Psyllid ID: psy9168

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MTWTFPLEKNHTPYFDSFPKPTVLFSSYLTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFISTLHGG
cEEEEEccccEEcccccccccEEEccccccccHHHHHHHHHHHccccccccEEccccccccEEEEEEccccEEccccccEEccccEEEEEEccccc
cEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHEEcccccccEEEEEEEcccEEEcccccEEEccccEEEEEEEcccc
mtwtfpleknhtpyfdsfpkptvlfSSYLTGTIKGLIEWLKLnklterpelfvqgdsvrpgILVLINEADWELYGELTyelkendtIMFISTLHGG
mtwtfpleknhtpyfdsfpkPTVLFSSYLTGTIKGLIEWLKLNKLTERPElfvqgdsvrpgILVLINEADWELYGELTyelkendtiMFISTLHGG
MTWTFPLEKNHTPYFDSFPKPTVLFSSYLTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFISTLHGG
****FPLEKNHTPYFDSFPKPTVLFSSYLTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFIST****
MTWTFPLEKNHTPYFDSFP********YLTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFISTLHG*
MTWTFPLEKNHTPYFDSFPKPTVLFSSYLTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFISTLHGG
*T*************************YLTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFISTLH**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTWTFPLEKNHTPYFDSFPKPTVLFSSYLTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFISTLHGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
B5DQK299 Ubiquitin-related modifie yes N/A 0.854 0.828 0.573 5e-22
B4GUT199 Ubiquitin-related modifie N/A N/A 0.854 0.828 0.573 5e-22
Q9D2P4101 Ubiquitin-related modifie yes N/A 0.666 0.633 0.718 2e-21
B4PCA1101 Ubiquitin-related modifie N/A N/A 0.854 0.811 0.573 3e-21
A9YUB5101 Ubiquitin-related modifie N/A N/A 0.666 0.633 0.687 3e-21
Q148F0101 Ubiquitin-related modifie yes N/A 0.666 0.633 0.687 3e-21
B3NFA2101 Ubiquitin-related modifie N/A N/A 0.677 0.643 0.707 4e-21
Q7KU86101 Ubiquitin-related modifie yes N/A 0.677 0.643 0.707 4e-21
Q1HQ10109 Ubiquitin-related modifie N/A N/A 0.677 0.596 0.753 4e-21
Q9BTM9101 Ubiquitin-related modifie yes N/A 0.666 0.633 0.703 4e-21
>sp|B5DQK2|URM1_DROPS Ubiquitin-related modifier 1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA23607 PE=3 SV=1 Back     alignment and function desciption
 Score =  102 bits (255), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 60/82 (73%)

Query: 15 FDSFPKPTVLFSSYLTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELY 74
          F +  +  +    +   TI  L++W+  N LTERPELF+QGD+VRPGILVLIN+ DWEL 
Sbjct: 18 FGNIKRRQLFLDGHKKWTIANLLKWMHANILTERPELFLQGDTVRPGILVLINDTDWELL 77

Query: 75 GELTYELKENDTIMFISTLHGG 96
          GEL YEL+ ND ++FISTLHGG
Sbjct: 78 GELDYELQANDNVLFISTLHGG 99
Acts as a sulfur carrier required for 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Serves as sulfur donor in tRNA 2-thiolation reaction by thiocarboxylated (-COSH) at its C-terminus by MOCS3. The sulfur is then transferred to tRNA to form 2-thiolation of mcm(5)S(2)U. May also act as an ubiquitin-like protein that is covalently conjugated to other proteins; the relevance of such function is however unclear in vivo.
Drosophila pseudoobscura pseudoobscura (taxid: 46245)
>sp|B4GUT1|URM1_DROPE Ubiquitin-related modifier 1 homolog OS=Drosophila persimilis GN=GL24132 PE=3 SV=1 Back     alignment and function description
>sp|Q9D2P4|URM1_MOUSE Ubiquitin-related modifier 1 homolog OS=Mus musculus GN=Urm1 PE=1 SV=1 Back     alignment and function description
>sp|B4PCA1|URM1_DROYA Ubiquitin-related modifier 1 homolog OS=Drosophila yakuba GN=GE20399 PE=3 SV=1 Back     alignment and function description
>sp|A9YUB5|URM1_CAPHI Ubiquitin-related modifier 1 homolog OS=Capra hircus GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|Q148F0|URM1_BOVIN Ubiquitin-related modifier 1 homolog OS=Bos taurus GN=URM1 PE=3 SV=1 Back     alignment and function description
>sp|B3NFA2|URM1_DROER Ubiquitin-related modifier 1 homolog OS=Drosophila erecta GN=GG14947 PE=3 SV=2 Back     alignment and function description
>sp|Q7KU86|URM1_DROME Ubiquitin-related modifier 1 homolog OS=Drosophila melanogaster GN=CG33276 PE=3 SV=2 Back     alignment and function description
>sp|Q1HQ10|URM1_BOMMO Ubiquitin-related modifier 1 homolog OS=Bombyx mori PE=3 SV=1 Back     alignment and function description
>sp|Q9BTM9|URM1_HUMAN Ubiquitin-related modifier 1 homolog OS=Homo sapiens GN=URM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
195999032122 hypothetical protein TRIADDRAFT_53360 [T 0.666 0.524 0.781 3e-21
39550621679 PREDICTED: ubiquitin-related modifier 1 0.791 0.962 0.618 1e-20
19516303899 GL24132 [Drosophila persimilis] gi|19846 0.854 0.828 0.573 2e-20
291232768105 PREDICTED: Ubiquitin-related modifier 1 0.677 0.619 0.738 3e-20
159163326114 Chain A, Solution Structure Of Mouse Hyp 0.666 0.561 0.718 6e-20
159163618101 Chain A, Solution Structure Of Ubiquitin 0.666 0.633 0.718 7e-20
26339916101 unnamed protein product [Mus musculus] 0.666 0.633 0.718 7e-20
312596916101 ubiquitin-related modifier 1 homolog [Ra 0.666 0.633 0.718 8e-20
21311875101 ubiquitin-related modifier 1 homolog [Mu 0.666 0.633 0.718 8e-20
43295711296 PREDICTED: ubiquitin-related modifier 1 0.687 0.687 0.681 8e-20
>gi|195999032|ref|XP_002109384.1| hypothetical protein TRIADDRAFT_53360 [Trichoplax adhaerens] gi|190587508|gb|EDV27550.1| hypothetical protein TRIADDRAFT_53360 [Trichoplax adhaerens] Back     alignment and taxonomy information
 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 55/64 (85%)

Query: 33  IKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFIST 92
           +K LI W+K N L ERPELFVQGDSVRPGILVLINE+DWEL GEL Y L+END I+FIST
Sbjct: 59  MKKLISWIKENLLQERPELFVQGDSVRPGILVLINESDWELLGELEYHLEENDCILFIST 118

Query: 93  LHGG 96
           LHGG
Sbjct: 119 LHGG 122

Source: Trichoplax adhaerens

Species: Trichoplax adhaerens

Genus: Trichoplax

Family:

Order:

Class:

Phylum: Placozoa

Superkingdom: Eukaryota
>gi|395506216|ref|XP_003757431.1| PREDICTED: ubiquitin-related modifier 1 homolog [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|195163038|ref|XP_002022360.1| GL24132 [Drosophila persimilis] gi|198464526|ref|XP_002134794.1| GA23607 [Drosophila pseudoobscura pseudoobscura] gi|238058206|sp|B5DQK2.1|URM1_DROPS RecName: Full=Ubiquitin-related modifier 1 homolog gi|238690111|sp|B4GUT1.1|URM1_DROPE RecName: Full=Ubiquitin-related modifier 1 homolog gi|194104321|gb|EDW26364.1| GL24132 [Drosophila persimilis] gi|198149757|gb|EDY73421.1| GA23607 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|291232768|ref|XP_002736326.1| PREDICTED: Ubiquitin-related modifier 1 homolog [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|159163326|pdb|1WGK|A Chain A, Solution Structure Of Mouse Hypothetical Protein 2900073h19rik Back     alignment and taxonomy information
>gi|159163618|pdb|1XO3|A Chain A, Solution Structure Of Ubiquitin Like Protein From Mus Musculus Back     alignment and taxonomy information
>gi|26339916|dbj|BAC33621.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|312596916|ref|NP_001131034.2| ubiquitin-related modifier 1 homolog [Rattus norvegicus] gi|211853166|gb|AAI69094.1| Urm1 protein [Rattus norvegicus] Back     alignment and taxonomy information
>gi|21311875|ref|NP_080891.1| ubiquitin-related modifier 1 homolog [Mus musculus] gi|68565280|sp|Q9D2P4.1|URM1_MOUSE RecName: Full=Ubiquitin-related modifier 1 homolog gi|12859510|dbj|BAB31673.1| unnamed protein product [Mus musculus] gi|20071708|gb|AAH26994.1| Ubiquitin related modifier 1 homolog (S. cerevisiae) [Mus musculus] gi|26340588|dbj|BAC33956.1| unnamed protein product [Mus musculus] gi|148676476|gb|EDL08423.1| RIKEN cDNA 2900073H19, isoform CRA_a [Mus musculus] Back     alignment and taxonomy information
>gi|432957112|ref|XP_004085792.1| PREDICTED: ubiquitin-related modifier 1 homolog [Oryzias latipes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
RGD|1306599101 Urm1 "ubiquitin related modifi 0.666 0.633 0.718 7e-22
FB|FBgn0053276101 CG33276 [Drosophila melanogast 0.677 0.643 0.707 9e-22
MGI|MGI:1915455101 Urm1 "ubiquitin related modifi 0.666 0.633 0.718 9e-22
UNIPROTKB|E2QUA4101 URM1 "Uncharacterized protein" 0.666 0.633 0.703 1.1e-21
UNIPROTKB|F1RR84101 URM1 "Uncharacterized protein" 0.666 0.633 0.703 1.1e-21
UNIPROTKB|Q148F0101 URM1 "Ubiquitin-related modifi 0.666 0.633 0.687 1.5e-21
UNIPROTKB|Q9BTM9101 URM1 "Ubiquitin-related modifi 0.666 0.633 0.703 1.5e-21
UNIPROTKB|A9YUB5101 URM1 "Ubiquitin-related modifi 0.666 0.633 0.687 1.5e-21
UNIPROTKB|Q5ZJU4101 URM1 "Ubiquitin-related modifi 0.854 0.811 0.590 3e-21
ZFIN|ZDB-GENE-091204-300101 urm1 "ubiquitin related modifi 0.666 0.633 0.671 2.1e-20
RGD|1306599 Urm1 "ubiquitin related modifier 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 255 (94.8 bits), Expect = 7.0e-22, P = 7.0e-22
 Identities = 46/64 (71%), Positives = 56/64 (87%)

Query:    33 IKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFIST 92
             I+ L+ W+K N L ERPELF+QGDSVRPGILVLIN+ADWEL GEL Y+L++ D+I+FIST
Sbjct:    38 IRNLLVWIKTNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFIST 97

Query:    93 LHGG 96
             LHGG
Sbjct:    98 LHGG 101
GO:0002098 "tRNA wobble uridine modification" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0016783 "sulfurtransferase activity" evidence=IEA
GO:0034227 "tRNA thio-modification" evidence=IEA
FB|FBgn0053276 CG33276 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1915455 Urm1 "ubiquitin related modifier 1 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUA4 URM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR84 URM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q148F0 URM1 "Ubiquitin-related modifier 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BTM9 URM1 "Ubiquitin-related modifier 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A9YUB5 URM1 "Ubiquitin-related modifier 1 homolog" [Capra hircus (taxid:9925)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJU4 URM1 "Ubiquitin-related modifier 1 homolog" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091204-300 urm1 "ubiquitin related modifier 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P40554URM1_YEASTNo assigned EC number0.58690.47910.4646yesN/A
Q7KU86URM1_DROMENo assigned EC number0.70760.67700.6435yesN/A
Q2U9H6URM1_ASPORNo assigned EC number0.60600.67700.5416yesN/A
Q75AD1URM1_ASHGONo assigned EC number0.43280.67700.65yesN/A
Q9D2P4URM1_MOUSENo assigned EC number0.71870.66660.6336yesN/A
B4GUT1URM1_DROPENo assigned EC number0.57310.85410.8282N/AN/A
Q6FWQ3URM1_CANGANo assigned EC number0.44770.67700.6632yesN/A
B3NFA2URM1_DROERNo assigned EC number0.70760.67700.6435N/AN/A
A3GFM6URM1_PICSTNo assigned EC number0.47050.68750.6534yesN/A
Q54QN0URM1_DICDINo assigned EC number0.53650.85410.8541yesN/A
B3H7G2URM12_ARATHNo assigned EC number0.56920.67700.6565yesN/A
Q0D6M1URM1_ORYSJNo assigned EC number0.63070.67700.65yesN/A
Q7Q6I6URM1_ANOGANo assigned EC number0.54090.63540.5596yesN/A
B5FVI0URM1_YARLINo assigned EC number0.57400.56250.5454yesN/A
Q9BTM9URM1_HUMANNo assigned EC number0.70310.66660.6336yesN/A
Q5ZJU4URM1_CHICKNo assigned EC number0.55680.82290.7821yesN/A
B4PCA1URM1_DROYANo assigned EC number0.57310.85410.8118N/AN/A
Q6CQU4URM1_KLULANo assigned EC number0.46260.67700.6435yesN/A
Q148F0URM1_BOVINNo assigned EC number0.68750.66660.6336yesN/A
B5DQK2URM1_DROPSNo assigned EC number0.57310.85410.8282yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
pfam0913896 pfam09138, Urm1, Urm1 (Ubiquitin related modifier) 2e-34
cd0176494 cd01764, Urm1, Urm1-like ubuitin domain 2e-28
COG513196 COG5131, URM1, Ubiquitin-like protein [Posttransla 6e-16
>gnl|CDD|220123 pfam09138, Urm1, Urm1 (Ubiquitin related modifier) Back     alignment and domain information 
 Score =  113 bits (284), Expect = 2e-34
 Identities = 40/65 (61%), Positives = 52/65 (80%)

Query: 32 TIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFIS 91
           +  LI+++K N + ERPE+F++GD+VRPGILVLIN+ DWEL GEL Y L++ D I FIS
Sbjct: 32 NMGDLIDYIKKNLIKERPEVFLEGDTVRPGILVLINDCDWELLGELDYVLEDGDKITFIS 91

Query: 92 TLHGG 96
          TLHGG
Sbjct: 92 TLHGG 96

Urm1 is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like pathway urmylation. Structural comparisons and phylogenetic analysis of the ubiquitin superfamily has indicated that Urm1 has the most conserved structural and sequence features of the common ancestor of the entire superfamily. Length = 96
>gnl|CDD|176360 cd01764, Urm1, Urm1-like ubuitin domain Back     alignment and domain information
>gnl|CDD|227460 COG5131, URM1, Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
cd0176494 Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Rel 99.94
PF0913896 Urm1: Urm1 (Ubiquitin related modifier); InterPro: 99.9
KOG4146|consensus101 99.84
TIGR0168788 moaD_arch MoaD family protein, archaeal. Members o 99.81
COG513196 URM1 Ubiquitin-like protein [Posttranslational mod 99.78
PF0259777 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam 99.63
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 99.62
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 99.55
PRK1113081 moaD molybdopterin synthase small subunit; Provisi 99.53
PLN0279982 Molybdopterin synthase sulfur carrier subunit 99.46
COG197784 MoaD Molybdopterin converting factor, small subuni 99.39
PRK0694465 sulfur carrier protein ThiS; Provisional 99.19
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 99.15
TIGR0168364 thiS thiamine biosynthesis protein ThiS. This mode 99.02
PRK0836470 sulfur carrier protein ThiS; Provisional 98.95
PRK0648865 sulfur carrier protein ThiS; Validated 98.84
PRK0643767 hypothetical protein; Provisional 98.76
PRK0805366 sulfur carrier protein ThiS; Provisional 98.74
PRK0565966 sulfur carrier protein ThiS; Validated 98.59
PRK0586365 sulfur carrier protein ThiS; Provisional 98.41
PRK0744070 hypothetical protein; Provisional 98.37
COG210468 ThiS Sulfur transfer protein involved in thiamine 98.22
PRK0769667 sulfur carrier protein ThiS; Provisional 98.2
PRK0177795 hypothetical protein; Validated 98.18
PRK0608384 sulfur carrier protein ThiS; Provisional 98.13
PRK11840 326 bifunctional sulfur carrier protein/thiazole synth 97.93
PF1445181 Ub-Mut7C: Mut7-C ubiquitin 97.51
PF0680582 Lambda_tail_I: Bacteriophage lambda tail assembly 97.2
PF0282460 TGS: TGS domain; InterPro: IPR004095 The TGS domai 96.9
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 96.8
KOG3474|consensus84 96.32
cd0161660 TGS The TGS domain, named after the ThrRS, GTPase, 95.77
cd0166675 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulate 95.76
cd0166860 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) prote 95.65
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 94.49
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 94.49
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 94.09
cd0493876 TGS_Obg-like TGS_Obg-like: The C-terminal TGS doma 94.08
cd0166976 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS doma 93.68
PRK07570 250 succinate dehydrogenase/fumarate reductase iron-su 93.53
TIGR00384 220 dhsB succinate dehydrogenase and fumarate reductas 93.45
PF0365884 Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR00534 93.06
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 91.96
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 91.73
PRK12385 244 fumarate reductase iron-sulfur subunit; Provisiona 91.21
PRK05950 232 sdhB succinate dehydrogenase iron-sulfur subunit; 90.99
PRK1150770 ribosome-associated protein; Provisional 90.88
PLN00129 276 succinate dehydrogenase [ubiquinone] iron-sulfur s 90.05
PF1445357 ThiS-like: ThiS-like ubiquitin 90.04
COG250173 S4-like RNA binding protein [Replication, recombin 88.45
PRK13552 239 frdB fumarate reductase iron-sulfur subunit; Provi 88.4
COG0479 234 FrdB Succinate dehydrogenase/fumarate reductase, F 88.07
PF01561 485 Hanta_G2: Hantavirus glycoprotein G2; InterPro: IP 86.75
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 86.65
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 86.13
PRK12577 329 succinate dehydrogenase iron-sulfur subunit; Provi 85.47
PTZ0004476 ubiquitin; Provisional 85.38
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 84.68
KOG1769|consensus99 84.55
PF0049868 FHA: FHA domain; InterPro: IPR000253 The forkhead- 84.25
TIGR0298859 YaaA_near_RecF S4 domain protein YaaA. This small 83.83
cd0166761 TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Syn 82.17
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 81.97
PF1327565 S4_2: S4 domain; PDB: 1P9K_A. 81.93
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 81.91
TIGR00691 683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 81.85
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 81.68
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 81.42
PF1183469 DUF3354: Domain of unknown function (DUF3354); Int 81.21
>cd01764 Urm1 Urm1-like ubuitin domain Back     alignment and domain information 
Probab=99.94  E-value=3.6e-27  Score=157.55  Aligned_cols=73  Identities=51%  Similarity=0.940  Sum_probs=68.6

Q ss_pred             EecCCCCCCHHHHHHHHHHHcCCCCccceecCCccccceEEEEcCcCccccCCcccccCCCCEEEEeeccCCC
Q psy9168          24 LFSSYLTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFISTLHGG   96 (96)
Q Consensus        24 e~~~~~g~TV~dLL~~L~~~~~~~~~~lf~~~g~lr~~V~VlVNg~Di~~L~GldT~L~dgD~V~iiP~vaGG   96 (96)
                      .++...++||++||++|+++|++.++++|+++|++||+|+|||||+||++++|++|+|+|||+|+||||+|||
T Consensus        22 ~~~~~~~~tV~dll~~L~~~~~~~~~~lf~~~g~lr~~i~VlvN~~di~~l~g~~t~L~dgD~v~i~P~v~GG   94 (94)
T cd01764          22 VLDGEKPVTVGDLLDYVASNLLEERPDLFIEGGSVRPGIIVLINDTDWELLGEEDYILEDGDHVVFISTLHGG   94 (94)
T ss_pred             eccCCCCCcHHHHHHHHHHhCchhhhhhEecCCcccCCEEEEECCccccccCCcccCCCCcCEEEEECCCCCC
Confidence            3454457999999999999999999999999999999999999999999999999999999999999999998

Urm1 (Ubiquitin-Related Modifier1) The Urm1 fold, like those of two closely related proteins MoaD (molybdopterin synthase) and ThiS (sulfur carrier protein), is similar to that of ubiquitin although there is little or no sequence similarity. The C-terminal glycines of Urm1 are conjugated to an E1-like protein Uba4 as part of a novel conjugation system in yeast. The Urm1 fold is found only in eukaryotes.
>PF09138 Urm1: Urm1 (Ubiquitin related modifier); InterPro: IPR015221 Ubiquitin related modifier 1 (Urm1) is a ubiquitin related protein that modifies proteins in the yeast ubiquitin-like urmylation pathway [] Back     alignment and domain information
>KOG4146|consensus Back     alignment and domain information
>TIGR01687 moaD_arch MoaD family protein, archaeal Back     alignment and domain information
>COG5131 URM1 Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>PRK11130 moaD molybdopterin synthase small subunit; Provisional Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>COG1977 MoaD Molybdopterin converting factor, small subunit [Coenzyme metabolism] Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK07696 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK01777 hypothetical protein; Validated Back     alignment and domain information
>PRK06083 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PF14451 Ub-Mut7C: Mut7-C ubiquitin Back     alignment and domain information
>PF06805 Lambda_tail_I: Bacteriophage lambda tail assembly protein I; InterPro: IPR010654 This family consists of several Bacteriophage lambda tail assembly protein I and related phage and bacterial sequences Back     alignment and domain information
>PF02824 TGS: TGS domain; InterPro: IPR004095 The TGS domain is present in a number of enzymes, for example, in threonyl-tRNA synthetase (ThrRS), GTPase, and guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase (SpoT) [] Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>KOG3474|consensus Back     alignment and domain information
>cd01616 TGS The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin Back     alignment and domain information
>cd01666 TGS_DRG_C TGS_DRG_C: DRG (developmentally regulated GTP-binding protein) represents a family of GTP-binding proteins that includes two members, DRG1 and DRG2 Back     alignment and domain information
>cd01668 TGS_RelA_SpoT TGS_RelA_SpoT: The RelA (SpoT) protein, also referred to as ppGpp hydrolase/synthetase, is a ribosome-associated protein that is activated during amino acid starvation and thought to mediate the stringent response Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd04938 TGS_Obg-like TGS_Obg-like: The C-terminal TGS domain of Obg-like GTPases such as those present in DRG (developmentally regulated GTP-binding protein), and GTP-binding proteins Ygr210 and YchF Back     alignment and domain information
>cd01669 TGS_Ygr210_C TGS_Ygr210_C: The C-terminal TGS domain of Ygr210 GTP-binding protein which is a member of Obg-like family of GTPases, and present in archaea Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PF03658 Ub-RnfH: RnfH family Ubiquitin; InterPro: IPR005346 This is a small family of proteins of unknown function Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK11507 ribosome-associated protein; Provisional Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>COG2501 S4-like RNA binding protein [Replication, recombination, and repair] Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PF01561 Hanta_G2: Hantavirus glycoprotein G2; InterPro: IPR002532 The medium (M) genome segment of Hantaviruses (family Bunyaviridae) encodes the two virion glycoproteins [], G1 and G2, as a polyprotein precursor Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>KOG1769|consensus Back     alignment and domain information
>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins Back     alignment and domain information
>TIGR02988 YaaA_near_RecF S4 domain protein YaaA Back     alignment and domain information
>cd01667 TGS_ThrRS_N TGS _ThrRS_N: ThrRS (threonyl-tRNA Synthetase) is a class II tRNA synthetase that couples threonine to its cognate tRNA Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>PF13275 S4_2: S4 domain; PDB: 1P9K_A Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>PF11834 DUF3354: Domain of unknown function (DUF3354); InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1wgk_A114 Solution Structure Of Mouse Hypothetical Protein 29 1e-22
1xo3_A101 Solution Structure Of Ubiquitin Like Protein From M 1e-22
2k9x_A110 Solution Structure Of Urm1 From Trypanosoma Brucei 2e-14
2qjl_A99 Crystal Structure Of Urm1 Length = 99 8e-11
2ax5_A107 Solution Structure Of Urm1 From Saccharomyces Cerev 9e-11
>pdb|1WGK|A Chain A, Solution Structure Of Mouse Hypothetical Protein 2900073h19rik Length = 114 Back     alignment and structure 
Iteration: 1

 Score =  101 bits (251), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 46/64 (71%), Positives = 56/64 (87%)
Query: 33  IKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFIST 92
           I+ L+ W+K N L ERPELF+QGDSVRPGILVLIN+ADWEL GEL Y+L++ D+I+FIST
Sbjct: 45  IRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFIST 104
Query: 93  LHGG 96
           LHGG
Sbjct: 105 LHGG 108
>pdb|1XO3|A Chain A, Solution Structure Of Ubiquitin Like Protein From Mus Musculus Length = 101 Back     alignment and structure
>pdb|2K9X|A Chain A, Solution Structure Of Urm1 From Trypanosoma Brucei Length = 110 Back     alignment and structure
>pdb|2QJL|A Chain A, Crystal Structure Of Urm1 Length = 99 Back     alignment and structure
>pdb|2AX5|A Chain A, Solution Structure Of Urm1 From Saccharomyces Cerevisiae Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 1e-27
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 5e-26
2k9x_A110 Tburm1, uncharacterized protein; unknown function; 4e-24
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 5e-10
1v8c_A168 MOAD related protein; riken structural genomics/pr 1e-06
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 7e-06
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 2e-05
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 5e-05
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 6e-04
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Length = 114 Back     alignment and structure
 Score = 96.2 bits (239), Expect = 1e-27
 Identities = 46/65 (70%), Positives = 56/65 (86%)

Query: 32  TIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFIS 91
            I+ L+ W+K N L ERPELF+QGDSVRPGILVLIN+ADWEL GEL Y+L++ D+I+FIS
Sbjct: 44  DIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFIS 103

Query: 92  TLHGG 96
           TLHGG
Sbjct: 104 TLHGG 108
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Length = 99 Back     alignment and structure
>2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Length = 110 Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Length = 90 Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Length = 168 Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Length = 93 Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Length = 99 Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Length = 89 Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 99.94
2k9x_A110 Tburm1, uncharacterized protein; unknown function; 99.93
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 99.89
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 99.86
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 99.8
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 99.79
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 99.77
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 99.75
1v8c_A168 MOAD related protein; riken structural genomics/pr 99.62
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 99.57
1fm0_D81 Molybdopterin convertin factor, subunit 1; molybde 99.49
2q5w_D77 Molybdopterin converting factor, subunit 1; MOCO, 99.4
2cu3_A64 Unknown function protein; thermus thermophilus HB8 99.34
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 99.33
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 99.14
1rws_A77 Hypothetical protein PF1061; residual dipolar coup 98.95
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 98.92
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 98.73
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 98.68
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 98.09
2hj1_A97 Hypothetical protein; structural genomics, PSI, pr 98.05
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 97.05
3hvz_A78 Uncharacterized protein; alpha-beta protein, struc 96.2
2eki_A93 DRG 1, developmentally-regulated GTP-binding prote 95.43
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 92.58
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 92.38
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 91.7
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 91.61
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 90.5
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 90.13
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 89.32
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 88.9
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 88.82
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 88.55
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 88.28
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 87.6
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 87.09
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 86.66
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 86.31
1wwt_A88 Threonyl-tRNA synthetase, cytoplasmic; TGS domain, 86.26
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 86.15
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 86.04
4ejq_A154 Kinesin-like protein KIF1A; homodimer, FHA domain, 85.17
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 85.11
2bs2_B 241 Quinol-fumarate reductase iron-sulfur subunit B; 2 84.89
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 84.87
1tke_A 224 Threonyl-tRNA synthetase; ligase; 1.46A {Escherich 84.29
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 84.13
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 83.84
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 82.7
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 82.65
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 82.49
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 82.17
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 81.95
2h88_B 252 Succinate dehydrogenase IP subunit; complex II, me 81.71
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 81.3
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 80.92
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 80.75
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 80.35
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 80.35
4egx_A184 Kinesin-like protein KIF1A; FHA domain, transport 80.21
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Back     alignment and structure
Probab=99.94  E-value=3.7e-27  Score=161.16  Aligned_cols=75  Identities=63%  Similarity=1.083  Sum_probs=68.9

Q ss_pred             eEEecCC-CCCCHHHHHHHHHHHcCCCCccceecCCccccceEEEEcCcCccccCCcccccCCCCEEEEeeccCCC
Q psy9168          22 TVLFSSY-LTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFISTLHGG   96 (96)
Q Consensus        22 ~ve~~~~-~g~TV~dLL~~L~~~~~~~~~~lf~~~g~lr~~V~VlVNg~Di~~L~GldT~L~dgD~V~iiP~vaGG   96 (96)
                      +|+++.. .++||++||++|+++||+.++++|+++|++||+|+|||||+||++++|++|+|+|||+|+||||+|||
T Consensus        33 ~vel~~~~~~~TV~~Ll~~L~~~~~~~~~~lf~~~g~lr~~i~VlVN~~di~~l~gldt~L~dGDeV~iip~vaGG  108 (114)
T 1wgk_A           33 QVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFISTLHGG  108 (114)
T ss_dssp             EEEECCCSSCCBHHHHHHHHTTTTCCSCHHHHCCSSSCCSSEEEEESSSBHHHHCTTTCBCCSSEEEEEEECSCCC
T ss_pred             EEEeCCCCCCCCHHHHHHHHHHHccchhHhhCccCCcccCCeEEEECCeeeeccCCcCcCCCCCCEEEEeCCCCCC
Confidence            3666621 24799999999999999999999999999999999999999999999999999999999999999998
>2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Back     alignment and structure
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D Back     alignment and structure
>2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* Back     alignment and structure
>2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>1rws_A Hypothetical protein PF1061; residual dipolar couplings, structural genomics, unknown FUN; NMR {Pyrococcus furiosus} SCOP: d.15.3.2 PDB: 1sf0_A Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>3hvz_A Uncharacterized protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.20A {Clostridium leptum} Back     alignment and structure
>2eki_A DRG 1, developmentally-regulated GTP-binding protein 1; protein NEDD3, neural precursor cell expressed developmentally DOWN-regulated protein 3; NMR {Homo sapiens} Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wwt_A Threonyl-tRNA synthetase, cytoplasmic; TGS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, ligase; NMR {Homo sapiens} Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1tke_A Threonyl-tRNA synthetase; ligase; 1.46A {Escherichia coli} SCOP: d.15.10.1 d.67.1.1 PDB: 1tje_A 1tkg_A* 1tky_A* Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d1xo3a_101 d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus 4e-19
d1v8ca187 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal 1e-05
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: MoaD/ThiS
family: C9orf74 homolog
domain: C9orf74 homolog
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 72.6 bits (178), Expect = 4e-19
 Identities = 50/84 (59%), Positives = 60/84 (71%), Gaps = 1/84 (1%)

Query: 14  YFDSFPKPTVLFSSYLTG-TIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWE 72
            FD   K  V          I+ L+ W+K N L ERPELF+QGDSVRPGILVLIN+ADWE
Sbjct: 18  LFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWE 77

Query: 73  LYGELTYELKENDTIMFISTLHGG 96
           L GEL Y+L++ D+I+FISTLHGG
Sbjct: 78  LLGELDYQLQDQDSILFISTLHGG 101
>d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d1xo3a_101 C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 99.95
d1v8ca187 MoaD-related protein, N-terminal domain {Thermus t 99.83
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 99.68
d1fm0d_81 Molybdopterin synthase subunit MoaD {Escherichia c 99.39
d1zud2165 Thiamin biosynthesis sulfur carrier protein ThiS { 98.56
d1rwsa_68 Hypothetical protein PF1061 {Archaeon Pyrococcus f 97.85
d1tygb_65 Thiamin biosynthesis sulfur carrier protein ThiS { 97.81
d2cu3a163 Uncharacterised protein TTHA0675 {Thermus thermoph 97.72
d1wxqa276 GTP-binding protein PH0525 {Pyrococcus horikoshii 95.52
d1tkea162 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 95.01
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 94.86
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 94.65
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 93.48
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 92.59
d1nyra259 Threonyl-tRNA synthetase (ThrRS), N-terminal 'addi 92.17
d1ryja_70 Hypothetical protein MTH1743 {Archaeon Methanobact 92.03
d2hj1a177 Hypothetical protein HI0395 {Haemophilus influenza 91.25
d2g1la1102 Kinesin-like protein kif1c {Human (Homo sapiens) [ 88.86
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 87.53
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 87.17
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 85.54
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 85.27
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 85.01
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 82.09
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 81.83
d1gxca_116 Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} 80.84
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: MoaD/ThiS
family: C9orf74 homolog
domain: C9orf74 homolog
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.95  E-value=3.5e-28  Score=160.37  Aligned_cols=83  Identities=60%  Similarity=1.034  Sum_probs=77.5

Q ss_pred             CccCCCCceEEecCC-CCCCHHHHHHHHHHHcCCCCccceecCCccccceEEEEcCcCccccCCcccccCCCCEEEEeec
Q psy9168          14 YFDSFPKPTVLFSSY-LTGTIKGLIEWLKLNKLTERPELFVQGDSVRPGILVLINEADWELYGELTYELKENDTIMFIST   92 (96)
Q Consensus        14 ~~~~~~~~~ve~~~~-~g~TV~dLL~~L~~~~~~~~~~lf~~~g~lr~~V~VlVNg~Di~~L~GldT~L~dgD~V~iiP~   92 (96)
                      +|+...+++++++.. .++||+|||++|+++||+.++++|.++|++|++|+|+|||+||++++|++|+|++||+|+||||
T Consensus        18 lf~~~r~~~v~l~~~~~~~TV~dll~~L~~~~p~~~~~l~~~~~~lr~~v~v~vN~~di~~l~gl~t~l~dgDeV~~~p~   97 (101)
T d1xo3a_          18 LFDGVKKHQVALPGQEEPWDIRNLLVWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSILFIST   97 (101)
T ss_dssp             GGTTCCCEEEECCSSSCCCCHHHHHHHHHHHHCCSCGGGSCCTTSCCSSEEEEETTEEHHHHTTTSCCCCTTCEEEEEET
T ss_pred             HhCCcceEEEEcCCCCCCcCHHHHHHHHHHhCCcchhhhhccCcCeeeeEEEEEcCcceeccCCCccCcCCCCEEEEeCC
Confidence            577777778888764 4799999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCC
Q psy9168          93 LHGG   96 (96)
Q Consensus        93 vaGG   96 (96)
                      ||||
T Consensus        98 v~GG  101 (101)
T d1xo3a_          98 LHGG  101 (101)
T ss_dssp             TCCC
T ss_pred             CCCC
Confidence            9999
>d1v8ca1 d.15.3.1 (A:1-87) MoaD-related protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fm0d_ d.15.3.1 (D:) Molybdopterin synthase subunit MoaD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwsa_ d.15.3.2 (A:) Hypothetical protein PF1061 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tygb_ d.15.3.2 (B:) Thiamin biosynthesis sulfur carrier protein ThiS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cu3a1 d.15.3.2 (A:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wxqa2 d.15.10.2 (A:320-395) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tkea1 d.15.10.1 (A:1-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyra2 d.15.10.1 (A:4-62) Threonyl-tRNA synthetase (ThrRS), N-terminal 'additional' domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ryja_ d.15.3.2 (A:) Hypothetical protein MTH1743 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2hj1a1 d.15.3.4 (A:11-87) Hypothetical protein HI0395 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure