675 1.9e-113
UNIPROTKB|Q9Y5P6360 GMPPB "Mannose-1-phosphate gua 0.784 0.827 0.672 6.6e-113
UNIPROTKB|P0C5I2360 GMPPB "Mannose-1-phosphate gua 0.784 0.827 0.675 1.4e-112
ZFIN|ZDB-GENE-040801-234360 gmppb "GDP-mannose pyrophospho 0.784 0.827 0.678 1.4e-112
UNIPROTKB|Q295Y7 GA10892 "Mannose-1-phosphate guanyltransferase beta" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
 Score = 1247 (444.0 bits), Expect = 5.3e-127, P = 5.3e-127
 Identities = 229/298 (76%), Positives = 267/298 (89%)

Query:     1 MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLAL 60
             +LLHQ+EALV+AG R+VILAVSYRAEQME EL VE  KLG+ L+FSHE EPLGTAGPLAL
Sbjct:    45 ILLHQLEALVDAGCRQVILAVSYRAEQMEKELKVEADKLGVELIFSHETEPLGTAGPLAL 104

Query:    61 AKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEH 120
             AK IL+ S EPFFVLNSD+ICDFPFK LV FH+NHGKEGTIVVT+VEEPSKYGVVLY+E 
Sbjct:   105 AKSILSASPEPFFVLNSDVICDFPFKQLVQFHRNHGKEGTIVVTKVEEPSKYGVVLYDED 164

Query:   121 GCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMELK 180
             GCI++FIEKPQEFVSNKINAG+YIFNPSVL+RIE+KPTSIEKE+FP M+++++LYAM+L 
Sbjct:   165 GCIKNFIEKPQEFVSNKINAGIYIFNPSVLERIEVKPTSIEKEVFPAMAEQQELYAMDLT 224

Query:   181 GFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPTATIGPGCRIGPNVT 240
             GFWMD+GQP+DFL GMCLYL+SLRQK+   L  G G+VGNVLVDPTATIG GCRIGPNVT
Sbjct:   225 GFWMDIGQPKDFLTGMCLYLSSLRQKQSPKLYTGPGVVGNVLVDPTATIGEGCRIGPNVT 284

Query:   241 IGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECII 298
             IGP V+IE GVCIKR+TIL+ AIV+SHSWL+ CI+GW+  VG+WVR+E ITVLGE +I
Sbjct:   285 IGPDVIIEDGVCIKRATILKGAIVRSHSWLDSCIVGWRSTVGRWVRIEGITVLGEDVI 342


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
FB|FBgn0037279 CG1129 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F6X690 GMPPB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2660880 Gmppb "GDP-mannose pyrophosphorylase B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SPR4 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2I6 GMPPB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1560458 Gmppb "GDP-mannose pyrophosphorylase B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y5P6 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P0C5I2 GMPPB "Mannose-1-phosphate guanyltransferase beta" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-234 gmppb "GDP-mannose pyrophosphorylase B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0CO20MPG1_CRYNJ2, ., 7, ., 7, ., 1, 30.52580.84210.8791yesN/A
A3QMC8GMPPB_CAEEL2, ., 7, ., 7, ., 1, 30.57100.85780.8931yesN/A
O74484MPG1_SCHPO2, ., 7, ., 7, ., 1, 30.54800.86310.9035yesN/A
Q4I1Y5MPG1_GIBZE2, ., 7, ., 7, ., 1, 30.56280.84730.8846yesN/A
Q941T9GMPP2_ORYSJ2, ., 7, ., 7, ., 1, 30.55360.84210.8864yesN/A
Q2YDJ9GMPPB_BOVIN2, ., 7, ., 7, ., 1, 30.63950.84210.8888yesN/A
Q68EY9GMPBA_XENLA2, ., 7, ., 7, ., 1, 30.63660.84210.8888N/AN/A
O74624MPG1_HYPJE2, ., 7, ., 7, ., 1, 30.55740.84210.8791N/AN/A
Q7RVR8MPG1_NEUCR2, ., 7, ., 7, ., 1, 30.53710.83680.8736N/AN/A
Q9P8N0MPG1_PICAN2, ., 7, ., 7, ., 1, 30.52900.83150.8681N/AN/A
Q9Y5P6GMPPB_HUMAN2, ., 7, ., 7, ., 1, 30.63660.84210.8888noN/A
Q68EQ1GMPPB_XENTR2, ., 7, ., 7, ., 1, 30.63080.84210.8888yesN/A
Q295Y7GMPPB_DROPS2, ., 7, ., 7, ., 1, 30.72590.84210.8625yesN/A
Q6BN12MPG1_DEBHA2, ., 7, ., 7, ., 1, 30.51150.84210.8839yesN/A
Q6FRY2MPG12_CANGA2, ., 7, ., 7, ., 1, 30.52460.84210.8864noN/A
Q8BTZ7GMPPB_MOUSE2, ., 7, ., 7, ., 1, 30.64240.84210.8888yesN/A
Q61S97GMPPB_CAEBR2, ., 7, ., 7, ., 1, 30.56980.85780.8956N/AN/A
Q7JZB4GMPPB_DROME2, ., 7, ., 7, ., 1, 30.73170.84210.8672yesN/A
Q9M2S0GMPP2_ARATH2, ., 7, ., 7, ., 1, 30.52290.84210.8791noN/A
P0C5I2GMPPB_PIG2, ., 7, ., 7, ., 1, 30.63950.84210.8888yesN/A
Q6DBU5GMPPB_DANRE2, ., 7, ., 7, ., 1, 30.63950.84210.8888yesN/A
Q70SJ2MPG1_KLULA2, ., 7, ., 7, ., 1, 30.53660.83150.8753yesN/A
Q54K39GMPPB_DICDI2, ., 7, ., 7, ., 1, 30.60170.83940.8885yesN/A
Q6Z9A3GMPP3_ORYSJ2, ., 7, ., 7, ., 1, 30.55940.84210.8864yesN/A
Q9Y725MPG11_CANGA2, ., 7, ., 7, ., 1, 30.52750.84210.8864yesN/A
Q6CCU3MPG1_YARLI2, ., 7, ., 7, ., 1, 30.50860.84470.8842yesN/A
O93827MPG1_CANAL2, ., 7, ., 7, ., 1, 30.54040.84210.8839N/AN/A
P0CO21MPG1_CRYNB2, ., 7, ., 7, ., 1, 30.52580.84210.8791N/AN/A
Q4U3E8MPG1_ASPFU2, ., 7, ., 7, ., 1, 30.52870.84210.8791noN/A
P41940MPG1_YEAST2, ., 7, ., 7, ., 1, 30.54200.84210.8864yesN/A
O22287GMPP1_ARATH2, ., 7, ., 7, ., 1, 30.54490.84210.8864yesN/A
Q84JH5GMPP1_ORYSJ2, ., 7, ., 7, ., 1, 30.55070.84210.8864noN/A
Q5B1J4MPG1_EMENI2, ., 7, ., 7, ., 1, 30.52870.84210.8791yesN/A
Q2UJU5MPG1_ASPOR2, ., 7, ., 7, ., 1, 30.53480.83150.8681yesN/A
Q752H4MPG1_ASHGO2, ., 7, ., 7, ., 1, 30.52170.84210.8864yesN/A
P37820MPG1_SULAC2, ., 7, ., 7, ., 1, 30.28280.84470.8941yesN/A
A2VD83GMPBB_XENLA2, ., 7, ., 7, ., 1, 30.6250.84210.8888N/AN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.70.976
3rd Layer2.7.7.130.991

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query380
cd06425233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain 1e-132
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyroph 8e-78
cd04181217 cd04181, NTP_transferase, NTP_transferases catalyz 2e-59
TIGR03992393 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diph 2e-44
pfam00483247 pfam00483, NTP_transferase, Nucleotidyl transferas 9e-43
cd06915223 cd06915, NTP_transferase_WcbM_like, WcbM_like is a 1e-41
cd06426220 cd06426, NTP_transferase_like_2, NTP_trnasferase_l 5e-40
cd06428257 cd06428, M1P_guanylylT_A_like_N, N-terminal domain 1e-36
cd06422221 cd06422, NTP_transferase_like_1, NTP_transferase_l 5e-32
COG1209286 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cel 7e-30
TIGR01208353 TIGR01208, rmlA_long, glucose-1-phosphate thymidyl 2e-29
cd04189236 cd04189, G1P_TT_long, G1P_TT_long represents the l 1e-28
cd0582480 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate 2e-27
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphospho 1e-24
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uri 3e-23
COG0448393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb 4e-22
cd02524253 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltr 2e-21
TIGR02091361 TIGR02091, glgC, glucose-1-phosphate adenylyltrans 8e-20
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransf 5e-19
TIGR02623254 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cyti 2e-16
PRK14358481 PRK14358, glmU, bifunctional N-acetylglucosamine-1 5e-16
cd02541267 cd02541, UGPase_prokaryotic, Prokaryotic UGPase ca 2e-15
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1 2e-15
cd02540229 cd02540, GT2_GlmU_N_bac, N-terminal domain of bact 3e-15
PRK14360450 PRK14360, glmU, bifunctional N-acetylglucosamine-1 1e-14
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 1e-13
PRK14355459 PRK14355, glmU, bifunctional N-acetylglucosamine-1 2e-13
cd02538240 cd02538, G1P_TT_short, G1P_TT_short is the short f 3e-13
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel b 8e-13
PRK14356456 PRK14356, glmU, bifunctional N-acetylglucosamine-1 1e-12
cd02523229 cd02523, PC_cytidylyltransferase, Phosphocholine c 4e-12
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph 5e-12
COG1210291 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell 3e-11
PRK00892343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco 4e-11
TIGR01099260 TIGR01099, galU, UTP-glucose-1-phosphate uridylylt 9e-10
PRK15480292 PRK15480, PRK15480, glucose-1-phosphate thymidylyl 2e-09
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 2e-09
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyl 3e-09
PRK14353446 PRK14353, glmU, bifunctional N-acetylglucosamine-1 1e-08
cd02508200 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphory 2e-08
PLN02241436 PLN02241, PLN02241, glucose-1-phosphate adenylyltr 1e-07
PRK00844407 PRK00844, glgC, glucose-1-phosphate adenylyltransf 2e-07
PRK02862429 PRK02862, glgC, glucose-1-phosphate adenylyltransf 2e-07
TIGR02092369 TIGR02092, glgD, glucose-1-phosphate adenylyltrans 3e-07
PRK14357448 PRK14357, glmU, bifunctional N-acetylglucosamine-1 7e-07
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1 1e-06
PRK12461255 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr 1e-06
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase 1e-06
cd02507216 cd02507, eIF-2B_gamma_N_like, The N-terminal of eI 1e-06
TIGR03570193 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia 4e-06
PRK05289 262 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltr 4e-06
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho 5e-06
TIGR01207286 TIGR01207, rmlA, glucose-1-phosphate thymidylyltra 8e-06
cd03351254 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamin 1e-05
COG1043 260 COG1043, LpxA, Acyl-[acyl carrier protein] 1e-05
cd0335679 cd03356, LbH_G1P_AT_C_like, Left-handed parallel b 2e-05
pfam0013236 pfam00132, Hexapep, Bacterial transferase hexapept 2e-05
PRK00892343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] gluco 5e-05
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase 5e-05
TIGR01852 254 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protei 5e-05
cd04183231 cd04183, GT2_BcE_like, GT2_BcbE_like is likely inv 5e-05
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho 7e-05
cd04745155 cd04745, LbH_paaY_like, paaY-like: This group is c 8e-05
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix ( 9e-05
cd04198214 cd04198, eIF-2B_gamma_N, The N-terminal domain of 1e-04
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransfera 2e-04
PRK12461255 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltr 3e-04
cd0578779 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit 3e-04
PRK14359430 PRK14359, glmU, bifunctional N-acetylglucosamine-1 4e-04
pfam0013236 pfam00132, Hexapep, Bacterial transferase hexapept 5e-04
PRK09451456 PRK09451, glmU, bifunctional N-acetylglucosamine-1 7e-04
cd00710167 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases ( 9e-04
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-pho 0.001
cd0465281 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, 0.001
COG0110190 COG0110, WbbJ, Acetyltransferase (isoleucine patch 0.002
PRK10122297 PRK10122, PRK10122, GalU regulator GalF; Provision 0.002
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra 0.002
PRK00725425 PRK00725, glgC, glucose-1-phosphate adenylyltransf 0.002
cd04651104 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenyly 0.002
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra 0.003
cd05825107 cd05825, LbH_wcaF_like, wcaF-like: This group is c 0.003
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristo 0.004
>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
 Score =  376 bits (968), Expect = e-132
 Identities = 138/201 (68%), Positives = 163/201 (81%), Gaps = 1/201 (0%)

Query: 1   MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLAL 60
           M+ HQIEAL +AGV+E+ILAV+YR E M   L    KKLGI + FS E EPLGTAGPLAL
Sbjct: 33  MIEHQIEALAKAGVKEIILAVNYRPEDMVPFLKEYEKKLGIKITFSIETEPLGTAGPLAL 92

Query: 61  AKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNE- 119
           A+D+L    EPFFVLNSD+ICDFP  +L+ FHK HG EGTI+VT+VE+PSKYGVV+++E 
Sbjct: 93  ARDLLGDDDEPFFVLNSDVICDFPLAELLDFHKKHGAEGTILVTKVEDPSKYGVVVHDEN 152

Query: 120 HGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMEL 179
            G IE F+EKP+ FV NKINAG+YI NPSVLDRI ++PTSIEKEIFP M+ E QLYA EL
Sbjct: 153 TGRIERFVEKPKVFVGNKINAGIYILNPSVLDRIPLRPTSIEKEIFPKMASEGQLYAYEL 212

Query: 180 KGFWMDVGQPRDFLKGMCLYL 200
            GFWMD+GQP+DFLKGM LYL
Sbjct: 213 PGFWMDIGQPKDFLKGMSLYL 233


GDP-mannose pyrophosphorylase (GTP: alpha-d-mannose-1-phosphate guanyltransferase) catalyzes the formation of GDP-d-mannose from GTP and alpha-d-mannose-1-Phosphate. It contains an N-terminal catalytic domain and a C-terminal Lefthanded-beta-Helix fold domain. GDP-d-mannose is the activated form of mannose for formation of cell wall lipoarabinomannan and various mannose-containing glycolipids and polysaccharides. The function of GDP-mannose pyrophosphorylase is essential for cell wall integrity, morphogenesis and viability. Repression of GDP-mannose pyrophosphorylase in yeast leads to phenotypes, such as cell lysis, defective cell wall, and failure of polarized growth and cell separation. Length = 233

>gnl|CDD|224129 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>gnl|CDD|234433 TIGR03992, Arch_glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|215940 pfam00483, NTP_transferase, Nucleotidyl transferase Back     alignment and domain information
>gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|224130 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233311 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|100062 cd05824, LbH_M1P_guanylylT_C, Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|233299 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|224128 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>gnl|CDD|233720 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|237688 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU Back     alignment and domain information
>gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|223974 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|237685 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|237686 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|224131 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233272 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>gnl|CDD|215133 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|234846 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233721 TIGR02092, glgD, glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>gnl|CDD|237687 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|235390 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>gnl|CDD|223973 COG1043, LpxA, Acyl-[acyl carrier protein] Back     alignment and domain information
>gnl|CDD|100046 cd03356, LbH_G1P_AT_C_like, Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) Back     alignment and domain information
>gnl|CDD|234858 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|188173 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>gnl|CDD|133026 cd04183, GT2_BcE_like, GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100061 cd05787, LbH_eIF2B_epsilon, eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|237689 PRK14359, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|189409 pfam00132, Hexapep, Bacterial transferase hexapeptide (six repeats) Back     alignment and domain information
>gnl|CDD|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|100057 cd04652, LbH_eIF2B_gamma_C, eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>gnl|CDD|223188 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|182252 PRK10122, PRK10122, GalU regulator GalF; Provisional Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|234824 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100056 cd04651, LbH_G1P_AT_C, Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|100063 cd05825, LbH_wcaF_like, wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>gnl|CDD|233599 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 380
KOG1322|consensus371 100.0
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 100.0
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 100.0
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
KOG1460|consensus407 100.0
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 100.0
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PLN02241436 glucose-1-phosphate adenylyltransferase 100.0
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 100.0
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 100.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 100.0
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 100.0
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 100.0
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 100.0
KOG1461|consensus 673 100.0
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 100.0
KOG1462|consensus433 100.0
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 99.97
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 99.97
TIGR01105297 galF UTP-glucose-1-phosphate uridylyltransferase, 99.96
PRK10122297 GalU regulator GalF; Provisional 99.95
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 99.95
TIGR02623254 G1P_cyt_trans glucose-1-phosphate cytidylyltransfe 99.95
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase, sh 99.95
PRK15480292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 99.95
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 99.95
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subun 99.94
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 99.94
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 99.93
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 99.93
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase 99.93
cd04181217 NTP_transferase NTP_transferases catalyze the tran 99.93
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 99.93
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 99.92
PRK12461255 UDP-N-acetylglucosamine acyltransferase; Provision 99.91
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.91
TIGR01099260 galU UTP-glucose-1-phosphate uridylyltransferase. 99.91
PRK05289262 UDP-N-acetylglucosamine acyltransferase; Provision 99.91
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.91
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.91
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.89
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.88
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.87
COG1043260 LpxA Acyl-[acyl carrier protein] 99.87
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope 99.87
cd04197217 eIF-2B_epsilon_N The N-terminal domain of epsilon 99.86
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.85
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.84
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.83
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.83
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltr 99.82
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.81
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.81
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 99.8
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in t 99.8
PRK12461255 UDP-N-acetylglucosamine acyltransferase; Provision 99.78
PRK05289262 UDP-N-acetylglucosamine acyltransferase; Provision 99.76
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 99.76
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.76
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.76
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 99.75
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.75
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.75
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.74
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.74
cd02507216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma 99.74
COG1043260 LpxA Acyl-[acyl carrier protein] 99.74
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.72
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.72
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.72
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.72
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.71
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 99.7
PLN02296269 carbonate dehydratase 99.69
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.68
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.68
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.68
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.67
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.67
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.67
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 99.66
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.66
PRK13627196 carnitine operon protein CaiE; Provisional 99.66
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 99.66
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 99.65
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 99.65
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 99.65
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.64
PLN02472246 uncharacterized protein 99.64
PRK13627196 carnitine operon protein CaiE; Provisional 99.63
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 99.62
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 99.61
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.61
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.6
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.6
PLN02296269 carbonate dehydratase 99.6
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 99.59
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 99.57
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 99.56
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.55
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.55
PRK10502182 putative acyl transferase; Provisional 99.55
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.54
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 99.54
PRK10092183 maltose O-acetyltransferase; Provisional 99.53
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 99.53
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.52
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 99.51
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.51
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 99.51
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.51
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.51
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.5
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.5
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.5
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.49
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.49
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.49
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.47
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.47
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.46
KOG1461|consensus 673 99.46
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 99.45
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 99.45
PLN02472246 uncharacterized protein 99.45
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.43
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.42
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.42
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.42
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.42
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.41
PRK11132273 cysE serine acetyltransferase; Provisional 99.41
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.4
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.4
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.38
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 99.37
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 99.36
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.36
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 99.36
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.35
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.35
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 99.33
PLN02694294 serine O-acetyltransferase 99.33
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 99.31
PRK10191146 putative acyl transferase; Provisional 99.29
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.29
PLN02739355 serine acetyltransferase 99.28
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.28
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 99.27
KOG4750|consensus269 99.27
KOG1462|consensus433 99.27
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.25
PLN02917293 CMP-KDO synthetase 99.25
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.25
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 99.24
PRK10502182 putative acyl transferase; Provisional 99.23
PRK11132273 cysE serine acetyltransferase; Provisional 99.23
PLN02357360 serine acetyltransferase 99.22
PLN02694294 serine O-acetyltransferase 99.21
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 99.2
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 99.19
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 99.19
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 99.19
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 99.18
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 99.17
PRK10191146 putative acyl transferase; Provisional 99.16
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 99.16
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 99.16
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 99.14
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 99.12
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 99.12
PLN02241436 glucose-1-phosphate adenylyltransferase 99.11
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 99.11
PLN02357360 serine acetyltransferase 99.09
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 99.07
PLN02739355 serine acetyltransferase 99.06
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 99.05
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 99.04
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.03
PRK10092183 maltose O-acetyltransferase; Provisional 99.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 99.0
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.98
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 98.95
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 98.91
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 98.9
COG0836333 {ManC} Mannose-1-phosphate guanylyltransferase [Ce 98.86
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 98.86
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.85
KOG3121|consensus184 98.82
KOG4042|consensus190 98.78
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 98.77
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 98.74
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 98.74
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 98.73
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 98.73
COG4750231 LicC CTP:phosphocholine cytidylyltransferase invol 98.73
KOG3121|consensus184 98.72
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 98.63
COG4801 277 Predicted acyltransferase [General function predic 98.59
KOG4750|consensus269 98.57
KOG1460|consensus407 98.57
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 98.5
TIGR02353695 NRPS_term_dom non-ribosomal peptide synthetase ter 98.48
TIGR02353 695 NRPS_term_dom non-ribosomal peptide synthetase ter 98.46
KOG1322|consensus371 98.3
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 98.27
KOG4042|consensus190 98.27
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 98.25
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 98.24
COG4801 277 Predicted acyltransferase [General function predic 98.17
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase 98.16
TIGR00454183 conserved hypothetical protein TIGR00454. At this 98.11
PRK00155227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 98.05
PRK09382378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 98.04
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 98.02
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 98.0
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 97.87
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.85
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 97.8
COG2266177 GTP:adenosylcobinamide-phosphate guanylyltransfera 97.79
COG2068199 Uncharacterized MobA-related protein [General func 97.73
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 97.42
PRK13412 974 fkp bifunctional fucokinase/L-fucose-1-P-guanylylt 97.35
cd04180266 UGPase_euk_like Eukaryotic UGPase-like includes UD 97.19
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 97.12
cd02503181 MobA MobA catalyzes the formation of molybdopterin 97.1
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 96.98
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 96.88
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 96.85
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 96.32
COG1083228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell 96.26
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase 96.18
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 96.17
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 96.03
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 95.69
PRK00560196 molybdopterin-guanine dinucleotide biosynthesis pr 95.21
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 94.78
PLN02728252 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 93.93
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 93.4
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthes 92.26
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis pr 91.78
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 90.91
cd06423180 CESA_like CESA_like is the cellulose synthase supe 90.6
cd04188211 DPG_synthase DPG_synthase is involved in protein N 89.73
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 88.94
PF02348217 CTP_transf_3: Cytidylyltransferase; InterPro: IPR0 88.15
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 88.06
cd04193323 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catala 86.98
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 85.17
COG1920210 Predicted nucleotidyltransferase, CobY/MobA/RfbA f 84.29
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 84.16
cd06442224 DPM1_like DPM1_like represents putative enzymes si 84.14
PRK14500346 putative bifunctional molybdopterin-guanine dinucl 82.59
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 82.22
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 81.37
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the bios 81.12
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulo 81.11
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-ant 81.1
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot 80.27
>KOG1322|consensus Back     alignment and domain information
Probab=100.00  E-value=1.4e-55  Score=374.26  Aligned_cols=287  Identities=56%  Similarity=0.985  Sum_probs=265.8

Q ss_pred             CHHHHHHHHHHcCCCEEEEEccCChHHHHHHH-ccccccCCcEEEEeecCCCCCCchHHHHhHHhhCCCCC-cEEEEeCC
Q psy9164           1 MLLHQIEALVEAGVREVILAVSYRAEQMEDEL-TVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQE-PFFVLNSD   78 (380)
Q Consensus         1 li~~~l~~l~~~gi~~i~vv~~~~~~~i~~~l-~~~~~~~~~~i~~~~~~~~~gt~~al~~a~~~i~~~~~-~~lv~~gD   78 (380)
                      ||.|++++|.++|+++|++.++|.++++..++ +.+...+++++.++.|.+++||++.+..+++++-...+ +|+|++||
T Consensus        42 mI~hqieal~nsGi~~I~la~~y~s~sl~~~~~k~y~~~lgVei~~s~eteplgtaGpl~laR~~L~~~~~~~ffVLnsD  121 (371)
T KOG1322|consen   42 MILHQIEALINSGITKIVLATQYNSESLNRHLSKAYGKELGVEILASTETEPLGTAGPLALARDFLWVFEDAPFFVLNSD  121 (371)
T ss_pred             hhHHHHHHHHhCCCcEEEEEEecCcHHHHHHHHHHhhhccceEEEEEeccCCCcccchHHHHHHHhhhcCCCcEEEecCC
Confidence            79999999999999999999999988554444 44567789999999999999999999999999854333 79999999


Q ss_pred             cccCCChHHHHHHHHhcCCcEEEEEEEcCCCCceeEEEECC-CCceeEEEeCCCCCCCCeEEEEEEEeCHhHHhhccCCC
Q psy9164          79 IICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNE-HGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKP  157 (380)
Q Consensus        79 ~i~~~~l~~~l~~h~~~~~~~tl~~~~~~~~~~~g~v~~d~-~~~v~~~~ek~~~~~~~~~~~giyi~~~~~l~~l~~~~  157 (380)
                      +++++|+++|+++|++++++.|++.+++++|++||++..|+ +++|.+|.|||.++.++-+++|+|+|+|++++++...+
T Consensus       122 vi~~~p~~~~vqfH~~~gae~TI~~t~vdepSkyGvv~~d~~~grV~~F~EKPkd~vsnkinaGiYi~~~~vL~ri~~~p  201 (371)
T KOG1322|consen  122 VICRMPYKEMVQFHRAHGAEITIVVTKVDEPSKYGVVVIDEDTGRVIRFVEKPKDLVSNKINAGIYILNPEVLDRILLRP  201 (371)
T ss_pred             eeecCCHHHHHHHHHhcCCceEEEEEeccCccccceEEEecCCCceeEehhCchhhhhccccceEEEECHHHHhHhhhcc
Confidence            99999999999999999999999999999999999999997 89999999999999999999999999999999998888


Q ss_pred             CCcccchhhhhhcCCcEEEEEeccEEEecCChhhHHHHHHHHHhhhcccCcccccCCCccccceeeCCCCEECCCcEECC
Q psy9164         158 TSIEKEIFPLMSKEKQLYAMELKGFWMDVGQPRDFLKGMCLYLNSLRQKRPKLLKEGDGIVGNVLVDPTATIGPGCRIGP  237 (380)
Q Consensus       158 ~~~~~~il~~l~~~~~i~~~~~~~~~~~i~~~~~~~~a~~~~l~~~~~~~~~~~~~~~~i~~~~~i~~~~~i~~~~~i~~  237 (380)
                      .+++.+++|.+++..+++++.++|||.|+|+|.+|+.+...+++..+...+.++.+++.+.+++.+++.+.+|++|.|++
T Consensus       202 tSiekEifP~~a~~~~l~a~~l~gfWmDIGqpkdf~~g~~~Yl~s~~~~t~~r~~p~~~i~~nvlvd~~~~iG~~C~Ig~  281 (371)
T KOG1322|consen  202 TSIEKEIFPAMAEEHQLYAFDLPGFWMDIGQPKDFLTGFSFYLRSLPKYTSPRLLPGSKIVGNVLVDSIASIGENCSIGP  281 (371)
T ss_pred             cchhhhhhhhhhhcCceEEEecCchhhhcCCHHHHHHHHHHHHhhCcccCCccccCCccccccEeeccccccCCccEECC
Confidence            89999999999999999999999999999999999999999999998887778888899999999999999999999999


Q ss_pred             CcEECCCCEEcCCcEEeceEEccCCEECCCcEecCeEEcCCCEECCceEE
Q psy9164         238 NVTIGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRM  287 (380)
Q Consensus       238 ~~~ig~~~~i~~~~~i~~~~i~~~~~i~~~~~i~~~~ig~~~~ig~~~~i  287 (380)
                      +++||++|+|++++.+.+|.+..+..++.++.+..+++|.++.||.+++|
T Consensus       282 ~vvIG~r~~i~~gV~l~~s~il~~~~~~~~s~i~s~ivg~~~~IG~~~~i  331 (371)
T KOG1322|consen  282 NVVIGPRVRIEDGVRLQDSTILGADYYETHSEISSSIVGWNVPIGIWARI  331 (371)
T ss_pred             CceECCCcEecCceEEEeeEEEccceechhHHHHhhhccccccccCceEE
Confidence            99999999999999999999999999998888888888888888777655



>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>KOG1460|consensus Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>KOG1461|consensus Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1462|consensus Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>PRK10122 GalU regulator GalF; Provisional Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>KOG1461|consensus Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4750|consensus Back     alignment and domain information
>KOG1462|consensus Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>KOG3121|consensus Back     alignment and domain information
>KOG4042|consensus Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3121|consensus Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>KOG4750|consensus Back     alignment and domain information
>KOG1460|consensus Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>KOG1322|consensus Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>KOG4042|consensus Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00454 conserved hypothetical protein TIGR00454 Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional Back     alignment and domain information
>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>PF02348 CTP_transf_3: Cytidylyltransferase; InterPro: IPR003329 Synonym(s): CMP-N-acetylneuraminic acid synthetase Acylneuraminate cytidylyltransferase (2 Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>COG1920 Predicted nucleotidyltransferase, CobY/MobA/RfbA family [General function prediction only] Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>PRK14500 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MoaC/MobA; Provisional Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query380
2ggo_A401 Crystal Structure Of Glucose-1-Phosphate Thymidylyl 4e-15
1tzf_A259 X-Ray Crystal Structure Of Alpha-D-Glucose-1-Phosph 2e-14
1lvw_A295 Crystal Structure Of Glucose-1-phosphate Thymidylyl 4e-10
1mp3_A292 L89t Variant Of S. Enterica Rmla Length = 292 2e-09
1iim_A292 Thymidylyltransferase Complexed With Ttp Length = 2 1e-08
4aaw_A459 S.Pneumoniae Glmu In Complex With An Antibacterial 1e-08
3pkq_A292 Q83d Variant Of S. Enterica Rmla With Dgtp Length = 1e-08
1hm9_A468 Crystal Structure Of S.Pneumoniae N-Acetylglucosami 2e-08
3pkp_A292 Q83s Variant Of S. Enterica Rmla With Datp Length = 2e-08
1g95_A459 Crystal Structure Of S.Pneumoniae Glmu, Apo Form Le 3e-08
1mp5_A292 Y177f Variant Of S. Enterica Rmla Length = 292 4e-08
1h5t_A293 Thymidylyltransferase Complexed With Thymidylyldiph 7e-08
1h5s_D293 Thymidylyltransferase Complexed With Tmp Length = 2 1e-07
4b2x_A303 Pseudomonas Aeruginosa Rmla In Complex With Alloste 1e-07
1h5s_A293 Thymidylyltransferase Complexed With Tmp Length = 2 1e-07
4arw_A302 Pseudomonas Aeruginosa Rmla In Complex With Alloste 1e-07
1fxo_A293 The Structural Basis Of The Catalytic Mechanism And 1e-07
1mp4_A292 W224h Variant Of S. Enterica Rmla Length = 292 2e-07
1h5r_B293 Thymidylyltransferase Complexed With Thimidine And 2e-07
3foq_A503 Crystal Structure Of N-Acetylglucosamine-1-Phosphat 4e-07
3spt_A501 Crystal Structure Of Glmu From Mycobacterium Tuberc 4e-07
3d8v_A495 Crystal Structure Of Glmu From Mycobacterium Tuberc 4e-07
1mc3_A296 Crystal Structure Of Rffh Length = 296 6e-07
1g23_A293 The Structural Basis Of The Catalytic Mechanism And 9e-07
3hl3_A269 2.76 Angstrom Crystal Structure Of A Putative Gluco 1e-06
2qkx_A391 N-Acetyl Glucosamine 1-Phosphate Uridyltransferase 3e-06
>pdb|2GGO|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase From Sulfolobus Tokodaii Length = 401 Back     alignment and structure

Iteration: 1

Score = 79.0 bits (193), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 80/314 (25%), Positives = 143/314 (45%), Gaps = 47/314 (14%) Query: 1 MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLAL 60 ++ +QIE L + G+R++ + VS + ++ E K IS+V + +++ GT + Sbjct: 33 LIEYQIEYLRKCGIRDITVIVSSKNKEY-----FEKKLKEISIV-TQKDDIKGTGAAILS 86 Query: 61 AKDILNKSQ----EPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVL 116 AK N F N IC+ +++ KE I+ +V P YGV++ Sbjct: 87 AK--FNDEALIIYGDLFFSNEKEICN-----IITL-----KENAIIGVKVSNPKDYGVLV 134 Query: 117 YNEHGCIESFIEKPQEFVSNKINAGMYIFNPSV---LDRIEIKPTSIEKEI---FPLMSK 170 + + IEKP+ SN INAG+Y N + LD+I I E E+ LM+K Sbjct: 135 LDNQNNLSKIIEKPEIPPSNLINAGIYKLNSDIFTYLDKISISERG-ELELTDAINLMAK 193 Query: 171 EKQLYAMELKGFWMDVGQPRD-------------FLKGMCLYLNSLRQKRPKLLKEGDGI 217 + ++ +E +G+WMD+G+P + F + + ++++ K +++E I Sbjct: 194 DHRVKVIEYEGYWMDIGKPWNIIDVNKWALDNLVFSQNLGNVEDNVKIKGKVIIEEDAEI 253 Query: 218 VGNVLVDPTATIGPGCRIGPNVTIGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGW 277 ++ IG G IGPN + P ++ ++++ I VK +EG I Sbjct: 254 KSGTYIEGPVYIGKGSEIGPNSYLRPYTIL-----VEKNKIGASVEVKESVIMEGSKIPH 308 Query: 278 KCVVGQWVRMENIT 291 VG V E++ Sbjct: 309 LSYVGDSVIAEDVN 322
>pdb|1TZF|A Chain A, X-Ray Crystal Structure Of Alpha-D-Glucose-1-Phosphate Cytidylyltransferase From Salmonella Typhi Length = 259 Back     alignment and structure
>pdb|1LVW|A Chain A, Crystal Structure Of Glucose-1-phosphate Thymidylyltransferase, Rmla, Complex With Dtdp Length = 295 Back     alignment and structure
>pdb|1MP3|A Chain A, L89t Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1IIM|A Chain A, Thymidylyltransferase Complexed With Ttp Length = 292 Back     alignment and structure
>pdb|4AAW|A Chain A, S.Pneumoniae Glmu In Complex With An Antibacterial Inhibitor Length = 459 Back     alignment and structure
>pdb|3PKQ|A Chain A, Q83d Variant Of S. Enterica Rmla With Dgtp Length = 292 Back     alignment and structure
>pdb|1HM9|A Chain A, Crystal Structure Of S.Pneumoniae N-Acetylglucosamine-1-Phosphate Uridyltransferase, Glmu, Bound To Acetyl Coenzyme A And Udp-N- Acetylglucosamine Length = 468 Back     alignment and structure
>pdb|3PKP|A Chain A, Q83s Variant Of S. Enterica Rmla With Datp Length = 292 Back     alignment and structure
>pdb|1G95|A Chain A, Crystal Structure Of S.Pneumoniae Glmu, Apo Form Length = 459 Back     alignment and structure
>pdb|1MP5|A Chain A, Y177f Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1H5T|A Chain A, Thymidylyltransferase Complexed With Thymidylyldiphosphate- Glucose Length = 293 Back     alignment and structure
>pdb|1H5S|D Chain D, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>pdb|4B2X|A Chain A, Pseudomonas Aeruginosa Rmla In Complex With Allosteric Inhibitor Length = 303 Back     alignment and structure
>pdb|1H5S|A Chain A, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>pdb|4ARW|A Chain A, Pseudomonas Aeruginosa Rmla In Complex With Allosteric Inhibitor Length = 302 Back     alignment and structure
>pdb|1FXO|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. Length = 293 Back     alignment and structure
>pdb|1MP4|A Chain A, W224h Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>pdb|1H5R|B Chain B, Thymidylyltransferase Complexed With Thimidine And Glucose- 1-Phospate Length = 293 Back     alignment and structure
>pdb|3FOQ|A Chain A, Crystal Structure Of N-Acetylglucosamine-1-Phosphate Uridyltransferase (Glmu) From Mycobacterium Tuberculosis In A Cubic Space Group Length = 503 Back     alignment and structure
>pdb|3SPT|A Chain A, Crystal Structure Of Glmu From Mycobacterium Tuberculosis In Complex With Acetyl Coenzyme A And Uridine-Diphosphate-N-Acetylglucosamine Length = 501 Back     alignment and structure
>pdb|3D8V|A Chain A, Crystal Structure Of Glmu From Mycobacterium Tuberculosis In Complex With Uridine-Diphosphate-N-Acetylglucosamine Length = 495 Back     alignment and structure
>pdb|1MC3|A Chain A, Crystal Structure Of Rffh Length = 296 Back     alignment and structure
>pdb|1G23|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Glucose-1-Phosphate Complex. Length = 293 Back     alignment and structure
>pdb|3HL3|A Chain A, 2.76 Angstrom Crystal Structure Of A Putative Glucose-1-Phosphate Thymidylyltransferase From Bacillus Anthracis In Complex With A Sucrose. Length = 269 Back     alignment and structure
>pdb|2QKX|A Chain A, N-Acetyl Glucosamine 1-Phosphate Uridyltransferase From Mycobacterium Tuberculosis Complex With N-Acetyl Glucosamine 1-Phosphate Length = 391 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query380
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 1e-47
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 9e-47
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 1e-46
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 5e-32
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 3e-25
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 1e-23
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 2e-23
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 3e-20
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 6e-20
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 2e-19
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 3e-16
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 3e-13
3fs8_A 273 QDTC; acetyltransferase, natural product, deoxysug 1e-04
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 2e-10
3pmo_A 372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 7e-10
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 2e-10
2iu8_A 374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 1e-09
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 6e-10
3eh0_A 341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 2e-09
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 2e-08
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 3e-08
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 9e-08
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 6e-07
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 1e-07
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 2e-07
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 8e-07
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 1e-05
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 3e-07
3pnn_A303 Conserved domain protein; structural genomics, PSI 4e-07
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 6e-07
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 3e-06
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 2e-04
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 6e-04
4eqy_A 283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 2e-06
2qia_A 262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 3e-06
3hsq_A 259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 3e-06
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 9e-05
3r0s_A 266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 4e-06
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 9e-05
1j2z_A 270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 4e-06
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 1e-04
3t57_A 305 UDP-N-acetylglucosamine O-acyltransferase domain- 6e-06
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 4e-05
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 1e-04
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 4e-04
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 4e-04
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 9e-04
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Length = 232 Back     alignment and structure
 Score =  160 bits (408), Expect = 1e-47
 Identities = 31/195 (15%), Positives = 69/195 (35%), Gaps = 15/195 (7%)

Query: 1   MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLAL 60
           ++L  ++ L    V E I+  S  A+ ++  L  + K     +V     E  G    L +
Sbjct: 47  IILRTMKLL-SPHVSEFIIVASRYADDIDAFL--KDKGFNYKIVRHDRPE-KGNGYSLLV 102

Query: 61  AKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEH 120
           AK+ +    + F +   D +        +               +  +  +   +   + 
Sbjct: 103 AKNHVE---DRFILTMGDHVYSQ---QFIEKAVRGEGVIADREPRFVDIGEATKIRVED- 155

Query: 121 GCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPTSIEKEIFPLMSKEKQLYAMEL- 179
           G +    +  +E   + ++ G ++ + S+ +  E K    E+     + K  +L    + 
Sbjct: 156 GRVAKIGKDLRE--FDCVDTGFFVLDDSIFEHAE-KLRDREEIPLSEIVKLARLPVTYVD 212

Query: 180 KGFWMDVGQPRDFLK 194
              WMDV    D  +
Sbjct: 213 GELWMDVDTKEDVRR 227


>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Length = 254 Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Length = 401 Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Length = 259 Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Length = 196 Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Length = 468 Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Length = 501 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Length = 459 Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Length = 456 Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Length = 420 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Length = 451 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Length = 372 Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Length = 374 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Length = 341 Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Length = 255 Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Length = 302 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Length = 281 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Length = 297 Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Length = 303 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Length = 283 Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Length = 262 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} PDB: 3i3a_A* 3i3x_A* Length = 259 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} Length = 266 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Length = 270 Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Length = 305 Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 323 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Length = 197 Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Length = 308 Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query380
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 100.0
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 100.0
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 100.0
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 100.0
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 100.0
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 100.0
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 100.0
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.97
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 99.94
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 99.93
3pnn_A303 Conserved domain protein; structural genomics, PSI 99.92
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.92
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.92
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.92
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.92
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.91
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.91
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 99.91
3t57_A305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.91
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.9
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 99.9
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleoti 99.9
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnos 99.89
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.89
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose 99.89
4e79_A357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.89
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein 99.89
4e79_A357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.88
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.88
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.88
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 99.88
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosp 99.86
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.86
4evw_A255 Nucleoside-diphosphate-sugar pyrophosphorylase; st 99.84
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.84
3t57_A305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.82
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.81
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.81
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.81
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.8
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.8
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structur 99.8
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 99.8
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.8
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.8
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.8
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.78
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.78
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.78
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.78
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.78
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.77
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.77
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.76
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.74
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.74
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.73
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 99.73
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 99.73
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.73
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural 99.73
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.73
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.72
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.71
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.71
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.7
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.7
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.69
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.69
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 99.69
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.69
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 99.69
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.68
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.68
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.68
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.67
2x65_A336 Mannose-1-phosphate guanylyltransferase; nucleotid 99.67
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.67
2pig_A 334 Putative transferase; SCR6, NESG, YDCK, structural 99.66
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.66
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.66
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.64
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.64
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.63
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 99.63
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 99.63
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 99.63
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.62
2cu2_A337 Putative mannose-1-phosphate guanylyl transferase; 99.62
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.61
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransfera 99.6
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.6
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.59
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.59
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.58
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.57
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.57
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.56
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 99.55
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.55
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.55
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.55
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 99.53
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 99.53
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.53
2icy_A469 Probable UTP-glucose-1-phosphate uridylyltransfera 99.53
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 99.52
1vic_A262 3-deoxy-manno-octulosonate cytidylyltransferase; s 99.51
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.5
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.5
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.5
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 99.49
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 99.48
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 99.47
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 99.44
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 99.42
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 99.41
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.41
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 99.41
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 99.4
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 99.4
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.39
2xme_A232 CTP-inositol-1-phosphate cytidylyltransferase; CDP 99.38
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 99.37
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 99.36
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.36
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.33
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.31
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.31
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 99.31
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 99.31
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.28
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.24
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 99.2
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 99.19
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 99.18
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 99.16
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 99.15
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 99.13
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 99.11
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 99.08
2i5k_A488 UTP--glucose-1-phosphate uridylyltransferase; LEFT 99.06
2dpw_A232 Hypothetical protein TTHA0179; transferase, struct 99.06
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 99.04
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 99.02
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 98.98
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 98.94
1jv1_A505 Glcnac1P uridyltransferase isoform 1: AGX1; nucleo 98.91
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.88
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 98.8
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 98.73
3rsb_A196 Adenosylcobinamide-phosphate guanylyltransferase; 98.71
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 98.7
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 98.68
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 98.65
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 98.4
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; 98.22
2oeg_A505 UTP-glucose-1-phosphate uridylyltransferase 2, put 98.14
2e8b_A201 Probable molybdopterin-guanine dinucleotide biosy 98.05
3oc9_A405 UDP-N-acetylglucosamine pyrophosphorylase; structu 98.04
3q80_A231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 97.99
2px7_A236 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 97.96
2yqc_A486 UDP-N-acetylglucosamine pyrophosphorylase; uridine 97.77
1w55_A371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 97.52
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 97.27
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 97.06
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 95.23
2i5e_A211 Hypothetical protein MM_2497; APC86122, methanosar 92.81
3cgx_A242 Putative nucleotide-diphospho-sugar transferase; Y 88.47
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 86.92
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 83.81
3bcv_A240 Putative glycosyltransferase protein; protein stru 82.5
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
Probab=100.00  E-value=5.7e-44  Score=342.40  Aligned_cols=361  Identities=21%  Similarity=0.316  Sum_probs=270.1

Q ss_pred             CHHHHHHHHHHcCCCEEEEEccCChHHHHHHHccccccCCcEEEEeecCCCCCCchHHHHhHHhhCCCCCcEEEEeCCc-
Q psy9164           1 MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQEPFFVLNSDI-   79 (380)
Q Consensus         1 li~~~l~~l~~~gi~~i~vv~~~~~~~i~~~l~~~~~~~~~~i~~~~~~~~~gt~~al~~a~~~i~~~~~~~lv~~gD~-   79 (380)
                      ||+|+|++|.++|+++|+|++++..+++.+++.+     ++  .+..+++..|++++++.+.+++....+.||+++||. 
T Consensus        41 li~~~l~~l~~~g~~~iivv~~~~~~~i~~~~~~-----~i--~~v~~~~~~G~~~sl~~a~~~~~~~~~~vlv~~~D~P  113 (468)
T 1hm9_A           41 MLEHVFRSVGAIQPEKTVTVVGHKAELVEEVLAG-----QT--EFVTQSEQLGTGHAVMMTEPILEGLSGHTLVIAGDTP  113 (468)
T ss_dssp             HHHHHHHHHHTTCCSEEEEEECTTHHHHHHSSSS-----SS--EEEECSSCCCHHHHHHTTHHHHTTCCSEEEEEETTCT
T ss_pred             HHHHHHHHHHhcCCCCEEEEECCCHHHHHHHhCC-----Cc--EEEeCCccCChHHHHHHHHHHhccCCCeEEEEeCCcc
Confidence            6899999999999999999999998888888754     33  345567788999999999999842246799999999 


Q ss_pred             -ccCCChHHHHHHHHhcCCcEEEEEEEcCCCCceeEEEECCCCceeEEEeCCC----CCCCCeEEEEEEEeCHhHH-hhc
Q psy9164          80 -ICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEHGCIESFIEKPQ----EFVSNKINAGMYIFNPSVL-DRI  153 (380)
Q Consensus        80 -i~~~~l~~~l~~h~~~~~~~tl~~~~~~~~~~~g~v~~d~~~~v~~~~ek~~----~~~~~~~~~giyi~~~~~l-~~l  153 (380)
                       +.+.+++++++.|++.+++++++..+.+++..||.+..|+++++..|.|||.    .....+.++|+|+|+++.+ +.+
T Consensus       114 ~i~~~~i~~l~~~~~~~~~~~~i~~~~~~~~~~~g~v~~d~~g~v~~~~ek~~~~~~~~~~~~~~~Giy~f~~~~l~~~l  193 (468)
T 1hm9_A          114 LITGESLKNLIDFHINHKNVATILTAETDNPFGYGRIVRNDNAEVLRIVEQKDATDFEKQIKEINTGTYVFDNERLFEAL  193 (468)
T ss_dssp             TCCHHHHHHHHHHHHHTTCSEEEEEEECSCCTTSCEEEECTTCCEEEEECTTTCCTTGGGCCEEEEEEEEEEHHHHHHHH
T ss_pred             ccCHHHHHHHHHHHHhcCCcEEEEEeccCCCCceeEEEECCCCCEEEEEECCCCChHHhcCeEEEEEEEEEEHHHHHHHH
Confidence             6678899999999998888999999988888999999988899999999864    2246799999999999854 554


Q ss_pred             cCC------CCCcccchhhhhhcCC-cEEEEEeccEEEe--cCChhhHHHHHHHHHhhhccc----CcccccC-CCcccc
Q psy9164         154 EIK------PTSIEKEIFPLMSKEK-QLYAMELKGFWMD--VGQPRDFLKGMCLYLNSLRQK----RPKLLKE-GDGIVG  219 (380)
Q Consensus       154 ~~~------~~~~~~~il~~l~~~~-~i~~~~~~~~~~~--i~~~~~~~~a~~~~l~~~~~~----~~~~~~~-~~~i~~  219 (380)
                      +..      ...+..++++.+.+++ +++.+..+++|.+  ++++++|.++...+..+....    ....+.+ ...+.+
T Consensus       194 ~~~~~~~~~~~~~~~d~~~~l~~~g~~v~~~~~~g~~~~i~i~t~~dl~~a~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  273 (468)
T 1hm9_A          194 KNINTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAESVMRRRINHKHMVNGVSFVNPEATYIDI  273 (468)
T ss_dssp             TTCCSCSTTCSCCTTHHHHHHHHHTCCEEEEECSSGGGGCCCCSHHHHHHHHHHHHHHHHHHHHHTTCEESCGGGCEECT
T ss_pred             HhhccccCCCeEEHHHHHHHHHHCCCEEEEEEcCChHHhhCCCCHHHHHHHHHHHHHHHHHHHHhcCCEEECCCeeEECC
Confidence            321      1122367888888775 8999999999977  559999988876655433211    1111222 345677


Q ss_pred             ceeeCCCCEECCCcEECCCcEECCCCEEcCCcEEeceEEccCCEECCCcEecCeEEcCCCEECCceEEeeeeEecceEEC
Q psy9164         220 NVLVDPTATIGPGCRIGPNVTIGPGVVIEGGVCIKRSTILRDAIVKSHSWLEGCIIGWKCVVGQWVRMENITVLGECIIG  299 (380)
Q Consensus       220 ~~~i~~~~~i~~~~~i~~~~~ig~~~~i~~~~~i~~~~i~~~~~i~~~~~i~~~~ig~~~~ig~~~~i~~~~~~~~~~ig  299 (380)
                      ++.|++++.|++++.|++++.||++|.|++++.|+++.||++|.|+ ++.+.++.||+++.|++++.|.+     +++||
T Consensus       274 ~~~i~~~~~i~~~~~i~~~~~ig~~~~I~~~~~i~~~~ig~~~~i~-~~~i~~~~Ig~~~~Ig~~~~i~~-----~~~ig  347 (468)
T 1hm9_A          274 DVEIAPEVQIEANVILKGQTKIGAETVLTNGTYVVDSTIGAGAVIT-NSMIEESSVADGVTVGPYAHIRP-----NSSLG  347 (468)
T ss_dssp             TCEECTTCEECSSCEEESSCEECTTCEECTTCEEESCEECTTCEEC-SCEEESCEECTTCEECSSCEECS-----SCEEC
T ss_pred             CcEECCCCEECCCcEECCCCEECCCCEECCCCEEeccEEeCCcEEE-EEEEeccccCCCcEECCceEEec-----CcEEC
Confidence            7888888888888888888899999999999999899999999999 88888888888888888888853     44444


Q ss_pred             ccceeCcceEEc-----------c-----ceEECCCeEECcceEEcC-------Ceeecc-eeecCcceeecceeEecCc
Q psy9164         300 WKCVVGQWVRME-----------N-----ITVLGEDVIVQDELYVNG-------GQVLPH-KSIGSSLHMLGEDVIVQDE  355 (380)
Q Consensus       300 ~~~~ig~~~~i~-----------~-----~~~ig~~~~ig~~~~i~~-------~~v~~~-~~i~~~~~~~~~~v~i~~~  355 (380)
                      +++.||+++.+.           +     .+.||++++||+++.+..       ++++++ ..||.+++ +.++++||++
T Consensus       348 ~~~~Ig~~~~i~~~~Ig~~~~i~~~~~i~~~~Ig~~~~Ig~~~~i~~~~~~~~~~~~Ig~~~~Ig~~~~-i~~~v~Ig~~  426 (468)
T 1hm9_A          348 AQVHIGNFVEVKGSSIGENTKAGHLTYIGNCEVGSNVNFGAGTITVNYDGKNKYKTVIGDNVFVGSNST-IIAPVELGDN  426 (468)
T ss_dssp             TTCEEEEEEEEESCEECTTCEEEEEEEEESEEECTTCEECTTCEEECBCSSCBCCEEECTTCEECTTCE-EESSCEECTT
T ss_pred             CccEECCCcEEeeeEEcCCcEeCCceEEccccccCCcEECCCcEEecCcCccCCCcEECCCeEECCCCE-EeCCcEECCC
Confidence            444444444432           1     134444455554444432       222222 33444433 3557889999


Q ss_pred             eEEeceeeeccccccCCCCCCCccC
Q psy9164         356 LYVNGGQVLPHKSIGSSVPEPQIIM  380 (380)
Q Consensus       356 ~~i~~~~v~p~~~v~~~vp~~~iv~  380 (380)
                      ++||++++     |++|+|++++++
T Consensus       427 ~~i~~~s~-----v~~~v~~~~~~~  446 (468)
T 1hm9_A          427 SLVGAGST-----ITKDVPADAIAI  446 (468)
T ss_dssp             CEECTTCE-----ECSCBCTTCEEC
T ss_pred             CEECCCCE-----ECCCCCCCCEEE
Confidence            99999999     999999999864



>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>1tzf_A Glucose-1-phosphate cytidylyltransferase; nucleotidyltransferase, mixed alpha/beta fold; HET: C5G; 2.10A {Salmonella enterica subsp} SCOP: c.68.1.13 PDB: 1wvc_A* Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>4evw_A Nucleoside-diphosphate-sugar pyrophosphorylase; structural genomics, PSI-biology; HET: MSE; 1.90A {Vibrio cholerae} Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>2x65_A Mannose-1-phosphate guanylyltransferase; nucleotidyltransferase; HET: M1P; 2.10A {Thermotoga maritima} PDB: 2x5z_A* 2x60_A* 2x5s_A* Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>2cu2_A Putative mannose-1-phosphate guanylyl transferase; mannose-1-phosphate geranyltransferase, thermus thermophilus structural genomics; 2.20A {Thermus thermophilus} SCOP: b.81.4.1 c.68.1.20 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>1jyk_A LICC protein, CTP:phosphocholine cytidylytransferase; 3D structure, CTP:phosphocholine cytidylyltransferase; 1.50A {Streptococcus pneumoniae} SCOP: c.68.1.13 PDB: 1jyl_A* Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>1vic_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics; 1.80A {Haemophilus influenzae} SCOP: c.68.1.13 PDB: 1vh3_A 3duv_A* Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>2xme_A CTP-inositol-1-phosphate cytidylyltransferase; CDP-inositol, DI-MYO-inositol phosphate; 1.89A {Archaeoglobus fulgidus} PDB: 2xmh_A* Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>2i5k_A UTP--glucose-1-phosphate uridylyltransferase; LEFT-handed beta-helix, SGC domain; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2dpw_A Hypothetical protein TTHA0179; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 2.90A {Thermus thermophilus} SCOP: c.68.1.19 Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>1jv1_A Glcnac1P uridyltransferase isoform 1: AGX1; nucleotidyltransferase, alternative splicing; HET: UD1; 1.90A {Homo sapiens} SCOP: c.68.1.5 PDB: 1jv3_A* 1jvg_A* 1jvd_A* 1vm8_A* Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>3rsb_A Adenosylcobinamide-phosphate guanylyltransferase; pyrophosphorylase binding motif, pyrophosphorylase; HET: GTP; 2.80A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>1vpa_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TM1393, JCSG, joint center for structural GENO PSI, protein structure initiative; HET: CTP; 2.67A {Thermotoga maritima} SCOP: c.68.1.13 Back     alignment and structure
>1i52_A 4-diphosphocytidyl-2-C-methylerythritol synthase; cytidylyltransferase, deoxyxylulose-5-phosphate pathway (DXP isoprenoid biosynthesys, MEP; HET: CTP; 1.50A {Escherichia coli} SCOP: c.68.1.13 PDB: 1ini_A* 1inj_A 1vgt_A 1vgu_A 3n9w_A 1h3m_A Back     alignment and structure
>2oeg_A UTP-glucose-1-phosphate uridylyltransferase 2, putative; rossmann-fold, beta-helix, pyrophosphorylase; HET: UPG; 2.30A {Leishmania major} PDB: 2oef_A* Back     alignment and structure
>2e8b_A Probable molybdopterin-guanine dinucleotide biosy protein A; putative protein, molybdenum cofactor, structural G NPPSFA; 1.61A {Aquifex aeolicus} Back     alignment and structure
>3oc9_A UDP-N-acetylglucosamine pyrophosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.80A {Entamoeba histolytica} Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* Back     alignment and structure
>2px7_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; TTHA0171, ISPD_THET8, ISPD, structural genomics PSI; 2.20A {Thermus thermophilus HB8} Back     alignment and structure
>2yqc_A UDP-N-acetylglucosamine pyrophosphorylase; uridine-diphospho-N- acetylglucosamine, N-acetylglucosamine-1-phosphate, transferase; 1.90A {Candida albicans} PDB: 2yqh_A* 2yqj_A* 2yqs_A* Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>2i5e_A Hypothetical protein MM_2497; APC86122, methanosarcina mazei GO1, hypothetic protein, STRU genomics, PSI-2, protein structure initiative; 2.10A {Methanosarcina mazei} SCOP: c.68.1.21 Back     alignment and structure
>3cgx_A Putative nucleotide-diphospho-sugar transferase; YP_389115.1, joint center for structural genomics; 1.90A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 380
d1mc3a_291 c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} 6e-42
d1fxoa_292 c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa 3e-41
d1lvwa_295 c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacteri 1e-33
d1yp2a2307 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltr 2e-22
d1tzfa_259 c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransf 6e-18
d2jf2a1262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 1e-13
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 6e-13
d2f9ca1320 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salm 1e-09
d1j2za_ 259 b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer 2e-09
d1j2za_259 b.81.1.1 (A:) UDP N-acetylglucosamine acyltransfer 2e-09
d1v3wa_173 b.81.1.5 (A:) Ferripyochelin binding protein {Arch 8e-08
d1qrea_210 b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon M 3e-07
d1qrea_210 b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon M 2e-04
d1qrea_210 b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon M 0.001
d2oi6a1201 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha 6e-07
d2oi6a1201 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha 2e-06
d2oi6a1201 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phospha 5e-06
d1g97a1196 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha 2e-06
d3tdta_274 b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytra 4e-05
d3tdta_274 b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytra 0.002
d1yp2a1135 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylylt 5e-05
d1ocxa_182 b.81.1.3 (A:) Maltose O-acetyltransferase {Escheri 5e-05
d1xhda_172 b.81.1.5 (A:) Putative acetyltransferase/acyltrans 2e-04
d1xata_208 b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudo 3e-04
d1jyka_229 c.68.1.13 (A:) CTP:phosphocholine cytidylytransfer 5e-04
d1mr7a_203 b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero 9e-04
d1mr7a_203 b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero 0.002
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Length = 291 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RffH
species: Escherichia coli [TaxId: 562]
 Score =  146 bits (370), Expect = 6e-42
 Identities = 44/202 (21%), Positives = 87/202 (43%), Gaps = 10/202 (4%)

Query: 1   MLLHQIEALVEAGVREVILAVSYRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLAL 60
           M+ + +  L+ AG+RE+++  +   +     L  +  + GI L ++ +  P G A    +
Sbjct: 34  MIYYPLSVLMLAGIREILIITTPEDKGYFQRLLGDGSEFGIQLEYAEQPSPDGLAQAFII 93

Query: 61  AKDILNKSQEPFFVLNSDIICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEH 120
            +  LN       VL  +I     F   +       +  T+   QV +P ++GVV ++++
Sbjct: 94  GETFLNGE-PSCLVLGDNIFFGQGFSPKLRHVAARTEGATVFGYQVMDPERFGVVEFDDN 152

Query: 121 GCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIE-IKPTSIEKE-----IFPLMSKEKQL 174
               S  EKP++  SN    G+Y ++  V++  + +KP S   E     I  +  +   L
Sbjct: 153 FRAISLEEKPKQPKSNWAVTGLYFYDSKVVEYAKQVKP-SERGELEITSINQMYLEAGNL 211

Query: 175 --YAMELKGFWMDVGQPRDFLK 194
               +     W+D G     ++
Sbjct: 212 TVELLGRGFAWLDTGTHDSLIE 233


>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 295 Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 307 Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Length = 259 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Length = 320 Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Length = 259 Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 173 Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 201 Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Length = 274 Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Length = 274 Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 135 Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Length = 182 Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Length = 172 Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Length = 208 Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Length = 229 Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query380
d1fxoa_292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 99.97
d1mc3a_291 RffH {Escherichia coli [TaxId: 562]} 99.96
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.92
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.91
d1yp2a2307 Glucose-1-phosphate adenylyltransferase small subu 99.9
d1lvwa_295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 99.89
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.86
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 99.81
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.79
d1tzfa_259 Glucose-1-phosphate cytidylyltransferase RfbF {Sal 99.78
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.75
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.74
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.74
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.7
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.7
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 99.68
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.68
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.67
d1jyka_229 CTP:phosphocholine cytidylytransferase LicC {Strep 99.67
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 99.66
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.65
d2cu2a2268 Putative mannose-1-phosphate guanylyl transferase 99.64
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.63
d1g97a2250 N-acetylglucosamine 1-phosphate uridyltransferase 99.61
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.6
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.58
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.57
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.57
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.53
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.5
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.49
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 99.46
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 99.44
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.44
d2f9ca1320 Hypothetical protein YdcK {Salmonella enterica [Ta 99.42
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 99.42
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 99.39
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.37
d2oi6a2248 N-acetylglucosamine 1-phosphate uridyltransferase 99.32
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 99.3
d2f9ca1320 Hypothetical protein YdcK {Salmonella enterica [Ta 99.16
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 99.11
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 99.04
d1vh1a_246 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 98.31
d1vica_255 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 98.19
d1h7ea_245 CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)syn 98.01
d1vpaa_221 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 97.19
d1eyra_225 CMP acylneuraminate synthetase {Neisseria meningit 97.13
d1i52a_225 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 97.0
d1w77a1226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 96.97
d2dpwa1231 Uncharacterized protein TTHA0179 {Thermus thermoph 96.85
d1vgwa_226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 96.82
d1e5ka_188 Molybdenum cofactor biosynthesis protein MobA {Esc 94.04
d1qwja_228 CMP acylneuraminate synthetase {Mouse (Mus musculu 91.72
d2icya2378 UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale c 91.56
d2i5ea1208 Hypothetical protein MM2497 {Methanosarcina mazei 88.64
d1w55a1205 IspD/IspF bifunctional enzyme, CDP-me synthase dom 85.43
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 84.49
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: glucose-1-phosphate thymidylyltransferase
domain: RmlA (RfbA)
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.97  E-value=1.5e-29  Score=221.56  Aligned_cols=196  Identities=21%  Similarity=0.358  Sum_probs=171.9

Q ss_pred             CHHHHHHHHHHcCCCEEEEEcc-CChHHHHHHHccccccCCcEEEEeecCCCCCCchHHHHhHHhhCCCCCc-EEEEeCC
Q psy9164           1 MLLHQIEALVEAGVREVILAVS-YRAEQMEDELTVETKKLGISLVFSHENEPLGTAGPLALAKDILNKSQEP-FFVLNSD   78 (380)
Q Consensus         1 li~~~l~~l~~~gi~~i~vv~~-~~~~~i~~~l~~~~~~~~~~i~~~~~~~~~gt~~al~~a~~~i~~~~~~-~lv~~gD   78 (380)
                      ||+|+|++|.++|+++|+++++ ++.+.+++++.+ ++++++++.|..|++++||++|++.|+++++  +++ |+++++|
T Consensus        34 iI~~~l~~l~~~Gi~ei~ii~~~~~~~~i~~~~~~-~~~~g~~I~y~~q~~~~Gta~ai~~a~~~i~--~~~~~lil~dD  110 (292)
T d1fxoa_          34 MIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGD-GSNWGLDLQYAVQPSPDGLAQAFLIGESFIG--NDLSALVLGDN  110 (292)
T ss_dssp             TTHHHHHHHHHTTCCEEEEEECTTTHHHHHHHHTT-SGGGTCEEEEEECSSCCCGGGHHHHTHHHHT--TSEEEEEETTE
T ss_pred             hHHHHHHHHHHCCCCEEEEEeCcCCHHHHHHHhcc-ccccCeEEEEccCCCCCcHHHHHHhhhhhcC--CCceEEEEccc
Confidence            7999999999999999988776 567889999877 6778999999999999999999999999995  444 6778889


Q ss_pred             cccCCChHHHHHHHHhcCCcEEEEEEEcCCCCceeEEEECCCCceeEEEeCCCCCCCCeEEEEEEEeCHhHHhhccCCCC
Q psy9164          79 IICDFPFKDLVSFHKNHGKEGTIVVTQVEEPSKYGVVLYNEHGCIESFIEKPQEFVSNKINAGMYIFNPSVLDRIEIKPT  158 (380)
Q Consensus        79 ~i~~~~l~~~l~~h~~~~~~~tl~~~~~~~~~~~g~v~~d~~~~v~~~~ek~~~~~~~~~~~giyi~~~~~l~~l~~~~~  158 (380)
                      ++++.|+.+++++|.++++.+|+++.++++|++||++..|++++++.|.|||.++.++++.+|+|+|++++++.+..-..
T Consensus       111 ~~~~~dl~~ll~~h~~~~~~~~i~~~~V~~p~~yGV~~~d~~~ki~~~~EKP~~p~Snla~~G~Y~f~~~~~~~~~~l~~  190 (292)
T d1fxoa_         111 LYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKP  190 (292)
T ss_dssp             EEECTTHHHHHHHHHTCCSSEEEEEEECSCGGGSEEEEECTTSCEEEEEESCSSCSSSEEEEEEEEECTTHHHHHHHCCC
T ss_pred             cccCcCHHHHHHHHHhCCCCcEEEEEECCCHHHCeEEEEcCCCCEeEEEECCCCCCCCcEEEEEEEEChHHHHHHHhCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999887743322


Q ss_pred             C-----cccchhhhhhcCCcEEEEEec--cEEEecCChhhHHHHHHHH
Q psy9164         159 S-----IEKEIFPLMSKEKQLYAMELK--GFWMDVGQPRDFLKGMCLY  199 (380)
Q Consensus       159 ~-----~~~~il~~l~~~~~i~~~~~~--~~~~~i~~~~~~~~a~~~~  199 (380)
                      +     ...|+++.+++++++..+.+.  .+|.|+||++++++|+...
T Consensus       191 s~rgE~eitD~~~~~l~~~~~~~~~~~~~~~W~D~Gt~~~l~~a~~~v  238 (292)
T d1fxoa_         191 SPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFI  238 (292)
T ss_dssp             CTTSSCCHHHHHHHHHHTTCEEEEECCTTSEEEECCSHHHHHHHHHHH
T ss_pred             CCCCchhhHHHHHHHHHcCCeEEEEeCCCCEEEeCCCHHHHHHHHHHH
Confidence            2     224678888999888777764  3699999999999997543



>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yp2a2 c.68.1.6 (A:10-316) Glucose-1-phosphate adenylyltransferase small subunit, catalytic domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1tzfa_ c.68.1.13 (A:) Glucose-1-phosphate cytidylyltransferase RfbF {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1jyka_ c.68.1.13 (A:) CTP:phosphocholine cytidylytransferase LicC {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2cu2a2 c.68.1.20 (A:1-268) Putative mannose-1-phosphate guanylyl transferase (GDP)/mannose-6-phosphate isomerase TTHA1750 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g97a2 c.68.1.5 (A:2-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d2oi6a2 c.68.1.5 (A:4-251) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vh1a_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KdsB [TaxId: 562]} Back     information, alignment and structure
>d1vica_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h7ea_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} Back     information, alignment and structure
>d1vpaa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eyra_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1i52a_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2dpwa1 c.68.1.19 (A:1-231) Uncharacterized protein TTHA0179 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vgwa_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Neisseria gonorrhoeae [TaxId: 485]} Back     information, alignment and structure
>d1e5ka_ c.68.1.8 (A:) Molybdenum cofactor biosynthesis protein MobA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2icya2 c.68.1.5 (A:6-383) UDP-glucose pyrophosphorylase 2 (UDPGP 2) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2i5ea1 c.68.1.21 (A:1-208) Hypothetical protein MM2497 {Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure