Psyllid ID: psy9231

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MEHGPLPLAETIDHGRKNTQINFFILPGVSTMVKASLRTLLFISMSSFFPVFVWTGITSMDVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDAM
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEcccccccccccccHHHHccccEEEEcccccccccccccccccHHHHHHHHHcccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccEEccEEccHHHHHHHHHHHHcccccccccccccccccccHHHcHHHHHHHHHHccccHHHc
mehgplplaetidhgrkntqinffilpGVSTMVKASLRTLLFISMSSFFPVFVWTGITSMDVLCKvcgdkasgkhygvpscdgcrgffKRSIRRNLEYVCKErghcivdvtrrnqcqacrfskcLQVKMNRDAM
MEHGPLPLAETIDHGRKNTQINFFILPGVSTMVKASLRTLLFISMSSFFPVFVWTGITSMDVLCKVCGDKasgkhygvpscdgcrGFFKRSIRRNLEYVCKErghcivdvtrrnqcqacrfskclqvkmnrdam
MEHGPLPLAETIDHGRKNTQINFFILPGVSTMVKASLRTLLFISMSSFFPVFVWTGITSMDVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDAM
***************RKNTQINFFILPGVSTMVKASLRTLLFISMSSFFPVFVWTGITSMDVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQV*******
***************************************************************CKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNR***
MEHGPLPLAETIDHGRKNTQINFFILPGVSTMVKASLRTLLFISMSSFFPVFVWTGITSMDVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDAM
***********************************************************MDVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMN****
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHGPLPLAETIDHGRKNTQINFFILPGVSTMVKASLRTLLFISMSSFFPVFVWTGITSMDVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDAM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query134 2.2.26 [Sep-21-2011]
P70052 386 Nuclear receptor subfamil N/A N/A 0.597 0.207 0.666 1e-26
Q64104 385 Nuclear receptor subfamil yes N/A 0.559 0.194 0.675 4e-26
Q9Y466 385 Nuclear receptor subfamil yes N/A 0.559 0.194 0.675 5e-26
Q91379 385 Nuclear receptor subfamil yes N/A 0.559 0.194 0.675 5e-26
Q9YGL3 396 Nuclear receptor subfamil N/A N/A 0.559 0.189 0.662 2e-25
O16845 450 Protein tailless OS=Droso N/A N/A 0.544 0.162 0.64 6e-25
P18102 452 Protein tailless OS=Droso no N/A 0.544 0.161 0.64 6e-25
O76202 472 Protein ultraspiracle hom N/A N/A 0.537 0.152 0.583 1e-24
Q9XVV3 416 Nuclear hormone receptor yes N/A 0.559 0.180 0.6 3e-23
P10588 404 Nuclear receptor subfamil no N/A 0.559 0.185 0.573 6e-23
>sp|P70052|NR2E1_XENLA Nuclear receptor subfamily 2 group E member 1 OS=Xenopus laevis GN=nr2e1 PE=2 SV=1 Back     alignment and function desciption
 Score =  117 bits (294), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/84 (66%), Positives = 66/84 (78%), Gaps = 4/84 (4%)

Query: 55  TGITS--MDVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCK--ERGHCIVDV 110
           TG TS  +D+ CKVCGD++SGKHYGV +CDGC GFFKRSIRRN  YVCK   +G C VD 
Sbjct: 5   TGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRSYVCKSGNQGGCPVDK 64

Query: 111 TRRNQCQACRFSKCLQVKMNRDAM 134
           T RNQC+ACR  KCL+V MN+DA+
Sbjct: 65  THRNQCRACRLKKCLEVNMNKDAV 88
Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5'-AAGTCA-3' in which the 5' flanking nucleotides participate in determining receptor specificity (By similarity). Involved in the regulation of early eye development.
Xenopus laevis (taxid: 8355)
>sp|Q64104|NR2E1_MOUSE Nuclear receptor subfamily 2 group E member 1 OS=Mus musculus GN=Nr2e1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y466|NR2E1_HUMAN Nuclear receptor subfamily 2 group E member 1 OS=Homo sapiens GN=NR2E1 PE=2 SV=1 Back     alignment and function description
>sp|Q91379|NR2E1_CHICK Nuclear receptor subfamily 2 group E member 1 OS=Gallus gallus GN=NR2E1 PE=2 SV=1 Back     alignment and function description
>sp|Q9YGL3|NR2E1_ORYLA Nuclear receptor subfamily 2 group E member 1 OS=Oryzias latipes GN=nr2e1 PE=2 SV=1 Back     alignment and function description
>sp|O16845|TLL_DROVI Protein tailless OS=Drosophila virilis GN=tll PE=3 SV=1 Back     alignment and function description
>sp|P18102|TLL_DROME Protein tailless OS=Drosophila melanogaster GN=tll PE=2 SV=1 Back     alignment and function description
>sp|O76202|USP_CHOFU Protein ultraspiracle homolog OS=Choristoneura fumiferana GN=USP PE=2 SV=1 Back     alignment and function description
>sp|Q9XVV3|NHR67_CAEEL Nuclear hormone receptor family member nhr-67 OS=Caenorhabditis elegans GN=nhr-67 PE=1 SV=1 Back     alignment and function description
>sp|P10588|NR2F6_HUMAN Nuclear receptor subfamily 2 group F member 6 OS=Homo sapiens GN=NR2F6 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
312371094 486 hypothetical protein AND_22643 [Anophele 0.544 0.150 0.849 3e-34
189237797 426 PREDICTED: similar to PNR-like [Triboliu 0.537 0.169 0.888 5e-34
357612132 431 putative PNR-like protein [Danaus plexip 0.552 0.171 0.824 1e-33
345497210 417 PREDICTED: nuclear receptor subfamily 2 0.552 0.177 0.837 1e-33
158302179 430 AGAP001348-PA [Anopheles gambiae str. PE 0.529 0.165 0.845 2e-33
332025246 393 Nuclear receptor subfamily 2 group E mem 0.552 0.188 0.864 2e-33
307189123 380 Photoreceptor-specific nuclear receptor 0.552 0.194 0.864 3e-33
328787581 394 PREDICTED: nuclear receptor subfamily 2 0.552 0.187 0.864 3e-33
307196423 394 Photoreceptor-specific nuclear receptor 0.552 0.187 0.864 4e-33
340722756 392 PREDICTED: COUP transcription factor 1-l 0.552 0.188 0.864 4e-33
>gi|312371094|gb|EFR19357.1| hypothetical protein AND_22643 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  149 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 62/73 (84%), Positives = 68/73 (93%)

Query: 62  VLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRF 121
           VLCKVCGD+ASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKE G C+VDV+RRNQCQACRF
Sbjct: 7   VLCKVCGDRASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKEGGKCVVDVSRRNQCQACRF 66

Query: 122 SKCLQVKMNRDAM 134
           +KCLQ  M R+A+
Sbjct: 67  AKCLQANMRREAV 79

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189237797|ref|XP_973111.2| PREDICTED: similar to PNR-like [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357612132|gb|EHJ67823.1| putative PNR-like protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|345497210|ref|XP_001599315.2| PREDICTED: nuclear receptor subfamily 2 group F member 6 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|158302179|ref|XP_321796.4| AGAP001348-PA [Anopheles gambiae str. PEST] gi|157012826|gb|EAA01088.4| AGAP001348-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|332025246|gb|EGI65420.1| Nuclear receptor subfamily 2 group E member 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307189123|gb|EFN73579.1| Photoreceptor-specific nuclear receptor [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328787581|ref|XP_624042.2| PREDICTED: nuclear receptor subfamily 2 group F member 6 [Apis mellifera] Back     alignment and taxonomy information
>gi|307196423|gb|EFN78012.1| Photoreceptor-specific nuclear receptor [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340722756|ref|XP_003399768.1| PREDICTED: COUP transcription factor 1-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query134
WB|WBGene00021417 283 nhr-236 [Caenorhabditis elegan 0.529 0.250 0.774 2.1e-29
UNIPROTKB|Q91379 385 NR2E1 "Nuclear receptor subfam 0.589 0.205 0.662 1.9e-26
UNIPROTKB|F1MN68 385 NR2E1 "Uncharacterized protein 0.589 0.205 0.662 1.9e-26
UNIPROTKB|F1PD89 385 NR2E1 "Uncharacterized protein 0.589 0.205 0.662 1.9e-26
UNIPROTKB|Q9Y466 385 NR2E1 "Nuclear receptor subfam 0.589 0.205 0.662 1.9e-26
UNIPROTKB|I3LU21 385 NR2E1 "Uncharacterized protein 0.589 0.205 0.662 1.9e-26
MGI|MGI:1100526 385 Nr2e1 "nuclear receptor subfam 0.589 0.205 0.662 1.9e-26
UNIPROTKB|Q6ZMP8 422 NR2E1 "Nuclear receptor subfam 0.559 0.177 0.675 3.2e-26
UNIPROTKB|F1RT26 421 NR2E1 "Uncharacterized protein 0.559 0.178 0.675 3.2e-26
ZFIN|ZDB-GENE-040801-127 396 nr2e1 "nuclear receptor subfam 0.559 0.189 0.675 3.2e-26
WB|WBGene00021417 nhr-236 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 326 (119.8 bits), Expect = 2.1e-29, P = 2.1e-29
 Identities = 55/71 (77%), Positives = 62/71 (87%)

Query:    64 CKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSK 123
             C+VCGD+ASG+HYGV SCDGCRGFFKRSIRRNL Y CKE G C++DVTRRNQCQACRF K
Sbjct:    13 CRVCGDRASGRHYGVLSCDGCRGFFKRSIRRNLRYSCKESGDCVIDVTRRNQCQACRFQK 72

Query:   124 CLQVKMNRDAM 134
             C+ V MNR A+
Sbjct:    73 CITVAMNRHAV 83
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0003707 "steroid hormone receptor activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043401 "steroid hormone mediated signaling pathway" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
UNIPROTKB|Q91379 NR2E1 "Nuclear receptor subfamily 2 group E member 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MN68 NR2E1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PD89 NR2E1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y466 NR2E1 "Nuclear receptor subfamily 2 group E member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LU21 NR2E1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1100526 Nr2e1 "nuclear receptor subfamily 2, group E, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZMP8 NR2E1 "Nuclear receptor subfamily 2, group E, member 1, isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RT26 NR2E1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-127 nr2e1 "nuclear receptor subfamily 2, group E, member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91379NR2E1_CHICKNo assigned EC number0.67530.55970.1948yesN/A
Q64104NR2E1_MOUSENo assigned EC number0.67530.55970.1948yesN/A
Q9XVV3NHR67_CAEELNo assigned EC number0.60.55970.1802yesN/A
Q9Y466NR2E1_HUMANNo assigned EC number0.67530.55970.1948yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
cd0716478 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of 4e-46
cd0691672 cd06916, NR_DBD_like, DNA-binding domain of nuclea 2e-38
cd0716392 cd07163, NR_DBD_TLX, DNA-binding domain of Tailles 3e-36
pfam0010570 pfam00105, zf-C4, Zinc finger, C4 type (two domain 6e-36
cd0715473 cd07154, NR_DBD_PNR_like, The DNA-binding domain o 2e-35
cd0696076 cd06960, NR_DBD_HNF4A, DNA-binding domain of hepto 4e-32
cd0696185 cd06961, NR_DBD_TR, DNA-binding domain of thyroid 1e-29
cd0695677 cd06956, NR_DBD_RXR, DNA-binding domain of retinoi 1e-29
cd0697092 cd06970, NR_DBD_PNR, DNA-binding domain of the pho 2e-29
cd0716581 cd07165, NR_DBD_DmE78_like, DNA-binding domain of 2e-28
cd0696787 cd06967, NR_DBD_TR2_like, DNA-binding domain of th 2e-28
cd0695873 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chi 2e-28
cd0695782 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of 5e-28
smart0039970 smart00399, ZnF_C4, c4 zinc finger in nuclear horm 1e-27
cd0696975 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the 1e-27
cd0716689 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV 5e-27
cd0696895 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoi 6e-27
cd0715873 cd07158, NR_DBD_Ppar_like, The DNA-binding domain 2e-26
cd0696485 cd06964, NR_DBD_RAR, DNA-binding domain of retinoi 2e-26
cd0716793 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain 3e-26
cd0696584 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxi 2e-25
cd0717182 cd07171, NR_DBD_ER, DNA-binding domain of estrogen 7e-25
cd0717097 cd07170, NR_DBD_ERR, DNA-binding domain of estroge 2e-24
cd0716990 cd07169, NR_DBD_GCNF_like, DNA-binding domain of G 3e-24
cd0715575 cd07155, NR_DBD_ER_like, DNA-binding domain of est 5e-24
cd07160101 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X 7e-24
cd0696284 cd06962, NR_DBD_FXR, DNA-binding domain of Farneso 3e-22
cd0695973 cd06959, NR_DBD_EcR_like, The DNA-binding domain o 5e-22
cd0715672 cd07156, NR_DBD_VDR_like, The DNA-binding domain o 5e-22
cd0716890 cd07168, NR_DBD_DHR4_like, DNA-binding domain of e 7e-22
cd0716191 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdyson 7e-22
cd0716287 cd07162, NR_DBD_PXR, DNA-binding domain of pregnan 6e-21
cd0717974 cd07179, 2DBD_NR_DBD2, The second DNA-binding doma 1e-20
cd0717278 cd07172, NR_DBD_GR_PR, DNA-binding domain of gluco 1e-20
cd0696373 cd06963, NR_DBD_GR_like, The DNA binding domain of 5e-19
cd06955107 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin 5e-18
cd0717382 cd07173, NR_DBD_AR, DNA-binding domain of androgen 5e-16
cd0696694 cd06966, NR_DBD_CAR, DNA-binding domain of constit 5e-16
cd0715786 cd07157, 2DBD_NR_DBD1, The first DNA-binding domai 1e-15
>gnl|CDD|143538 cd07164, NR_DBD_PNR_like_1, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers Back     alignment and domain information 
 Score =  143 bits (363), Expect = 4e-46
 Identities = 61/70 (87%), Positives = 64/70 (91%)

Query: 64  CKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSK 123
           C+VCGD+ASGKHYGVPSCDGCRGFFKRSIRRNL YVCKE G C+VDV RRNQCQACRF K
Sbjct: 1   CRVCGDRASGKHYGVPSCDGCRGFFKRSIRRNLAYVCKENGSCVVDVARRNQCQACRFKK 60

Query: 124 CLQVKMNRDA 133
           CLQV MNRDA
Sbjct: 61  CLQVNMNRDA 70

DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. PNR is a member of nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 78
>gnl|CDD|143512 cd06916, NR_DBD_like, DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143537 cd07163, NR_DBD_TLX, DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|201004 pfam00105, zf-C4, Zinc finger, C4 type (two domains) Back     alignment and domain information
>gnl|CDD|143529 cd07154, NR_DBD_PNR_like, The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family Back     alignment and domain information
>gnl|CDD|143518 cd06960, NR_DBD_HNF4A, DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143519 cd06961, NR_DBD_TR, DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143514 cd06956, NR_DBD_RXR, DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143528 cd06970, NR_DBD_PNR, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143539 cd07165, NR_DBD_DmE78_like, DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143525 cd06967, NR_DBD_TR2_like, DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143516 cd06958, NR_DBD_COUP_TF, DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143515 cd06957, NR_DBD_PNR_like_2, DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|197701 smart00399, ZnF_C4, c4 zinc finger in nuclear hormone receptors Back     alignment and domain information
>gnl|CDD|143527 cd06969, NR_DBD_NGFI-B, DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B Back     alignment and domain information
>gnl|CDD|143540 cd07166, NR_DBD_REV_ERB, DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143526 cd06968, NR_DBD_ROR, DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143533 cd07158, NR_DBD_Ppar_like, The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family Back     alignment and domain information
>gnl|CDD|143522 cd06964, NR_DBD_RAR, DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143541 cd07167, NR_DBD_Lrh-1_like, The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143523 cd06965, NR_DBD_Ppar, DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143545 cd07171, NR_DBD_ER, DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143544 cd07170, NR_DBD_ERR, DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143543 cd07169, NR_DBD_GCNF_like, DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143530 cd07155, NR_DBD_ER_like, DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143534 cd07160, NR_DBD_LXR, DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143520 cd06962, NR_DBD_FXR, DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143517 cd06959, NR_DBD_EcR_like, The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143531 cd07156, NR_DBD_VDR_like, The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143542 cd07168, NR_DBD_DHR4_like, DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143535 cd07161, NR_DBD_EcR, DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143536 cd07162, NR_DBD_PXR, DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143548 cd07179, 2DBD_NR_DBD2, The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143546 cd07172, NR_DBD_GR_PR, DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143521 cd06963, NR_DBD_GR_like, The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143513 cd06955, NR_DBD_VDR, DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143547 cd07173, NR_DBD_AR, DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143524 cd06966, NR_DBD_CAR, DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>gnl|CDD|143532 cd07157, 2DBD_NR_DBD1, The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 134
KOG4215|consensus 432 99.96
cd0696975 NR_DBD_NGFI-B DNA-binding domain of the orphan nuc 99.95
cd0715672 NR_DBD_VDR_like The DNA-binding domain of vitamin 99.95
cd0696284 NR_DBD_FXR DNA-binding domain of Farnesoid X recep 99.95
cd0696485 NR_DBD_RAR DNA-binding domain of retinoic acid rec 99.95
cd0695973 NR_DBD_EcR_like The DNA-binding domain of Ecdysone 99.95
cd0715473 NR_DBD_PNR_like The DNA-binding domain of the phot 99.95
cd0691672 NR_DBD_like DNA-binding domain of nuclear receptor 99.95
cd0717278 NR_DBD_GR_PR DNA-binding domain of glucocorticoid 99.95
cd0696373 NR_DBD_GR_like The DNA binding domain of GR_like n 99.95
cd0695873 NR_DBD_COUP_TF DNA-binding domain of chicken ovalb 99.95
cd0717974 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o 99.95
cd0696787 NR_DBD_TR2_like DNA-binding domain of the TR2 and 99.95
cd0695677 NR_DBD_RXR DNA-binding domain of retinoid X recept 99.95
cd0717182 NR_DBD_ER DNA-binding domain of estrogen receptors 99.95
cd07160101 NR_DBD_LXR DNA-binding domain of Liver X receptors 99.95
cd0697092 NR_DBD_PNR DNA-binding domain of the photoreceptor 99.95
cd0715873 NR_DBD_Ppar_like The DNA-binding domain of peroxis 99.95
cd06955107 NR_DBD_VDR DNA-binding domain of vitamin D recepto 99.95
cd0716392 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is 99.95
cd0717097 NR_DBD_ERR DNA-binding domain of estrogen related 99.94
cd0715575 NR_DBD_ER_like DNA-binding domain of estrogen rece 99.94
cd0716191 NR_DBD_EcR DNA-binding domain of Ecdysone receptor 99.94
cd0696185 NR_DBD_TR DNA-binding domain of thyroid hormone re 99.94
cd0695782 NR_DBD_PNR_like_2 DNA-binding domain of the photor 99.94
cd0696076 NR_DBD_HNF4A DNA-binding domain of heptocyte nucle 99.94
KOG4846|consensus 538 99.94
cd0715786 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of 99.94
cd0716689 NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep 99.94
cd0717382 NR_DBD_AR DNA-binding domain of androgen receptor 99.94
cd0716890 NR_DBD_DHR4_like DNA-binding domain of ecdysone-in 99.94
cd0716478 NR_DBD_PNR_like_1 DNA-binding domain of the photor 99.94
cd0716287 NR_DBD_PXR DNA-binding domain of pregnane X recept 99.94
cd0716990 NR_DBD_GCNF_like DNA-binding domain of Germ cell n 99.94
smart0039970 ZnF_C4 c4 zinc finger in nuclear hormone receptors 99.94
cd0696694 NR_DBD_CAR DNA-binding domain of constitutive andr 99.94
cd0696895 NR_DBD_ROR DNA-binding domain of Retinoid-related 99.94
cd0716793 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 99.94
KOG4217|consensus 605 99.93
cd0716581 NR_DBD_DmE78_like DNA-binding domain of Drosophila 99.93
cd0696584 NR_DBD_Ppar DNA-binding domain of peroxisome proli 99.93
PF0010570 zf-C4: Zinc finger, C4 type (two domains); InterPr 99.92
KOG4216|consensus 479 99.92
KOG4218|consensus 475 99.9
>KOG4215|consensus Back     alignment and domain information 
Probab=99.96  E-value=1.5e-30  Score=214.28  Aligned_cols=75  Identities=52%  Similarity=1.224  Sum_probs=72.9

Q ss_pred             CCccceEcCcCCCceeecCccCcCCCceeeeeEecCcccceecCCceeecCCCCCCCcchhhHHHHHccCCCCCC
Q psy9231          60 MDVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDAM  134 (134)
Q Consensus        60 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFrRtv~~~~~~~C~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~aV  134 (134)
                      ....|.||||++.|.|||+.+|++||+||||+|.++..|.|+++.+|.|+++.|+.|||||||||+++||++|||
T Consensus        18 ~~~~CaICGDkaTGKHYGA~SCdGCKGFFRRSVrk~~~YtCRF~k~C~VDKdkRNaCRyCRfqKC~~aGMK~eAi   92 (432)
T KOG4215|consen   18 VAEFCAICGDKATGKHYGAISCDGCKGFFRRSVRKNHQYTCRFNKQCVVDKDKRNACRYCRFQKCVRAGMKREAI   92 (432)
T ss_pred             ccchhheeCCcccccccceeecCcchHHHHHHHHhcceeeeeccccccccchhhhhhhHhhHHHHHHhcccHHhh
Confidence            466899999999999999999999999999999999999999999999999999999999999999999999997

>cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B Back     alignment and domain information
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family Back     alignment and domain information
>cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family Back     alignment and domain information
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers Back     alignment and domain information
>KOG4846|consensus Back     alignment and domain information
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers Back     alignment and domain information
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors Back     alignment and domain information
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers Back     alignment and domain information
>cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers Back     alignment and domain information
>KOG4217|consensus Back     alignment and domain information
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers Back     alignment and domain information
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers Back     alignment and domain information
>PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis Back     alignment and domain information
>KOG4216|consensus Back     alignment and domain information
>KOG4218|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
3dzu_A 467 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 1e-22
1r0o_A86 Crystal Structure Of The Heterodimeric Ecdysone Rec 4e-22
2han_A93 Structural Basis Of Heterodimeric Ecdysteroid Recep 5e-22
1ynw_B99 Crystal Structure Of Vitamin D Receptor And 9-Cis R 4e-21
1r0n_A81 Crystal Structure Of Heterodimeric Ecdsyone Recepto 5e-21
1by4_A82 Structure And Mechanism Of The Homodimeric Assembly 7e-21
1dsz_B85 Structure Of The RxrRAR DNA-Binding Domain Heterodi 8e-21
2ebl_A89 Solution Structure Of The Zinc Finger, C4-type Doma 2e-20
1rxr_A83 High Resolution Solution Structure Of The Retinoid 6e-20
3cbb_A78 Crystal Structure Of Hepatocyte Nuclear Factor 4alp 2e-19
1hlz_A94 Crystal Structure Of The Orphan Nuclear Receptor Re 2e-19
2nll_A66 Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi 4e-19
3dzu_D 419 Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp 8e-19
2nll_B103 Retinoid X Receptor-Thyroid Hormone Receptor Dna-Bi 1e-18
3m9e_A105 Thyroid Hormone Beta Dna Binding Domain Homodimer W 3e-18
2a66_A113 Human Liver Receptor Homologue Dna-Binding Domain ( 8e-18
1lat_A82 Glucocorticoid Receptor MutantDNA COMPLEX Length = 2e-17
2ff0_A102 Solution Structure Of Steroidogenic Factor 1 Dna Bi 2e-17
2env_A88 Solution Sturcture Of The C4-Type Zinc Finger Domai 3e-17
1dsz_A86 Structure Of The RxrRAR DNA-Binding Domain Heterodi 5e-17
1hra_A80 The Solution Structure Of The Human Retinoic Acid R 5e-17
1cit_A89 Dna-Binding Mechanism Of The Monomeric Orphan Nucle 6e-17
1lo1_A98 Estrogen Related Receptor 2 Dna Binding Domain In C 2e-16
4hn5_A117 Gr Dna Binding Domain - Tslp Ngre Complex Length = 3e-16
4aa6_E71 The Oestrogen Receptor Recognizes An Imperfectly Pa 8e-16
1hcp_A76 Dna Recognition By The Oestrogen Receptor: From Sol 8e-16
4aa6_A71 The Oestrogen Receptor Recognizes An Imperfectly Pa 8e-16
1gdc_A72 Refined Solution Structure Of The Glucocorticoid Re 1e-15
2gda_A72 Refined Solution Structure Of The Glucocorticoid Re 1e-15
1hcq_A84 The Crystal Structure Of The Estrogen Receptor Dna- 1e-15
3g9p_B90 Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 9 2e-15
4hn6_A114 Gr Dna Binding Domain R460d/d462r - Tslp Ngre Compl 2e-15
1r4o_A92 Crystallographic Analysis Of The Interaction Of The 3e-15
1r4r_B92 Crystallographic Analysis Of The Interaction Of The 4e-15
1rgd_A71 Structure Refinement Of The Glucocorticoid Receptor 4e-15
1glu_A81 Crystallographic Analysis Of The Interaction Of The 5e-15
3g6t_A91 Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 L 6e-15
1r0n_B109 Crystal Structure Of Heterodimeric Ecdsyone Recepto 4e-14
2han_B119 Structural Basis Of Heterodimeric Ecdysteroid Recep 5e-14
2c7a_A78 Structure Of The Progesterone Receptor-Dna Complex 1e-13
1ynw_A110 Crystal Structure Of Vitamin D Receptor And 9-Cis R 3e-13
1kb2_A110 Crystal Structure Of Vdr Dna-Binding Domain Bound T 7e-13
1r4i_A105 Crystal Structure Of Androgen Receptor Dna-Binding 2e-12
>pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 Back     alignment and structure 
Iteration: 1

 Score =  101 bits (252), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 58/72 (80%)
Query: 63  LCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFS 122
           +C +CGD++SGKHYGV SC+GC+GFFKR++R++L Y C++   C++D  +RN+CQ CR+ 
Sbjct: 139 ICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQ 198
Query: 123 KCLQVKMNRDAM 134
           KCL + M R+A+
Sbjct: 199 KCLAMGMKREAV 210
>pdb|1R0O|A Chain A, Crystal Structure Of The Heterodimeric Ecdysone Receptor Dna-Binding Complex Length = 86 Back     alignment and structure
>pdb|2HAN|A Chain A, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 93 Back     alignment and structure
>pdb|1YNW|B Chain B, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 99 Back     alignment and structure
>pdb|1R0N|A Chain A, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 81 Back     alignment and structure
>pdb|1BY4|A Chain A, Structure And Mechanism Of The Homodimeric Assembly Of The Rxr On Dna Length = 82 Back     alignment and structure
>pdb|1DSZ|B Chain B, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 85 Back     alignment and structure
>pdb|2EBL|A Chain A, Solution Structure Of The Zinc Finger, C4-type Domain Of Human Coup Transcription Factor 1 Length = 89 Back     alignment and structure
>pdb|1RXR|A Chain A, High Resolution Solution Structure Of The Retinoid X Receptor Dna Binding Domain, Nmr, 20 Structure Length = 83 Back     alignment and structure
>pdb|3CBB|A Chain A, Crystal Structure Of Hepatocyte Nuclear Factor 4alpha In Complex With Dna: Diabetes Gene Product Length = 78 Back     alignment and structure
>pdb|1HLZ|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Rev- Erb(Alpha) Dna-Binding Domain Bound To Its Cognate Response Element Length = 94 Back     alignment and structure
>pdb|2NLL|A Chain A, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 66 Back     alignment and structure
>pdb|3DZU|D Chain D, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 419 Back     alignment and structure
>pdb|2NLL|B Chain B, Retinoid X Receptor-Thyroid Hormone Receptor Dna-Binding Domain Heterodimer Bound To Thyroid Response Element Dna Length = 103 Back     alignment and structure
>pdb|3M9E|A Chain A, Thyroid Hormone Beta Dna Binding Domain Homodimer With Inverted Palindrome Tre Length = 105 Back     alignment and structure
>pdb|2A66|A Chain A, Human Liver Receptor Homologue Dna-Binding Domain (Hlrh-1 Dbd) In Complex With Dsdna From The Hcyp7a1 Promoter Length = 113 Back     alignment and structure
>pdb|1LAT|A Chain A, Glucocorticoid Receptor MutantDNA COMPLEX Length = 82 Back     alignment and structure
>pdb|2FF0|A Chain A, Solution Structure Of Steroidogenic Factor 1 Dna Binding Domain Bound To Its Target Sequence In The Inhibin Alpha- Subunit Promoter Length = 102 Back     alignment and structure
>pdb|2ENV|A Chain A, Solution Sturcture Of The C4-Type Zinc Finger Domain From Human Peroxisome Proliferator-Activated Receptor Delta Length = 88 Back     alignment and structure
>pdb|1DSZ|A Chain A, Structure Of The RxrRAR DNA-Binding Domain Heterodimer In Complex With The Retinoic Acid Response Element Dr1 Length = 86 Back     alignment and structure
>pdb|1HRA|A Chain A, The Solution Structure Of The Human Retinoic Acid Receptor- Beta Dna-Binding Domain Length = 80 Back     alignment and structure
>pdb|1CIT|A Chain A, Dna-Binding Mechanism Of The Monomeric Orphan Nuclear Receptor Ngfi-B Length = 89 Back     alignment and structure
>pdb|1LO1|A Chain A, Estrogen Related Receptor 2 Dna Binding Domain In Complex With Dna Length = 98 Back     alignment and structure
>pdb|4HN5|A Chain A, Gr Dna Binding Domain - Tslp Ngre Complex Length = 117 Back     alignment and structure
>pdb|4AA6|E Chain E, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 Back     alignment and structure
>pdb|1HCP|A Chain A, Dna Recognition By The Oestrogen Receptor: From Solution To The Crystal Length = 76 Back     alignment and structure
>pdb|4AA6|A Chain A, The Oestrogen Receptor Recognizes An Imperfectly Palindromic Response Element Through An Alternative Side- Chain Conformation Length = 71 Back     alignment and structure
>pdb|1GDC|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 Back     alignment and structure
>pdb|2GDA|A Chain A, Refined Solution Structure Of The Glucocorticoid Receptor Dna-Binding Domain Length = 72 Back     alignment and structure
>pdb|1HCQ|A Chain A, The Crystal Structure Of The Estrogen Receptor Dna-Binding Domain Bound To Dna: How Receptors Discriminate Between Their Response Elements Length = 84 Back     alignment and structure
>pdb|3G9P|B Chain B, Gr Dna Binding Domain:sgk 16bp Complex-7 Length = 90 Back     alignment and structure
>pdb|4HN6|A Chain A, Gr Dna Binding Domain R460d/d462r - Tslp Ngre Complex Length = 114 Back     alignment and structure
>pdb|1R4O|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 Back     alignment and structure
>pdb|1R4R|B Chain B, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 92 Back     alignment and structure
>pdb|1RGD|A Chain A, Structure Refinement Of The Glucocorticoid Receptor-Dna Binding Domain From Nmr Data By Relaxation Matrix Calculations Length = 71 Back     alignment and structure
>pdb|1GLU|A Chain A, Crystallographic Analysis Of The Interaction Of The Glucocorticoid Receptor With Dna Length = 81 Back     alignment and structure
>pdb|3G6T|A Chain A, Gr Gamma Dna-Binding Domain:fkbp5 16bp Complex-34 Length = 91 Back     alignment and structure
>pdb|1R0N|B Chain B, Crystal Structure Of Heterodimeric Ecdsyone Receptor Dna Binding Complex Length = 109 Back     alignment and structure
>pdb|2HAN|B Chain B, Structural Basis Of Heterodimeric Ecdysteroid Receptor Interaction With Natural Response Element Hsp27 Gene Promoter Length = 119 Back     alignment and structure
>pdb|2C7A|A Chain A, Structure Of The Progesterone Receptor-Dna Complex Length = 78 Back     alignment and structure
>pdb|1YNW|A Chain A, Crystal Structure Of Vitamin D Receptor And 9-Cis Retinoic Acid Receptor Dna-Binding Domains Bound To A Dr3 Response Element Length = 110 Back     alignment and structure
>pdb|1KB2|A Chain A, Crystal Structure Of Vdr Dna-Binding Domain Bound To Mouse Osteopontin (Spp) Response Element Length = 110 Back     alignment and structure
>pdb|1R4I|A Chain A, Crystal Structure Of Androgen Receptor Dna-Binding Domain Bound To A Direct Repeat Response Element Length = 105 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query134
2ebl_A89 COUP transcription factor 1; DNA-binding, metal-bi 4e-43
2han_A93 Protein ultraspiracle; transcription regulation, t 3e-42
1ynw_B99 Retinoic acid receptor RXR-alpha, retinoid X recep 1e-41
1dsz_B85 RXR-alpha, retinoic acid receptor RXR-alpha; RAR, 2e-41
1a6y_A94 Orphan nuclear receptor NR1D1; orphan receptor, DN 2e-41
3cbb_A78 HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN 2e-41
1dsz_A86 RAR-alpha, retinoic acid receptor alpha; RAR, nucl 3e-41
1hcq_A84 Protein (estrogen receptor); protein-DNA complex, 2e-40
2a66_A113 Orphan nuclear receptor NR5A2; protein-DNA complex 3e-40
3g9m_A90 Glucocorticoid receptor; glucocorticoid, DNA-bindi 7e-40
1cit_A89 NGFI-B, protein (orphan nuclear receptor NGFI-B); 2e-39
1lo1_A98 Steroid hormone receptor ERR2; estrogen related re 2e-39
2han_B119 Ecdysone receptor; transcription regulation, trans 4e-38
1r4i_A105 Androgen receptor; AR, steroid receptor, protein-D 9e-38
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 5e-37
1kb2_A110 Vitamin D3 receptor; VDR, nuclear receptor, protei 4e-36
2nll_B103 Protein (thyroid hormone receptor); complex (trans 2e-35
3dzy_D 419 Peroxisome proliferator-activated receptor gamma; 4e-33
>2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Length = 89 Back     alignment and structure
 Score =  135 bits (343), Expect = 4e-43
 Identities = 43/76 (56%), Positives = 54/76 (71%)

Query: 58  TSMDVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQ 117
            S  + C VCGDK+SGKHYG  +C+GC+ FFKRS+RRNL Y C+   +C +D   RNQCQ
Sbjct: 4   GSSGIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQ 63

Query: 118 ACRFSKCLQVKMNRDA 133
            CR  KCL+V M R+A
Sbjct: 64  YCRLKKCLKVGMRREA 79
>2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Length = 93 Back     alignment and structure
>1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Length = 99 Back     alignment and structure
>1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Length = 85 Back     alignment and structure
>1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Length = 94 Back     alignment and structure
>3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Length = 78 Back     alignment and structure
>1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Length = 86 Back     alignment and structure
>1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Length = 84 Back     alignment and structure
>2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Length = 113 Back     alignment and structure
>3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Length = 90 Back     alignment and structure
>1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Length = 89 Back     alignment and structure
>1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Length = 98 Back     alignment and structure
>2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Length = 119 Back     alignment and structure
>1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Length = 105 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Length = 110 Back     alignment and structure
>2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Length = 103 Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
2ebl_A89 COUP transcription factor 1; DNA-binding, metal-bi 99.96
3cbb_A78 HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN 99.96
1dsz_B85 RXR-alpha, retinoic acid receptor RXR-alpha; RAR, 99.96
1hcq_A84 Protein (estrogen receptor); protein-DNA complex, 99.96
2han_A93 Protein ultraspiracle; transcription regulation, t 99.96
1ynw_B99 Retinoic acid receptor RXR-alpha, retinoid X recep 99.96
1dsz_A86 RAR-alpha, retinoic acid receptor alpha; RAR, nucl 99.96
1cit_A89 NGFI-B, protein (orphan nuclear receptor NGFI-B); 99.96
1a6y_A94 Orphan nuclear receptor NR1D1; orphan receptor, DN 99.96
4hn5_A117 Glucocorticoid receptor; glucocorticoid receptor, 99.95
1kb2_A110 Vitamin D3 receptor; VDR, nuclear receptor, protei 99.95
3g9m_A90 Glucocorticoid receptor; glucocorticoid, DNA-bindi 99.95
1r4i_A105 Androgen receptor; AR, steroid receptor, protein-D 99.95
2a66_A113 Orphan nuclear receptor NR5A2; protein-DNA complex 99.95
2nll_B103 Protein (thyroid hormone receptor); complex (trans 99.95
2han_B119 Ecdysone receptor; transcription regulation, trans 99.95
1lo1_A98 Steroid hormone receptor ERR2; estrogen related re 99.95
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 99.93
3dzy_D 419 Peroxisome proliferator-activated receptor gamma; 99.91
2lze_A87 A primordial catalytic fold generated by in vitro 99.8
>2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} Back     alignment and structure
Probab=99.96  E-value=4.5e-32  Score=184.97  Aligned_cols=75  Identities=56%  Similarity=1.179  Sum_probs=70.9

Q ss_pred             CCccceEcCcCCCceeecCccCcCCCceeeeeEecCcccceecCCceeecCCCCCCCcchhhHHHHHccCCCCCC
Q psy9231          60 MDVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDAM  134 (134)
Q Consensus        60 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFrRtv~~~~~~~C~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~aV  134 (134)
                      .+..|.|||++++|+||||++|+||++||||++..+..|.|+.+++|.|++..|+.|++|||+|||++||++++|
T Consensus         6 ~~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~v~~~~~y~C~~~~~C~i~~~~r~~C~~CR~~KCl~vGM~~~~v   80 (89)
T 2ebl_A            6 SGIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAV   80 (89)
T ss_dssp             SSCBCTTTCSBCCSEETTEECCHHHHHHHHHHHTTTCCCCCSSCSCCCCCSSSSSCCSHHHHHHHHHHTCCHHHH
T ss_pred             CCCCCcEeCCCCcceEeCchhhHHhhhhhheeeeeccceecccCccCCcCccCccccccchHHHhhhccCCHHHc
Confidence            456799999999999999999999999999999999999999999999999999999999999999999998765
>3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} Back     alignment and structure
>1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* Back     alignment and structure
>1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A Back     alignment and structure
>2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 Back     alignment and structure
>1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 Back     alignment and structure
>1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A Back     alignment and structure
>1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 Back     alignment and structure
>1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A Back     alignment and structure
>4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* Back     alignment and structure
>1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A Back     alignment and structure
>3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... Back     alignment and structure
>1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 Back     alignment and structure
>2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A Back     alignment and structure
>2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* Back     alignment and structure
>2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B Back     alignment and structure
>1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Back     alignment and structure
>3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Back     alignment and structure
>2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 134
d1dszb_84 g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA- 4e-26
d1kb2a_89 g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-bindin 6e-25
d2hanb183 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding do 7e-25
d1lo1a_90 g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-bi 3e-24
d1r4ia_74 g.39.1.2 (A:) Androgen receptor {Rat (Rattus norve 5e-24
d1cita_89 g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-b 2e-23
d1lata_71 g.39.1.2 (A:) Glucocorticoid receptor DNA-binding 3e-23
d1a6ya_78 g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-b 6e-23
d1dsza_75 g.39.1.2 (A:) Retinoic acid receptor DNA-binding d 7e-23
d1hcqa_74 g.39.1.2 (A:) Estrogen receptor DNA-binding domain 3e-22
d2nllb_103 g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) D 2e-21
>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Nuclear receptor
domain: Retinoid X receptor (RXR-alpha) DNA-binding domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 91.6 bits (227), Expect = 4e-26
 Identities = 38/71 (53%), Positives = 57/71 (80%)

Query: 63  LCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFS 122
           +C +CGD++SGKHYGV SC+GC+GFFKR++R++L Y C++   C++D  +RN+CQ CR+ 
Sbjct: 7   ICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQ 66

Query: 123 KCLQVKMNRDA 133
           KCL + M R+A
Sbjct: 67  KCLAMGMKREA 77
>d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 74 Back     information, alignment and structure
>d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 Back     information, alignment and structure
>d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query134
d1r4ia_74 Androgen receptor {Rat (Rattus norvegicus) [TaxId: 99.96
d1dszb_84 Retinoid X receptor (RXR-alpha) DNA-binding domain 99.96
d1dsza_75 Retinoic acid receptor DNA-binding domain {Human ( 99.95
d2hanb183 Ecdysone receptor DNA-binding domain {Fruit fly (D 99.95
d1lata_71 Glucocorticoid receptor DNA-binding domain {Rat (R 99.95
d1kb2a_89 Vitamin D3 receptor, VDR, DNA-binding domain {Huma 99.95
d1a6ya_78 Orphan nuclear receptor reverb DNA-binding domain 99.95
d1hcqa_74 Estrogen receptor DNA-binding domain {Human and ch 99.95
d2nllb_103 Thyroid hormone receptor (TR-beta) DNA-binding dom 99.95
d1lo1a_90 Steroid hormone receptor Err2 DNA-binding domain { 99.95
d1cita_89 Orphan nuclear receptor NGFI-B DNA-binding domain 99.94
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 82.11
>d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Nuclear receptor
domain: Androgen receptor
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.96  E-value=5.6e-32  Score=177.24  Aligned_cols=73  Identities=41%  Similarity=0.971  Sum_probs=69.9

Q ss_pred             CccceEcCcCCCceeecCccCcCCCceeeeeEecCcccceecCCceeecCCCCCCCcchhhHHHHHccCCCCC
Q psy9231          61 DVLCKVCGDKASGKHYGVPSCDGCRGFFKRSIRRNLEYVCKERGHCIVDVTRRNQCQACRFSKCLQVKMNRDA  133 (134)
Q Consensus        61 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFrRtv~~~~~~~C~~~~~C~i~~~~r~~Cr~CRf~KCl~vGM~~~a  133 (134)
                      +++|.|||+.++++||||.+|+||++||||++..+..|.|..+++|.++...|..|++|||+|||++||++||
T Consensus         2 ~~~C~VCg~~a~g~hyGv~sC~aCk~FFRR~~~~~~~~~c~~~~~C~~~~~~r~~C~~CR~~KCl~vGM~~~A   74 (74)
T d1r4ia_           2 QKTCLICGDEASGAHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGA   74 (74)
T ss_dssp             CCBCSSSCSBEEEEETTEEEEHHHHHHHHHHHTSCCCCCCSSSSCCCCCTTTTTTCHHHHHHHHHHHTCCSCC
T ss_pred             CCcCccCCCcCCccCCCHHhhHHHHHHHHHHHhcccceeeecCCCcccCCCCcccchhhhHHHHHHcCCcCCC
Confidence            4579999999999999999999999999999999999999999999999999999999999999999999987
>d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} Back     information, alignment and structure
>d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure