Psyllid ID: psy9216


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MVKKKADSAAGREPKLVSALEDPTSQDNLVPGSNVPDNKIRLQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAVNALDFGSGGWW
cccccccccccccccccccccccccccccccccccccccccccccccccHHHEEEEEcEEEEEEEEcHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHccccc
cccccccccccccccccccccccccccccccccccccccEEEEEEEEEHcEEEEEEEEEccccEEEccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccc
mvkkkadsaagrepklvsaledptsqdnlvpgsnvpdnkIRLQKELGLMDGVAMIVGVIVGSgifvspigvlknagspGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAvnaldfgsggww
mvkkkadsaagrepklvsaledptsqdnlvpgsnvpdNKIRLQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAVNALDFGSGGWW
MVKKKADSAAGREPKLVSALEDPTSQDNLVPGSNVPDNKIRLQKELGLMDgvamivgvivgsgifvspigvLKNAGSPGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAVNALDFGSGGWW
***************************************IRLQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAVNALDFGSGGW*
**********************************************GLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAVNALDFGSGGWW
**************KLVSALEDPTSQDNLVPGSNVPDNKIRLQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAVNALDFGSGGWW
*************************************NKIRLQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAVNALDFGSGGWW
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKKKADSAAGREPKLVSALEDPTSQDNLVPGSNVPDNKIRLQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAVNALDFGSGGWW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
Q01650 507 Large neutral amino acids yes N/A 0.504 0.124 0.650 7e-18
Q8MH63180 Putative L-type amino aci no N/A 0.656 0.455 0.554 8e-18
Q9Z127 512 Large neutral amino acids yes N/A 0.504 0.123 0.634 1e-17
Q7YQK4 503 Large neutral amino acids yes N/A 0.504 0.125 0.634 1e-17
Q63016 512 Large neutral amino acids yes N/A 0.504 0.123 0.634 1e-17
Q8BGK6 515 Y+L amino acid transporte no N/A 0.856 0.207 0.440 1e-16
Q28I80 514 Y+L amino acid transporte no N/A 0.56 0.136 0.557 3e-16
Q9UHI5 535 Large neutral amino acids no N/A 0.504 0.117 0.634 5e-16
Q5RAE3 535 Large neutral amino acids no N/A 0.504 0.117 0.634 5e-16
Q9WVR6 533 Large neutral amino acids no N/A 0.504 0.118 0.634 6e-16
>sp|Q01650|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 OS=Homo sapiens GN=SLC7A5 PE=1 SV=2 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 52/63 (82%)

Query: 40  IRLQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCY 99
           + LQ+ + L++GVA+IVG I+GSGIFV+P GVLK AGSPGLAL+VW   G  S++GALCY
Sbjct: 44  VTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGALCY 103

Query: 100 AEL 102
           AEL
Sbjct: 104 AEL 106




Sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Involved in cellular amino acid uptake. Acts as an amino acid exchanger. Involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Plays a role in neuronal cell proliferation (neurogenesis) in brain. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. May play an important role in high-grade gliomas. Mediates blood-to-retina L-leucine transport across the inner blood-retinal barrier which in turn may play a key role in maintaining large neutral amino acids as well as neurotransmitters in the neural retina. Acts as the major transporter of tyrosine in fibroblasts.
Homo sapiens (taxid: 9606)
>sp|Q8MH63|LAT1N_HUMAN Putative L-type amino acid transporter 1-like protein MLAS OS=Homo sapiens GN=SLC7A5P1 PE=5 SV=1 Back     alignment and function description
>sp|Q9Z127|LAT1_MOUSE Large neutral amino acids transporter small subunit 1 OS=Mus musculus GN=Slc7a5 PE=1 SV=2 Back     alignment and function description
>sp|Q7YQK4|LAT1_RABIT Large neutral amino acids transporter small subunit 1 OS=Oryctolagus cuniculus GN=SLC7A5 PE=1 SV=1 Back     alignment and function description
>sp|Q63016|LAT1_RAT Large neutral amino acids transporter small subunit 1 OS=Rattus norvegicus GN=Slc7a5 PE=1 SV=2 Back     alignment and function description
>sp|Q8BGK6|YLAT2_MOUSE Y+L amino acid transporter 2 OS=Mus musculus GN=Slc7a6 PE=2 SV=1 Back     alignment and function description
>sp|Q28I80|YLAT2_XENTR Y+L amino acid transporter 2 OS=Xenopus tropicalis GN=slc7a6 PE=2 SV=1 Back     alignment and function description
>sp|Q9UHI5|LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens GN=SLC7A8 PE=1 SV=1 Back     alignment and function description
>sp|Q5RAE3|LAT2_PONAB Large neutral amino acids transporter small subunit 2 OS=Pongo abelii GN=SLC7A8 PE=2 SV=2 Back     alignment and function description
>sp|Q9WVR6|LAT2_RAT Large neutral amino acids transporter small subunit 2 OS=Rattus norvegicus GN=Slc7a8 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
340712486 489 PREDICTED: large neutral amino acids tra 0.56 0.143 0.685 5e-20
350399823 489 PREDICTED: large neutral amino acids tra 0.552 0.141 0.695 7e-20
242007493 494 large neutral amino acids transporter, p 0.544 0.137 0.735 9e-20
427793519 568 Putative amino acid transporter, partial 0.8 0.176 0.514 2e-19
66550796 489 PREDICTED: large neutral amino acids tra 0.528 0.134 0.746 2e-19
307184182 490 Large neutral amino acids transporter sm 0.672 0.171 0.607 3e-19
307205380 496 Large neutral amino acids transporter sm 0.528 0.133 0.727 7e-19
91083729 486 PREDICTED: similar to amino acids transp 0.528 0.135 0.712 7e-19
332025781 490 Large neutral amino acids transporter sm 0.696 0.177 0.562 9e-19
157103807 506 amino acids transporter [Aedes aegypti] 0.56 0.138 0.714 1e-18
>gi|340712486|ref|XP_003394790.1| PREDICTED: large neutral amino acids transporter small subunit 2-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  101 bits (252), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 48/70 (68%), Positives = 62/70 (88%)

Query: 33  SNVPDNKIRLQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALS 92
           +N  ++ ++L+KELGL+DGVA+IVG+IVG+GIFVSP GVL+N+GS G ALIVW+ SG LS
Sbjct: 19  NNHENDAVKLKKELGLLDGVAIIVGIIVGAGIFVSPKGVLENSGSVGQALIVWIFSGVLS 78

Query: 93  MIGALCYAEL 102
           +IGALCYAEL
Sbjct: 79  LIGALCYAEL 88




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350399823|ref|XP_003485650.1| PREDICTED: large neutral amino acids transporter small subunit 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242007493|ref|XP_002424574.1| large neutral amino acids transporter, putative [Pediculus humanus corporis] gi|212508017|gb|EEB11836.1| large neutral amino acids transporter, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|427793519|gb|JAA62211.1| Putative amino acid transporter, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|66550796|ref|XP_395404.2| PREDICTED: large neutral amino acids transporter small subunit 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|307184182|gb|EFN70702.1| Large neutral amino acids transporter small subunit 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307205380|gb|EFN83721.1| Large neutral amino acids transporter small subunit 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|91083729|ref|XP_970665.1| PREDICTED: similar to amino acids transporter [Tribolium castaneum] gi|270006804|gb|EFA03252.1| hypothetical protein TcasGA2_TC013186 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332025781|gb|EGI65938.1| Large neutral amino acids transporter small subunit 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157103807|ref|XP_001648140.1| amino acids transporter [Aedes aegypti] gi|108869341|gb|EAT33566.1| AAEL014161-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
FB|FBgn0002778 499 mnd "minidiscs" [Drosophila me 0.64 0.160 0.387 4.7e-09
UNIPROTKB|Q8MH63180 SLC7A5P1 "Putative L-type amin 0.656 0.455 0.361 1.6e-08
UNIPROTKB|Q9GIP4190 SLC7A5P2 "Putative L-type amin 0.4 0.263 0.549 1.6e-08
UNIPROTKB|Q9TU26 505 LAT "Blood-brain barrier large 0.72 0.178 0.340 2.1e-08
UNIPROTKB|E9PLV9 289 SLC7A8 "Large neutral amino ac 0.504 0.217 0.412 5.4e-08
ZFIN|ZDB-GENE-030616-586 531 slc7a8b "solute carrier family 0.68 0.160 0.360 8e-08
UNIPROTKB|K7EK24 389 SLC7A10 "Asc-type amino acid t 0.632 0.203 0.353 1e-07
UNIPROTKB|E9PQT494 SLC7A8 "Large neutral amino ac 0.488 0.648 0.393 1.4e-07
UNIPROTKB|Q01650 507 SLC7A5 "Large neutral amino ac 0.928 0.228 0.325 1.6e-07
MGI|MGI:1298205 512 Slc7a5 "solute carrier family 0.72 0.175 0.329 1.6e-07
FB|FBgn0002778 mnd "minidiscs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 143 (55.4 bits), Expect = 4.7e-09, P = 4.7e-09
 Identities = 31/80 (38%), Positives = 43/80 (53%)

Query:    23 PTSQDNLVPGSNVPDNKIRLQKELGLMDXXXXXXXXXXXXXXXXXXXXXLKNAGSPGLAL 82
             P   +N    S    + ++L+K++GL+D                     LK +GS G +L
Sbjct:    20 PAEPNNSTADSGSQGSGVKLKKQIGLLDGVAIIVGVIVGSGIFVSPKGVLKFSGSIGQSL 79

Query:    83 IVWVMSGALSMIGALCYAEL 102
             IVWV+SG LSM+GALCYAEL
Sbjct:    80 IVWVLSGVLSMVGALCYAEL 99




GO:0015171 "amino acid transmembrane transporter activity" evidence=ISS;NAS;TAS
GO:0006865 "amino acid transport" evidence=TAS
GO:0003333 "amino acid transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0060356 "leucine import" evidence=IMP
UNIPROTKB|Q8MH63 SLC7A5P1 "Putative L-type amino acid transporter 1-like protein MLAS" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GIP4 SLC7A5P2 "Putative L-type amino acid transporter 1-like protein IMAA" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TU26 LAT "Blood-brain barrier large neutral amino acid transporter" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PLV9 SLC7A8 "Large neutral amino acids transporter small subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-586 slc7a8b "solute carrier family 7 (cationic amino acid transporter, y+ system), member 8b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|K7EK24 SLC7A10 "Asc-type amino acid transporter 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PQT4 SLC7A8 "Large neutral amino acids transporter small subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q01650 SLC7A5 "Large neutral amino acids transporter small subunit 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1298205 Slc7a5 "solute carrier family 7 (cationic amino acid transporter, y+ system), member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q63016LAT1_RATNo assigned EC number0.63490.5040.1230yesN/A
Q7YQK4LAT1_RABITNo assigned EC number0.63490.5040.1252yesN/A
Q9Z127LAT1_MOUSENo assigned EC number0.63490.5040.1230yesN/A
Q01650LAT1_HUMANNo assigned EC number0.65070.5040.1242yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
TIGR00911 501 TIGR00911, 2A0308, L-type amino acid transporter 7e-26
PRK11357 445 PRK11357, frlA, putative fructoselysine transporte 5e-08
pfam13520 425 pfam13520, AA_permease_2, Amino acid permease 5e-06
COG0531 466 COG0531, PotE, Amino acid transporters [Amino acid 1e-05
TIGR00906 557 TIGR00906, 2A0303, cationic amino acid transport p 5e-05
TIGR00909 429 TIGR00909, 2A0306, amino acid transporter 9e-05
TIGR00905 473 TIGR00905, 2A0302, transporter, basic amino acid/p 1e-04
>gnl|CDD|233179 TIGR00911, 2A0308, L-type amino acid transporter Back     alignment and domain information
 Score =  100 bits (250), Expect = 7e-26
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 4/100 (4%)

Query: 3   KKKADSAAGREPKLVSALEDPTSQDNLVPGSNVPDNKIRLQKELGLMDGVAMIVGVIVGS 62
           +     +     +  S+    +   + V G       + L+KE+ L+ GV +IVG I+GS
Sbjct: 5   RVFRSQSNATNYQFSSSGRKKSVSASTVDG----GEAVALKKEITLLSGVGIIVGTIIGS 60

Query: 63  GIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAEL 102
           GIFVSP GVLKNAGS GLALI+W + G  S++GAL YAEL
Sbjct: 61  GIFVSPKGVLKNAGSVGLALIMWAVCGIFSIVGALVYAEL 100


[Transport and binding proteins, Amino acids, peptides and amines]. Length = 501

>gnl|CDD|183096 PRK11357, frlA, putative fructoselysine transporter; Provisional Back     alignment and domain information
>gnl|CDD|222193 pfam13520, AA_permease_2, Amino acid permease Back     alignment and domain information
>gnl|CDD|223605 COG0531, PotE, Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|129984 TIGR00906, 2A0303, cationic amino acid transport permease Back     alignment and domain information
>gnl|CDD|129987 TIGR00909, 2A0306, amino acid transporter Back     alignment and domain information
>gnl|CDD|129983 TIGR00905, 2A0302, transporter, basic amino acid/polyamine antiporter (APA) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
PRK15049 499 L-asparagine permease; Provisional 99.72
TIGR00911 501 2A0308 L-type amino acid transporter. 99.69
TIGR03428 475 ureacarb_perm permease, urea carboxylase system. A 99.69
KOG1287|consensus 479 99.67
PRK11387 471 S-methylmethionine transporter; Provisional 99.66
PRK10836 489 lysine transporter; Provisional 99.66
PRK10249 458 phenylalanine transporter; Provisional 99.65
PRK11357 445 frlA putative fructoselysine transporter; Provisio 99.65
PRK10238 456 aromatic amino acid transporter; Provisional 99.63
PRK10580 457 proY putative proline-specific permease; Provision 99.63
PRK10746 461 putative transport protein YifK; Provisional 99.62
TIGR01773 452 GABAperm gamma-aminobutyrate permease. GabP is hig 99.62
KOG1289|consensus 550 99.61
PRK10644 445 arginine:agmatin antiporter; Provisional 99.6
TIGR00906 557 2A0303 cationic amino acid transport permease. 99.59
TIGR00907 482 2A0304 amino acid permease (GABA permease). 99.58
PRK10655 438 potE putrescine transporter; Provisional 99.56
PRK10435 435 cadB lysine/cadaverine antiporter; Provisional 99.56
TIGR00905 473 2A0302 transporter, basic amino acid/polyamine ant 99.55
PRK11021 410 putative transporter; Provisional 99.54
TIGR00913 478 2A0310 amino acid permease (yeast). 99.54
TIGR00908 442 2A0305 ethanolamine permease. The three genes used 99.48
TIGR03810 468 arg_ornith_anti arginine/ornithine antiporter. Mem 99.47
PRK11049 469 D-alanine/D-serine/glycine permease; Provisional 99.46
COG0833 541 LysP Amino acid transporters [Amino acid transport 99.41
TIGR00909 429 2A0306 amino acid transporter. 99.4
KOG1286|consensus 554 99.38
PRK10197 446 gamma-aminobutyrate transporter; Provisional 99.3
TIGR00930 953 2a30 K-Cl cotransporter. 99.19
PRK15238 496 inner membrane transporter YjeM; Provisional 99.18
PHA02764 399 hypothetical protein; Provisional 99.15
COG1113 462 AnsP Gamma-aminobutyrate permease and related perm 99.14
COG0531 466 PotE Amino acid transporters [Amino acid transport 99.13
PF13520 426 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3G 99.04
TIGR00912 359 2A0309 spore germination protein (amino acid perme 98.77
TIGR00910 507 2A0307_GadC glutamate:gamma-aminobutyrate antiport 98.74
TIGR03813 474 put_Glu_GABA_T putative glutamate/gamma-aminobutyr 98.7
PF00324 478 AA_permease: Amino acid permease; InterPro: IPR004 98.64
TIGR00837 381 araaP aromatic amino acid transport protein. aroma 98.49
PF03845 320 Spore_permease: Spore germination protein; InterPr 97.26
PF03222 394 Trp_Tyr_perm: Tryptophan/tyrosine permease family; 97.1
COG0814 415 SdaC Amino acid permeases [Amino acid transport an 97.04
PRK10483 414 tryptophan permease; Provisional 96.91
PRK09664 415 tryptophan permease TnaB; Provisional 96.81
TIGR00796 378 livcs branched-chain amino acid uptake carrier. tr 96.54
TIGR00814 397 stp serine transporter. The HAAAP family includes 96.45
PF01235 416 Na_Ala_symp: Sodium:alanine symporter family; Inte 96.44
KOG1303|consensus 437 96.34
PRK13629 443 threonine/serine transporter TdcC; Provisional 95.62
PRK15132 403 tyrosine transporter TyrP; Provisional 95.53
PTZ00206 467 amino acid transporter; Provisional 93.98
COG1115 452 AlsT Na+/alanine symporter [Amino acid transport a 93.86
TIGR00835 425 agcS amino acid carrier protein. Members of the AG 93.51
PF01490 409 Aa_trans: Transmembrane amino acid transporter pro 93.05
PLN03074 473 auxin influx permease; Provisional 91.3
KOG1305|consensus 411 89.64
>PRK15049 L-asparagine permease; Provisional Back     alignment and domain information
Probab=99.72  E-value=2.5e-17  Score=131.24  Aligned_cols=83  Identities=19%  Similarity=0.191  Sum_probs=77.2

Q ss_pred             cccccccChHHHHHHHhhchhcchhccchHHHHHhhCCchHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCCchHhHhhHh
Q psy9216          40 IRLQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAVNALDF  119 (125)
Q Consensus        40 ~~l~r~l~~~~~~~~~~~~~ig~gi~~~~~~~~~~~G~~G~~~~~~i~~~~~~~~~a~~~ael~s~~P~~GG~y~~~~~~  119 (125)
                      +++||+++.+++.+++++.+||+|+|.+++..+..+|+.  .+++|+++++++++++++++||++++|.+||.| .|+++
T Consensus        24 ~~l~r~L~~~~~~~i~~G~~IGsGiF~~~g~~~~~aGp~--~il~~li~~i~~~~v~~slaELas~~P~aGg~y-~y~~~  100 (499)
T PRK15049         24 EGYHKAMGNRQVQMIAIGGAIGTGLFLGAGARLQMAGPA--LALVYLICGLFSFFILRALGELVLHRPSSGSFV-SYARE  100 (499)
T ss_pred             hhhhccCCHhHhHHHhhhccccchHHHhhHHHHHhcCCH--HHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCHH-HHHHH
Confidence            459999999999999999999999999999999988874  567899999999999999999999999999997 99999


Q ss_pred             hhCCCC
Q psy9216         120 GSGGWW  125 (125)
Q Consensus       120 ~~G~~~  125 (125)
                      .+|+++
T Consensus       101 ~~G~~~  106 (499)
T PRK15049        101 FLGEKA  106 (499)
T ss_pred             HhCcHh
Confidence            999863



>TIGR00911 2A0308 L-type amino acid transporter Back     alignment and domain information
>TIGR03428 ureacarb_perm permease, urea carboxylase system Back     alignment and domain information
>KOG1287|consensus Back     alignment and domain information
>PRK11387 S-methylmethionine transporter; Provisional Back     alignment and domain information
>PRK10836 lysine transporter; Provisional Back     alignment and domain information
>PRK10249 phenylalanine transporter; Provisional Back     alignment and domain information
>PRK11357 frlA putative fructoselysine transporter; Provisional Back     alignment and domain information
>PRK10238 aromatic amino acid transporter; Provisional Back     alignment and domain information
>PRK10580 proY putative proline-specific permease; Provisional Back     alignment and domain information
>PRK10746 putative transport protein YifK; Provisional Back     alignment and domain information
>TIGR01773 GABAperm gamma-aminobutyrate permease Back     alignment and domain information
>KOG1289|consensus Back     alignment and domain information
>PRK10644 arginine:agmatin antiporter; Provisional Back     alignment and domain information
>TIGR00906 2A0303 cationic amino acid transport permease Back     alignment and domain information
>TIGR00907 2A0304 amino acid permease (GABA permease) Back     alignment and domain information
>PRK10655 potE putrescine transporter; Provisional Back     alignment and domain information
>PRK10435 cadB lysine/cadaverine antiporter; Provisional Back     alignment and domain information
>TIGR00905 2A0302 transporter, basic amino acid/polyamine antiporter (APA) family Back     alignment and domain information
>PRK11021 putative transporter; Provisional Back     alignment and domain information
>TIGR00913 2A0310 amino acid permease (yeast) Back     alignment and domain information
>TIGR00908 2A0305 ethanolamine permease Back     alignment and domain information
>TIGR03810 arg_ornith_anti arginine/ornithine antiporter Back     alignment and domain information
>PRK11049 D-alanine/D-serine/glycine permease; Provisional Back     alignment and domain information
>COG0833 LysP Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00909 2A0306 amino acid transporter Back     alignment and domain information
>KOG1286|consensus Back     alignment and domain information
>PRK10197 gamma-aminobutyrate transporter; Provisional Back     alignment and domain information
>TIGR00930 2a30 K-Cl cotransporter Back     alignment and domain information
>PRK15238 inner membrane transporter YjeM; Provisional Back     alignment and domain information
>PHA02764 hypothetical protein; Provisional Back     alignment and domain information
>COG1113 AnsP Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism] Back     alignment and domain information
>COG0531 PotE Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>PF13520 AA_permease_2: Amino acid permease; PDB: 3NCY_A 3GI8_C 3GIA_A 3GI9_C 3OB6_A 3L1L_A 3LRC_D 3LRB_B 4DJK_A 4DJI_A Back     alignment and domain information
>TIGR00912 2A0309 spore germination protein (amino acid permease) Back     alignment and domain information
>TIGR00910 2A0307_GadC glutamate:gamma-aminobutyrate antiporter Back     alignment and domain information
>TIGR03813 put_Glu_GABA_T putative glutamate/gamma-aminobutyrate antiporter Back     alignment and domain information
>PF00324 AA_permease: Amino acid permease; InterPro: IPR004841 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>TIGR00837 araaP aromatic amino acid transport protein Back     alignment and domain information
>PF03845 Spore_permease: Spore germination protein; InterPro: IPR004761 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>PF03222 Trp_Tyr_perm: Tryptophan/tyrosine permease family; InterPro: IPR018227 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>COG0814 SdaC Amino acid permeases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10483 tryptophan permease; Provisional Back     alignment and domain information
>PRK09664 tryptophan permease TnaB; Provisional Back     alignment and domain information
>TIGR00796 livcs branched-chain amino acid uptake carrier Back     alignment and domain information
>TIGR00814 stp serine transporter Back     alignment and domain information
>PF01235 Na_Ala_symp: Sodium:alanine symporter family; InterPro: IPR001463 Sodium symporters can be divided by sequence and functional similarity into various groups Back     alignment and domain information
>KOG1303|consensus Back     alignment and domain information
>PRK13629 threonine/serine transporter TdcC; Provisional Back     alignment and domain information
>PRK15132 tyrosine transporter TyrP; Provisional Back     alignment and domain information
>PTZ00206 amino acid transporter; Provisional Back     alignment and domain information
>COG1115 AlsT Na+/alanine symporter [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00835 agcS amino acid carrier protein Back     alignment and domain information
>PF01490 Aa_trans: Transmembrane amino acid transporter protein; InterPro: IPR013057 This transmembrane region is found in many amino acid transporters including P34579 from SWISSPROT (UNC-47) and P40501 from SWISSPROT (MTR) Back     alignment and domain information
>PLN03074 auxin influx permease; Provisional Back     alignment and domain information
>KOG1305|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
3l1l_A 445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 5e-12
3gia_A 444 Uncharacterized protein MJ0609; membrane protein, 6e-09
>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Length = 445 Back     alignment and structure
 Score = 60.4 bits (147), Expect = 5e-12
 Identities = 17/71 (23%), Positives = 38/71 (53%), Gaps = 3/71 (4%)

Query: 42  LQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAE 101
              ++GL+    M+ G I+GSG+F+ P  +   A + G+A+  W+++   ++  ++ YA+
Sbjct: 6   DAHKVGLIPVTLMVSGAIMGSGVFLLPANL---ASTGGIAIYGWLVTIIGALGLSMVYAK 62

Query: 102 LVEKICHLSGA 112
           +        G+
Sbjct: 63  MSFLDPSPGGS 73


>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Length = 444 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
3gia_A 444 Uncharacterized protein MJ0609; membrane protein, 99.5
3l1l_A 445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 99.49
4djk_A 511 Probable glutamate/gamma-aminobutyrate antiporter; 99.09
2jln_A 501 MHP1; hydantoin, transporter, membrane protein, nu 92.05
>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Back     alignment and structure
Probab=99.50  E-value=3.7e-14  Score=109.05  Aligned_cols=81  Identities=28%  Similarity=0.350  Sum_probs=74.6

Q ss_pred             ccccccChHHHHHHHhhchhcchhccchHHHHHhhCCchHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCCchHhHhhHhh
Q psy9216          41 RLQKELGLMDGVAMIVGVIVGSGIFVSPIGVLKNAGSPGLALIVWVMSGALSMIGALCYAELVEKICHLSGAAVNALDFG  120 (125)
Q Consensus        41 ~l~r~l~~~~~~~~~~~~~ig~gi~~~~~~~~~~~G~~G~~~~~~i~~~~~~~~~a~~~ael~s~~P~~GG~y~~~~~~~  120 (125)
                      +.||+++.++.++++++.++|+|+|..++.....+|+.  .++.|++++++.++.+++++|+++++|.+||.| .|+++.
T Consensus         3 ~~~r~l~~~~~~~l~~g~~iG~gi~~~~~~~~~~~G~~--~~~~~li~~~~~~~~~~~~~el~~~~P~~Gg~y-~~~~~~   79 (444)
T 3gia_A            3 LKNKKLSLWEAVSMAVGVMIGASIFSIFGVGAKIAGRN--LPETFILSGIYALLVAYSYTKLGAKIVSNAGPI-AFIHKA   79 (444)
T ss_dssp             CCCCCBCHHHHHHHHHHHHHHHHTTTSHHHHHHHHGGG--HHHHHHHHHHHHHHHHHHHHHHHTTCCCTTTHH-HHHHHH
T ss_pred             ccCCcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcH--HHHHHHHHHHHHHHHHHHHHHHHhhCCCCCcHH-HhHHHH
Confidence            45799999999999999999999999998888888764  677899999999999999999999999999997 999999


Q ss_pred             hCCC
Q psy9216         121 SGGW  124 (125)
Q Consensus       121 ~G~~  124 (125)
                      +|++
T Consensus        80 ~G~~   83 (444)
T 3gia_A           80 IGDN   83 (444)
T ss_dssp             HCSS
T ss_pred             hCcc
Confidence            9985



>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3ob6_A* 3hqk_A 3ncy_A Back     alignment and structure
>4djk_A Probable glutamate/gamma-aminobutyrate antiporter; LEUT, glutamate-GABA antiporter, transport protein; 3.10A {Escherichia coli} PDB: 4dji_A Back     alignment and structure
>2jln_A MHP1; hydantoin, transporter, membrane protein, nucleobase-cation-symport-1 family; 2.85A {Microbacterium liquefaciens} PDB: 2jlo_A* 2x79_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00