Psyllid ID: psy9281
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 152 | ||||||
| 328708752 | 292 | PREDICTED: probable enoyl-CoA hydratase, | 0.703 | 0.366 | 0.766 | 7e-43 | |
| 359843262 | 283 | enoyl-CoA hydratase, partial [Schistocer | 0.703 | 0.378 | 0.794 | 2e-42 | |
| 261335974 | 297 | putative enoyl-CoA hydratase precursor [ | 0.703 | 0.360 | 0.794 | 1e-41 | |
| 389608935 | 297 | cyclohex-1-ene-1-carboxyl-CoA hydratase | 0.703 | 0.360 | 0.794 | 2e-41 | |
| 308512715 | 296 | enoyl-CoA hydratase [Biston betularia] | 0.703 | 0.361 | 0.775 | 1e-40 | |
| 87248109 | 296 | enoyl-CoA hydratase precursor 1 [Bombyx | 0.703 | 0.361 | 0.785 | 2e-40 | |
| 87248113 | 278 | enoyl-CoA hydratase precursor 3 [Bombyx | 0.703 | 0.384 | 0.785 | 3e-40 | |
| 87248111 | 279 | enoyl-CoA hydratase precursor 2 [Bombyx | 0.703 | 0.383 | 0.785 | 3e-40 | |
| 242013706 | 274 | enoyl-CoA hydratase, putative [Pediculus | 0.703 | 0.390 | 0.719 | 2e-39 | |
| 322799329 | 296 | hypothetical protein SINV_11170 [Solenop | 0.703 | 0.361 | 0.728 | 3e-39 |
| >gi|328708752|ref|XP_003243793.1| PREDICTED: probable enoyl-CoA hydratase, mitochondrial-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 178 bits (451), Expect = 7e-43, Method: Compositional matrix adjust.
Identities = 82/107 (76%), Positives = 95/107 (88%)
Query: 36 LGGGCELAMMCDIIYAGEKAKFGQPEIIIGTMPGAGGTQRLTRAAGKSNAMEICLTGNQF 95
LGGGCELAMMCDIIYAGEKAKFGQPEI+IGT+PGAGGTQR+ R+ GKS AME+CL+GNQ
Sbjct: 141 LGGGCELAMMCDIIYAGEKAKFGQPEIVIGTIPGAGGTQRMIRSCGKSFAMEVCLSGNQI 200
Query: 96 TAQEAKEMGVVSKIFPPEKLLEETIKLAERIGEHSPLIVTQVKEAVN 142
+AQEA G+VSK+FPPEKL++E IKLAE+I EHSPLIV KE+VN
Sbjct: 201 SAQEALSRGLVSKVFPPEKLVDEAIKLAEKISEHSPLIVALCKESVN 247
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|359843262|gb|AEV89766.1| enoyl-CoA hydratase, partial [Schistocerca gregaria] | Back alignment and taxonomy information |
|---|
| >gi|261335974|emb|CBH09259.1| putative enoyl-CoA hydratase precursor [Heliconius melpomene] gi|261335983|emb|CBH09263.1| putative enoyl-CoA hydratase [Heliconius melpomene] | Back alignment and taxonomy information |
|---|
| >gi|389608935|dbj|BAM18079.1| cyclohex-1-ene-1-carboxyl-CoA hydratase [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|308512715|gb|ADO33011.1| enoyl-CoA hydratase [Biston betularia] | Back alignment and taxonomy information |
|---|
| >gi|87248109|gb|ABD36107.1| enoyl-CoA hydratase precursor 1 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|87248113|gb|ABD36109.1| enoyl-CoA hydratase precursor 3 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|87248111|gb|ABD36108.1| enoyl-CoA hydratase precursor 2 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|242013706|ref|XP_002427543.1| enoyl-CoA hydratase, putative [Pediculus humanus corporis] gi|212511945|gb|EEB14805.1| enoyl-CoA hydratase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|322799329|gb|EFZ20717.1| hypothetical protein SINV_11170 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 152 | ||||||
| WB|WBGene00001155 | 288 | ech-6 [Caenorhabditis elegans | 0.703 | 0.371 | 0.738 | 8.9e-38 | |
| FB|FBgn0033879 | 295 | CG6543 [Drosophila melanogaste | 0.703 | 0.362 | 0.710 | 1.9e-37 | |
| MGI|MGI:2136460 | 290 | Echs1 "enoyl Coenzyme A hydrat | 0.703 | 0.368 | 0.700 | 4.9e-37 | |
| RGD|69330 | 290 | Echs1 "enoyl CoA hydratase, sh | 0.703 | 0.368 | 0.700 | 1.7e-36 | |
| UNIPROTKB|Q58DM8 | 290 | ECHS1 "Enoyl-CoA hydratase, mi | 0.703 | 0.368 | 0.682 | 7.2e-36 | |
| UNIPROTKB|F1PAZ6 | 225 | ECHS1 "Uncharacterized protein | 0.703 | 0.475 | 0.672 | 1.9e-35 | |
| ZFIN|ZDB-GENE-030616-617 | 291 | echs1 "enoyl Coenzyme A hydrat | 0.703 | 0.367 | 0.672 | 6.5e-35 | |
| UNIPROTKB|P30084 | 290 | ECHS1 "Enoyl-CoA hydratase, mi | 0.697 | 0.365 | 0.679 | 1.1e-34 | |
| DICTYBASE|DDB_G0285071 | 277 | echs1 "enoyl-CoA hydratase" [D | 0.703 | 0.386 | 0.672 | 2.5e-33 | |
| UNIPROTKB|F1SAC1 | 289 | ECHS1 "Uncharacterized protein | 0.697 | 0.366 | 0.654 | 1.4e-32 |
| WB|WBGene00001155 ech-6 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 405 (147.6 bits), Expect = 8.9e-38, P = 8.9e-38
Identities = 79/107 (73%), Positives = 90/107 (84%)
Query: 36 LGGGCELAMMCDIIYAGEKAKFGQPEIIIGTMPGAGGTQRLTRAAGKSNAMEICLTGNQF 95
LGGG ELAMMCDIIYAGEKA+FGQPEI IGT+PGAGGTQR RAAGKS AME+CLTGN
Sbjct: 137 LGGGNELAMMCDIIYAGEKARFGQPEINIGTIPGAGGTQRWARAAGKSFAMEVCLTGNHV 196
Query: 96 TAQEAKEMGVVSKIFPPEKLLEETIKLAERIGEHSPLIVTQVKEAVN 142
TAQEAKE G+VSKIFP ++++ E +KL E+I + SPLIV KEAVN
Sbjct: 197 TAQEAKEHGIVSKIFPADQVVGEAVKLGEKIADQSPLIVQMAKEAVN 243
|
|
| FB|FBgn0033879 CG6543 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2136460 Echs1 "enoyl Coenzyme A hydratase, short chain, 1, mitochondrial" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|69330 Echs1 "enoyl CoA hydratase, short chain, 1, mitochondrial" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DM8 ECHS1 "Enoyl-CoA hydratase, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PAZ6 ECHS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030616-617 echs1 "enoyl Coenzyme A hydratase, short chain, 1, mitochondrial" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P30084 ECHS1 "Enoyl-CoA hydratase, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285071 echs1 "enoyl-CoA hydratase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SAC1 ECHS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 152 | |||
| PRK05862 | 257 | PRK05862, PRK05862, enoyl-CoA hydratase; Provision | 5e-51 | |
| pfam00378 | 245 | pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami | 2e-45 | |
| PRK08138 | 261 | PRK08138, PRK08138, enoyl-CoA hydratase; Provision | 5e-45 | |
| PRK09674 | 255 | PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; | 6e-45 | |
| cd06558 | 195 | cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme | 2e-38 | |
| COG1024 | 257 | COG1024, CaiD, Enoyl-CoA hydratase/carnithine race | 8e-37 | |
| PRK05809 | 260 | PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata | 1e-33 | |
| PRK06688 | 259 | PRK06688, PRK06688, enoyl-CoA hydratase; Provision | 4e-33 | |
| PRK05980 | 260 | PRK05980, PRK05980, enoyl-CoA hydratase; Provision | 8e-32 | |
| PRK07657 | 260 | PRK07657, PRK07657, enoyl-CoA hydratase; Provision | 3e-31 | |
| PRK07658 | 257 | PRK07658, PRK07658, enoyl-CoA hydratase; Provision | 1e-29 | |
| PRK08252 | 254 | PRK08252, PRK08252, enoyl-CoA hydratase; Provision | 4e-29 | |
| PRK06494 | 259 | PRK06494, PRK06494, enoyl-CoA hydratase; Provision | 6e-28 | |
| PLN02600 | 251 | PLN02600, PLN02600, enoyl-CoA hydratase | 4e-26 | |
| PRK03580 | 261 | PRK03580, PRK03580, carnitinyl-CoA dehydratase; Pr | 5e-26 | |
| PRK09245 | 266 | PRK09245, PRK09245, enoyl-CoA hydratase; Provision | 1e-25 | |
| PRK06563 | 255 | PRK06563, PRK06563, enoyl-CoA hydratase; Provision | 3e-24 | |
| COG0447 | 282 | COG0447, MenB, Dihydroxynaphthoic acid synthase [C | 9e-23 | |
| PRK06190 | 258 | PRK06190, PRK06190, enoyl-CoA hydratase; Provision | 5e-22 | |
| PLN02664 | 275 | PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-d | 7e-22 | |
| TIGR01929 | 259 | TIGR01929, menB, naphthoate synthase (dihydroxynap | 1e-21 | |
| PRK11730 | 715 | PRK11730, fadB, multifunctional fatty acid oxidati | 6e-21 | |
| PRK06127 | 269 | PRK06127, PRK06127, enoyl-CoA hydratase; Provision | 2e-20 | |
| PRK08290 | 288 | PRK08290, PRK08290, enoyl-CoA hydratase; Provision | 2e-20 | |
| PRK07799 | 263 | PRK07799, PRK07799, enoyl-CoA hydratase; Provision | 2e-20 | |
| PRK11154 | 708 | PRK11154, fadJ, multifunctional fatty acid oxidati | 3e-20 | |
| PRK07396 | 273 | PRK07396, PRK07396, dihydroxynaphthoic acid synthe | 6e-20 | |
| PRK06495 | 257 | PRK06495, PRK06495, enoyl-CoA hydratase; Provision | 1e-19 | |
| PRK08139 | 266 | PRK08139, PRK08139, enoyl-CoA hydratase; Validated | 4e-19 | |
| TIGR02440 | 699 | TIGR02440, FadJ, fatty oxidation complex, alpha su | 5e-19 | |
| PRK06142 | 272 | PRK06142, PRK06142, enoyl-CoA hydratase; Provision | 5e-19 | |
| PRK05869 | 222 | PRK05869, PRK05869, enoyl-CoA hydratase; Validated | 7e-19 | |
| PRK09076 | 258 | PRK09076, PRK09076, enoyl-CoA hydratase; Provision | 7e-19 | |
| PRK05981 | 266 | PRK05981, PRK05981, enoyl-CoA hydratase; Provision | 2e-17 | |
| PLN02921 | 327 | PLN02921, PLN02921, naphthoate synthase | 1e-16 | |
| TIGR02441 | 737 | TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c | 2e-16 | |
| TIGR03210 | 256 | TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hyd | 2e-16 | |
| TIGR02437 | 714 | TIGR02437, FadB, fatty oxidation complex, alpha su | 3e-16 | |
| PRK08788 | 287 | PRK08788, PRK08788, enoyl-CoA hydratase; Validated | 6e-16 | |
| PLN02888 | 265 | PLN02888, PLN02888, enoyl-CoA hydratase | 2e-15 | |
| PRK05995 | 262 | PRK05995, PRK05995, enoyl-CoA hydratase; Provision | 2e-15 | |
| PRK07938 | 249 | PRK07938, PRK07938, enoyl-CoA hydratase; Provision | 2e-15 | |
| TIGR02280 | 256 | TIGR02280, PaaB1, phenylacetate degradation probab | 3e-15 | |
| PRK08321 | 302 | PRK08321, PRK08321, naphthoate synthase; Validated | 7e-15 | |
| PRK07511 | 260 | PRK07511, PRK07511, enoyl-CoA hydratase; Provision | 8e-15 | |
| PRK06210 | 272 | PRK06210, PRK06210, enoyl-CoA hydratase; Provision | 8e-15 | |
| PRK09120 | 275 | PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydrata | 1e-14 | |
| PRK08260 | 296 | PRK08260, PRK08260, enoyl-CoA hydratase; Provision | 3e-14 | |
| PRK08259 | 254 | PRK08259, PRK08259, enoyl-CoA hydratase; Provision | 4e-14 | |
| PRK11423 | 261 | PRK11423, PRK11423, methylmalonyl-CoA decarboxylas | 4e-14 | |
| PRK05864 | 276 | PRK05864, PRK05864, enoyl-CoA hydratase; Provision | 4e-14 | |
| PRK05870 | 249 | PRK05870, PRK05870, enoyl-CoA hydratase; Provision | 7e-14 | |
| PRK08140 | 262 | PRK08140, PRK08140, enoyl-CoA hydratase; Provision | 2e-13 | |
| PRK08150 | 255 | PRK08150, PRK08150, enoyl-CoA hydratase; Provision | 3e-13 | |
| PRK06143 | 256 | PRK06143, PRK06143, enoyl-CoA hydratase; Provision | 4e-13 | |
| PRK07260 | 255 | PRK07260, PRK07260, enoyl-CoA hydratase; Provision | 6e-13 | |
| PRK06144 | 262 | PRK06144, PRK06144, enoyl-CoA hydratase; Provision | 7e-13 | |
| PRK08272 | 302 | PRK08272, PRK08272, enoyl-CoA hydratase; Provision | 6e-11 | |
| PRK06023 | 251 | PRK06023, PRK06023, enoyl-CoA hydratase; Provision | 1e-10 | |
| PRK07509 | 262 | PRK07509, PRK07509, enoyl-CoA hydratase; Provision | 7e-10 | |
| PRK07468 | 262 | PRK07468, PRK07468, enoyl-CoA hydratase; Provision | 1e-08 | |
| PRK08258 | 277 | PRK08258, PRK08258, enoyl-CoA hydratase; Provision | 3e-08 | |
| TIGR03200 | 360 | TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-car | 3e-07 | |
| TIGR03189 | 251 | TIGR03189, dienoyl_CoA_hyt, cyclohexa-1,5-dienecar | 4e-07 | |
| PRK06072 | 248 | PRK06072, PRK06072, enoyl-CoA hydratase; Provision | 2e-06 | |
| PRK07854 | 243 | PRK07854, PRK07854, enoyl-CoA hydratase; Provision | 3e-06 | |
| TIGR03222 | 546 | TIGR03222, benzo_boxC, benzoyl-CoA-dihydrodiol lya | 5e-06 | |
| PRK07827 | 260 | PRK07827, PRK07827, enoyl-CoA hydratase; Provision | 1e-05 | |
| PRK07110 | 249 | PRK07110, PRK07110, polyketide biosynthesis enoyl- | 1e-05 | |
| PRK08184 | 550 | PRK08184, PRK08184, benzoyl-CoA-dihydrodiol lyase; | 2e-05 | |
| PRK07659 | 260 | PRK07659, PRK07659, enoyl-CoA hydratase; Provision | 2e-05 | |
| PLN03214 | 278 | PLN03214, PLN03214, probable enoyl-CoA hydratase/i | 5e-05 | |
| PRK12478 | 298 | PRK12478, PRK12478, enoyl-CoA hydratase; Provision | 5e-05 | |
| PRK05674 | 265 | PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydr | 6e-05 | |
| PRK07327 | 268 | PRK07327, PRK07327, enoyl-CoA hydratase; Provision | 2e-04 | |
| PRK07112 | 255 | PRK07112, PRK07112, polyketide biosynthesis enoyl- | 2e-04 | |
| PLN02988 | 381 | PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrol | 0.002 | |
| PLN02267 | 239 | PLN02267, PLN02267, enoyl-CoA hydratase/isomerase | 0.002 |
| >gnl|CDD|180295 PRK05862, PRK05862, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
Score = 162 bits (413), Expect = 5e-51
Identities = 62/107 (57%), Positives = 76/107 (71%)
Query: 36 LGGGCELAMMCDIIYAGEKAKFGQPEIIIGTMPGAGGTQRLTRAAGKSNAMEICLTGNQF 95
LGGGCELAMMCDII A + AKFGQPEI +G +PG GG+QRLTRA GK+ AM++CLTG
Sbjct: 106 LGGGCELAMMCDIIIAADTAKFGQPEIKLGVLPGMGGSQRLTRAVGKAKAMDLCLTGRMM 165
Query: 96 TAQEAKEMGVVSKIFPPEKLLEETIKLAERIGEHSPLIVTQVKEAVN 142
A EA+ G+VS++ P +KLL+E + A I S V KEAVN
Sbjct: 166 DAAEAERAGLVSRVVPADKLLDEALAAATTIASFSLPAVMMAKEAVN 212
|
Length = 257 |
| >gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family | Back alignment and domain information |
|---|
| >gnl|CDD|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182026 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181325 PRK08252, PRK08252, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178210 PLN02600, PLN02600, enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >gnl|CDD|179599 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180625 PRK06563, PRK06563, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223524 COG0447, MenB, Dihydroxynaphthoic acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178269 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|200143 TIGR01929, menB, naphthoate synthase (dihydroxynaphthoic acid synthetase) | Back alignment and domain information |
|---|
| >gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236220 PRK08290, PRK08290, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181122 PRK07799, PRK07799, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236864 PRK11154, fadJ, multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180958 PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168580 PRK06495, PRK06495, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181249 PRK08139, PRK08139, enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|131493 TIGR02440, FadJ, fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >gnl|CDD|235714 PRK06142, PRK06142, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235632 PRK05869, PRK05869, enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236373 PRK09076, PRK09076, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235661 PRK05981, PRK05981, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178509 PLN02921, PLN02921, naphthoate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >gnl|CDD|132254 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >gnl|CDD|236338 PRK08788, PRK08788, enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215480 PLN02888, PLN02888, enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181174 PRK07938, PRK07938, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB | Back alignment and domain information |
|---|
| >gnl|CDD|181386 PRK08321, PRK08321, naphthoate synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181009 PRK07511, PRK07511, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180472 PRK06210, PRK06210, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236383 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydratase/lyase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236206 PRK08260, PRK08260, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236205 PRK08259, PRK08259, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236908 PRK11423, PRK11423, methylmalonyl-CoA decarboxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168278 PRK05864, PRK05864, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180298 PRK05870, PRK05870, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236163 PRK08140, PRK08140, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181254 PRK08150, PRK08150, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180423 PRK06143, PRK06143, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180910 PRK07260, PRK07260, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180424 PRK06144, PRK06144, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236213 PRK08272, PRK08272, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168351 PRK06023, PRK06023, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181008 PRK07509, PRK07509, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180987 PRK07468, PRK07468, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132244 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|132233 TIGR03189, dienoyl_CoA_hyt, cyclohexa-1,5-dienecarbonyl-CoA hydratase | Back alignment and domain information |
|---|
| >gnl|CDD|168377 PRK06072, PRK06072, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236115 PRK07854, PRK07854, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213787 TIGR03222, benzo_boxC, benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >gnl|CDD|236109 PRK07827, PRK07827, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235936 PRK07110, PRK07110, polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181274 PRK08184, PRK08184, benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236073 PRK07659, PRK07659, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215635 PLN03214, PLN03214, probable enoyl-CoA hydratase/isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183548 PRK12478, PRK12478, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168168 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235991 PRK07327, PRK07327, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235938 PRK07112, PRK07112, polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|178568 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|215151 PLN02267, PLN02267, enoyl-CoA hydratase/isomerase family protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 152 | |||
| KOG1680|consensus | 290 | 100.0 | ||
| PRK08150 | 255 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK09076 | 258 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06143 | 256 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PLN02600 | 251 | enoyl-CoA hydratase | 100.0 | |
| PRK05862 | 257 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06494 | 259 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08252 | 254 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK05980 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK05869 | 222 | enoyl-CoA hydratase; Validated | 100.0 | |
| PRK06190 | 258 | enoyl-CoA hydratase; Provisional | 99.98 | |
| PRK07657 | 260 | enoyl-CoA hydratase; Provisional | 99.98 | |
| PRK05809 | 260 | 3-hydroxybutyryl-CoA dehydratase; Validated | 99.98 | |
| PRK06563 | 255 | enoyl-CoA hydratase; Provisional | 99.98 | |
| PRK09674 | 255 | enoyl-CoA hydratase-isomerase; Provisional | 99.98 | |
| PRK03580 | 261 | carnitinyl-CoA dehydratase; Provisional | 99.98 | |
| PRK07658 | 257 | enoyl-CoA hydratase; Provisional | 99.98 | |
| TIGR02280 | 256 | PaaB1 phenylacetate degradation probable enoyl-CoA | 99.98 | |
| PRK09120 | 275 | p-hydroxycinnamoyl CoA hydratase/lyase; Validated | 99.98 | |
| PRK08138 | 261 | enoyl-CoA hydratase; Provisional | 99.98 | |
| PRK06144 | 262 | enoyl-CoA hydratase; Provisional | 99.98 | |
| PRK06127 | 269 | enoyl-CoA hydratase; Provisional | 99.98 | |
| TIGR03210 | 256 | badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb | 99.98 | |
| PRK08259 | 254 | enoyl-CoA hydratase; Provisional | 99.98 | |
| PLN02888 | 265 | enoyl-CoA hydratase | 99.98 | |
| PRK09245 | 266 | enoyl-CoA hydratase; Provisional | 99.98 | |
| PRK07260 | 255 | enoyl-CoA hydratase; Provisional | 99.98 | |
| PRK07799 | 263 | enoyl-CoA hydratase; Provisional | 99.98 | |
| TIGR01929 | 259 | menB naphthoate synthase (dihydroxynaphthoic acid | 99.97 | |
| PRK06142 | 272 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK08140 | 262 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK07110 | 249 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 99.97 | |
| PRK08139 | 266 | enoyl-CoA hydratase; Validated | 99.97 | |
| PF00378 | 245 | ECH: Enoyl-CoA hydratase/isomerase family; InterPr | 99.97 | |
| PRK07659 | 260 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK07511 | 260 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK05674 | 265 | gamma-carboxygeranoyl-CoA hydratase; Validated | 99.97 | |
| PLN02664 | 275 | enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA | 99.97 | |
| PRK06688 | 259 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK06023 | 251 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK07327 | 268 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK05995 | 262 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK08258 | 277 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK11423 | 261 | methylmalonyl-CoA decarboxylase; Provisional | 99.97 | |
| PRK07396 | 273 | dihydroxynaphthoic acid synthetase; Validated | 99.97 | |
| PRK05870 | 249 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK05981 | 266 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PLN03214 | 278 | probable enoyl-CoA hydratase/isomerase; Provisiona | 99.97 | |
| PRK06210 | 272 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK06213 | 229 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK08260 | 296 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK05864 | 276 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK07468 | 262 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PLN02921 | 327 | naphthoate synthase | 99.97 | |
| PRK07938 | 249 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK06495 | 257 | enoyl-CoA hydratase; Provisional | 99.97 | |
| TIGR03189 | 251 | dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy | 99.97 | |
| COG1024 | 257 | CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi | 99.97 | |
| PRK08321 | 302 | naphthoate synthase; Validated | 99.97 | |
| PRK07509 | 262 | enoyl-CoA hydratase; Provisional | 99.97 | |
| PRK08788 | 287 | enoyl-CoA hydratase; Validated | 99.96 | |
| PRK06072 | 248 | enoyl-CoA hydratase; Provisional | 99.96 | |
| PRK07854 | 243 | enoyl-CoA hydratase; Provisional | 99.96 | |
| PRK08290 | 288 | enoyl-CoA hydratase; Provisional | 99.96 | |
| PRK05617 | 342 | 3-hydroxyisobutyryl-CoA hydrolase; Provisional | 99.96 | |
| PRK08272 | 302 | enoyl-CoA hydratase; Provisional | 99.96 | |
| PRK07827 | 260 | enoyl-CoA hydratase; Provisional | 99.96 | |
| PRK07112 | 255 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 99.96 | |
| KOG1679|consensus | 291 | 99.95 | ||
| PLN02874 | 379 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 99.95 | |
| PRK12478 | 298 | enoyl-CoA hydratase; Provisional | 99.95 | |
| PLN02267 | 239 | enoyl-CoA hydratase/isomerase family protein | 99.95 | |
| PLN02157 | 401 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 99.95 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 99.95 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 99.95 | |
| TIGR03200 | 360 | dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy | 99.95 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 99.94 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 99.94 | |
| PLN02988 | 381 | 3-hydroxyisobutyryl-CoA hydrolase | 99.94 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 99.94 | |
| KOG0016|consensus | 266 | 99.93 | ||
| KOG1681|consensus | 292 | 99.92 | ||
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 99.91 | |
| cd06558 | 195 | crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy | 99.91 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 99.91 | |
| PLN02851 | 407 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 99.91 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 99.91 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 99.91 | |
| KOG1682|consensus | 287 | 99.87 | ||
| COG0447 | 282 | MenB Dihydroxynaphthoic acid synthase [Coenzyme me | 99.83 | |
| KOG1684|consensus | 401 | 99.75 | ||
| cd07020 | 187 | Clp_protease_NfeD_1 Nodulation formation efficienc | 99.52 | |
| cd07014 | 177 | S49_SppA Signal peptide peptidase A. Signal peptid | 99.37 | |
| cd07016 | 160 | S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- | 99.14 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 98.68 | |
| cd00394 | 161 | Clp_protease_like Caseinolytic protease (ClpP) is | 98.62 | |
| cd07021 | 178 | Clp_protease_NfeD_like Nodulation formation effici | 98.35 | |
| cd07019 | 211 | S49_SppA_1 Signal peptide peptidase A (SppA), a se | 98.3 | |
| TIGR00706 | 207 | SppA_dom signal peptide peptidase SppA, 36K type. | 98.19 | |
| cd07023 | 208 | S49_Sppa_N_C Signal peptide peptidase A (SppA), a | 98.08 | |
| cd07022 | 214 | S49_Sppa_36K_type Signal peptide peptidase A (SppA | 97.96 | |
| cd07015 | 172 | Clp_protease_NfeD Nodulation formation efficiency | 97.94 | |
| PRK00277 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 97.89 | |
| CHL00198 | 322 | accA acetyl-CoA carboxylase carboxyltransferase al | 97.75 | |
| PRK12553 | 207 | ATP-dependent Clp protease proteolytic subunit; Re | 97.73 | |
| cd07013 | 162 | S14_ClpP Caseinolytic protease (ClpP) is an ATP-de | 97.63 | |
| PRK12319 | 256 | acetyl-CoA carboxylase subunit alpha; Provisional | 97.63 | |
| PLN03230 | 431 | acetyl-coenzyme A carboxylase carboxyl transferase | 97.61 | |
| PRK14512 | 197 | ATP-dependent Clp protease proteolytic subunit; Pr | 97.58 | |
| CHL00028 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 97.56 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 97.47 | |
| TIGR00493 | 191 | clpP ATP-dependent Clp protease, proteolytic subun | 97.41 | |
| cd07018 | 222 | S49_SppA_67K_type Signal peptide peptidase A (SppA | 97.38 | |
| PF00574 | 182 | CLP_protease: Clp protease; InterPro: IPR001907 In | 97.36 | |
| cd07017 | 171 | S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- | 97.31 | |
| PRK14514 | 221 | ATP-dependent Clp protease proteolytic subunit; Pr | 97.2 | |
| PRK14513 | 201 | ATP-dependent Clp protease proteolytic subunit; Pr | 97.18 | |
| TIGR00513 | 316 | accA acetyl-CoA carboxylase, carboxyl transferase, | 97.12 | |
| PRK05724 | 319 | acetyl-CoA carboxylase carboxyltransferase subunit | 97.09 | |
| PRK12551 | 196 | ATP-dependent Clp protease proteolytic subunit; Re | 96.95 | |
| PRK12552 | 222 | ATP-dependent Clp protease-like protein; Reviewed | 96.29 | |
| TIGR03133 | 274 | malonate_beta malonate decarboxylase, beta subunit | 96.04 | |
| PF01343 | 154 | Peptidase_S49: Peptidase family S49 peptidase clas | 95.96 | |
| PRK05654 | 292 | acetyl-CoA carboxylase subunit beta; Validated | 95.96 | |
| PF01972 | 285 | SDH_sah: Serine dehydrogenase proteinase; InterPro | 95.85 | |
| TIGR00515 | 285 | accD acetyl-CoA carboxylase, carboxyl transferase, | 95.59 | |
| PRK11778 | 330 | putative inner membrane peptidase; Provisional | 95.49 | |
| PRK10949 | 618 | protease 4; Provisional | 95.37 | |
| CHL00174 | 296 | accD acetyl-CoA carboxylase beta subunit; Reviewed | 95.02 | |
| COG0825 | 317 | AccA Acetyl-CoA carboxylase alpha subunit [Lipid m | 94.88 | |
| COG0740 | 200 | ClpP Protease subunit of ATP-dependent Clp proteas | 94.81 | |
| COG0616 | 317 | SppA Periplasmic serine proteases (ClpP class) [Po | 94.7 | |
| TIGR03134 | 238 | malonate_gamma malonate decarboxylase, gamma subun | 94.14 | |
| PRK07189 | 301 | malonate decarboxylase subunit beta; Reviewed | 93.97 | |
| PF01039 | 493 | Carboxyl_trans: Carboxyl transferase domain; Inter | 93.91 | |
| KOG1683|consensus | 380 | 93.85 | ||
| COG1030 | 436 | NfeD Membrane-bound serine protease (ClpP class) [ | 92.14 | |
| KOG0840|consensus | 275 | 91.86 | ||
| TIGR01117 | 512 | mmdA methylmalonyl-CoA decarboxylase alpha subunit | 90.36 | |
| TIGR01117 | 512 | mmdA methylmalonyl-CoA decarboxylase alpha subunit | 89.96 | |
| cd07019 | 211 | S49_SppA_1 Signal peptide peptidase A (SppA), a se | 85.29 | |
| smart00250 | 38 | PLEC Plectin repeat. | 84.22 | |
| COG0777 | 294 | AccD Acetyl-CoA carboxylase beta subunit [Lipid me | 83.83 | |
| PLN02820 | 569 | 3-methylcrotonyl-CoA carboxylase, beta chain | 83.28 | |
| COG4799 | 526 | Acetyl-CoA carboxylase, carboxyltransferase compon | 80.92 | |
| PF00681 | 45 | Plectin: Plectin repeat; InterPro: IPR001101 Plect | 80.18 |
| >KOG1680|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4e-34 Score=218.72 Aligned_cols=143 Identities=49% Similarity=0.727 Sum_probs=130.7
Q ss_pred ccccccCCCCCCcchhhhhhhchhhh-----hhhh----------------hhchHHHHHHHHcCeeEecCCeEEecccc
Q psy9281 4 FEKLFILIDYEQKDLYRSKNLKFIQC-----LKIW----------------IYLGGGCELAMMCDIIYAGEKAKFGQPEI 62 (152)
Q Consensus 4 ~~k~Fs~~~caG~Dl~~~~~~~~~~~-----~~~~----------------~a~G~G~~lal~cD~ria~~~a~f~~pe~ 62 (152)
.+|.|| +|.||+++......+. ...| +|+|||++|++.||+|||+++++|++|+.
T Consensus 90 ~gksFc----sG~Dl~e~~~~~~~~~~~~~~~~~~~~~~~~~KPvIaainG~AlgGG~ELalmCDirva~~~Akfg~~~~ 165 (290)
T KOG1680|consen 90 SGKSFC----SGADLKEMKKDEFQDVSDGIFLRVWDLVSRLKKPVIAAINGFALGGGLELALMCDIRVAGEGAKFGFFEI 165 (290)
T ss_pred CCCccc----cccCHHHHhhccccccccccccchhhhhhhcccceeEeeeceeeccchhhhhhcceEeccCCCeeccccc
Confidence 468999 9999999987554433 1111 99999999999999999999999999999
Q ss_pred cccccCCccHHHHHHHHhCHHHHHHHHHcCCCCCHHHHHHcCCccccCCcchHHHHHHHHHHHHhcCCHHHHHHHHHHHh
Q psy9281 63 IIGTMPGAGGTQRLTRAAGKSNAMEICLTGNQFTAQEAKEMGVVSKIFPPEKLLEETIKLAERIGEHSPLIVTQVKEAVN 142 (152)
Q Consensus 63 ~~G~~p~~~~~~~l~~~~g~~~a~~lll~g~~~~a~ea~~~Glv~~v~~~~~l~~~~~~~a~~l~~~~~~a~~~~K~~l~ 142 (152)
++|++|.+|++.+|++.+|.++|++++++|++++++||.++||||+|+|.+++..++.++++.|++.||.+++..|+.+|
T Consensus 166 ~~Gi~p~~GGT~rl~r~vG~s~Ale~~ltg~~~~AqeA~~~GlVn~Vvp~~~~l~eAv~l~~~Ia~~~~~~v~~~K~svn 245 (290)
T KOG1680|consen 166 RMGIIPSWGGTQRLPRIVGKSRALEMILTGRRLGAQEAKKIGLVNKVVPSGDALGEAVKLAEQIAKNSPLVVRADKESVN 245 (290)
T ss_pred ccCCccCCCchhhHHHHhChHHHHHHHHhcCcccHHHHHhCCceeEeecchhHHHHHHHHHHHHHhCCHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccCCCC
Q psy9281 143 IDDTEGLN 150 (152)
Q Consensus 143 ~~~~~~l~ 150 (152)
..++..+.
T Consensus 246 ~~~e~~l~ 253 (290)
T KOG1680|consen 246 AAYETTLF 253 (290)
T ss_pred HHhhccHH
Confidence 87766543
|
|
| >PRK08150 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09076 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06143 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02600 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK05862 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06494 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08252 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05980 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05869 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK06190 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07657 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK06563 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09674 enoyl-CoA hydratase-isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK03580 carnitinyl-CoA dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07658 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB | Back alignment and domain information |
|---|
| >PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated | Back alignment and domain information |
|---|
| >PRK08138 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06144 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06127 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK08259 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02888 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK09245 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07799 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) | Back alignment and domain information |
|---|
| >PRK06142 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08140 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK08139 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix | Back alignment and domain information |
|---|
| >PRK07659 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07511 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase | Back alignment and domain information |
|---|
| >PRK06688 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06023 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07327 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05995 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08258 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11423 methylmalonyl-CoA decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07396 dihydroxynaphthoic acid synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05870 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05981 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06210 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06213 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05864 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07468 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02921 naphthoate synthase | Back alignment and domain information |
|---|
| >PRK07938 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06495 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase | Back alignment and domain information |
|---|
| >COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK08321 naphthoate synthase; Validated | Back alignment and domain information |
|---|
| >PRK07509 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08788 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK06072 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07854 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08290 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08272 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07827 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >KOG1679|consensus | Back alignment and domain information |
|---|
| >PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PRK12478 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02267 enoyl-CoA hydratase/isomerase family protein | Back alignment and domain information |
|---|
| >PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PLN02988 3-hydroxyisobutyryl-CoA hydrolase | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >KOG0016|consensus | Back alignment and domain information |
|---|
| >KOG1681|consensus | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >KOG1682|consensus | Back alignment and domain information |
|---|
| >COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG1684|consensus | Back alignment and domain information |
|---|
| >cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd07014 S49_SppA Signal peptide peptidase A | Back alignment and domain information |
|---|
| >cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease | Back alignment and domain information |
|---|
| >cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type | Back alignment and domain information |
|---|
| >cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00028 clpP ATP-dependent Clp protease proteolytic subunit | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP | Back alignment and domain information |
|---|
| >cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit | Back alignment and domain information |
|---|
| >PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12552 ATP-dependent Clp protease-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03133 malonate_beta malonate decarboxylase, beta subunit | Back alignment and domain information |
|---|
| >PF01343 Peptidase_S49: Peptidase family S49 peptidase classification | Back alignment and domain information |
|---|
| >PRK05654 acetyl-CoA carboxylase subunit beta; Validated | Back alignment and domain information |
|---|
| >PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily | Back alignment and domain information |
|---|
| >TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit | Back alignment and domain information |
|---|
| >PRK11778 putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
| >CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed | Back alignment and domain information |
|---|
| >COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit | Back alignment and domain information |
|---|
| >PRK07189 malonate decarboxylase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] | Back alignment and domain information |
|---|
| >KOG1683|consensus | Back alignment and domain information |
|---|
| >COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0840|consensus | Back alignment and domain information |
|---|
| >TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >smart00250 PLEC Plectin repeat | Back alignment and domain information |
|---|
| >COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain | Back alignment and domain information |
|---|
| >COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF00681 Plectin: Plectin repeat; InterPro: IPR001101 Plectin may have a role in cross-linking intermediate filaments, in inter-linking intermediate filaments with microtubules and microfilaments and in anchoring intermediate filaments to the plasma and nuclear membranes | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 152 | ||||
| 1dub_A | 261 | 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph | 1e-39 | ||
| 1mj3_A | 260 | Crystal Structure Analysis Of Rat Enoyl-Coa Hydrata | 1e-39 | ||
| 1ey3_A | 258 | Structure Of Enoyl-Coa Hydratase Complexed With The | 1e-39 | ||
| 2hw5_A | 286 | The Crystal Structure Of Human Enoyl-Coenzyme A (Co | 8e-39 | ||
| 3moy_A | 263 | Crystal Structure Of Probable Enoyl-Coa Hydratase F | 8e-32 | ||
| 4fzw_A | 258 | Crystal Structure Of The Paaf-paag Hydratase-isomer | 4e-30 | ||
| 3q0j_A | 258 | Crystal Structure Of The Mycobacterium Tuberculosis | 3e-28 | ||
| 3pzk_A | 257 | Crystal Structure Of The Mycobacterium Tuberculosis | 3e-28 | ||
| 3h81_A | 278 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 4e-28 | ||
| 2pbp_A | 258 | Crystal Structure Of Enoyl-Coa Hydrates Subunit I ( | 2e-27 | ||
| 3kqf_A | 265 | 1.8 Angstrom Resolution Crystal Structure Of Enoyl- | 3e-20 | ||
| 2ppy_A | 265 | Crystal Structure Of Enoyl-Coa Hydrates (Gk_1992) F | 1e-18 | ||
| 3pea_A | 261 | Crystal Structure Of Enoyl-Coa Hydratase From Bacil | 1e-17 | ||
| 2iex_A | 272 | Crystal Structure Of Dihydroxynapthoic Acid Synthet | 2e-17 | ||
| 3rsi_A | 265 | The Structure Of A Putative Enoyl-Coa HydrataseISOM | 4e-17 | ||
| 3trr_A | 256 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 5e-16 | ||
| 4eml_A | 275 | Synechocystis Sp. Pcc 6803 1,4-Dihydroxy-2-Naphthoy | 8e-16 | ||
| 3r0o_A | 273 | Crystal Structure Of Carnitinyl-Coa Hydratase From | 2e-15 | ||
| 2uzf_A | 273 | Crystal Structure Of Staphylococcus Aureus 1,4-Dihy | 3e-15 | ||
| 3t88_A | 289 | Crystal Structure Of Escherichia Coli Menb In Compl | 4e-14 | ||
| 4els_A | 285 | Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Co | 4e-14 | ||
| 1uiy_A | 253 | Crystal Structure Of Enoyl-Coa Hydratase From Therm | 2e-13 | ||
| 3swx_A | 265 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 2e-13 | ||
| 4di1_A | 277 | Crystal Structure Of Enoyl-Coa Hydratase Echa17 Fro | 6e-13 | ||
| 3h0u_A | 289 | Crystal Structure Of A Putative Enoyl-Coa Hydratase | 8e-13 | ||
| 2vx2_A | 287 | Crystal Structure Of Human Enoyl Coenzyme A Hydrata | 4e-12 | ||
| 3h02_A | 288 | 2.15 Angstrom Resolution Crystal Structure Of Napht | 1e-11 | ||
| 4f47_A | 278 | The Structure Of Enoyl-Coa Hydratase Echa19 From My | 1e-11 | ||
| 3lao_A | 258 | Crystal Structure Of Enoyl-Coa Hydratase From Pseud | 3e-11 | ||
| 4fzw_C | 274 | Crystal Structure Of The Paaf-paag Hydratase-isomer | 3e-11 | ||
| 3t3w_A | 279 | Crystal Structure Of Probable Enoyl-Coa Hydratase F | 4e-11 | ||
| 2gtr_A | 261 | Human Chromodomain Y-Like Protein Length = 261 | 5e-11 | ||
| 2wtb_A | 725 | Arabidopsis Thaliana Multifuctional Protein, Mfp2 L | 1e-10 | ||
| 3pe8_A | 256 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 1e-10 | ||
| 1wdk_A | 715 | Fatty Acid Beta-Oxidation Multienzyme Complex From | 2e-10 | ||
| 3r9s_A | 267 | Structure Of A Carnitinyl-Coa Dehydratase From Myco | 2e-10 | ||
| 3r9t_A | 267 | Structure Of Echa1_1 From Mycobacterium Paratubercu | 2e-10 | ||
| 2vss_E | 276 | Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C | 3e-10 | ||
| 1dci_A | 275 | Dienoyl-Coa Isomerase Length = 275 | 3e-10 | ||
| 1ef8_A | 261 | Crystal Structure Of Methylmalonyl Coa Decarboxylas | 3e-10 | ||
| 2j5i_B | 276 | Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase | 3e-10 | ||
| 2vss_F | 276 | Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C | 3e-10 | ||
| 2j5i_I | 276 | Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase | 3e-10 | ||
| 2j5i_A | 276 | Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase | 4e-10 | ||
| 2vsu_E | 276 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 4e-10 | ||
| 2vsu_A | 276 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 4e-10 | ||
| 2vsu_F | 276 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 4e-10 | ||
| 2vsu_C | 275 | A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase | 4e-10 | ||
| 3ome_A | 282 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 4e-10 | ||
| 3gkb_A | 287 | Crystal Structure Of A Putative Enoyl-coa Hydratase | 4e-10 | ||
| 3qyr_A | 253 | Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 M | 5e-10 | ||
| 3p85_A | 270 | Crystal Structure Enoyl-Coa Hydratase From Mycobact | 5e-10 | ||
| 2fbm_A | 291 | Acetyltransferase Domain Of Cdy1 Length = 291 | 6e-10 | ||
| 1rjm_A | 339 | Crystal Structure Of Menb (rv0548c) From Mycobacter | 1e-09 | ||
| 1q51_A | 314 | Crystal Structure Of Mycobacterium Tuberculosis Men | 1e-09 | ||
| 3t8a_A | 334 | Crystal Structure Of Mycobacterium Tuberculosis Men | 1e-09 | ||
| 2vre_A | 296 | Crystal Structure Of Human Peroxisomal Delta3,5, De | 1e-09 | ||
| 2x58_A | 727 | The Crystal Structure Of Mfe1 Liganded With Coa Len | 1e-09 | ||
| 3zw8_A | 742 | Crystal Structure Of Rat Peroxisomal Multifunctiona | 1e-09 | ||
| 3hrx_A | 254 | Crystal Structure Of Phenylacetic Acid Degradation | 2e-09 | ||
| 3sll_A | 290 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 3e-09 | ||
| 2fw2_A | 260 | Catalytic Domain Of Cdy Length = 260 | 5e-09 | ||
| 3zwb_A | 742 | Crystal Structure Of Rat Peroxisomal Multifunctiona | 6e-09 | ||
| 3tlf_A | 274 | Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS | 7e-09 | ||
| 1hzd_A | 272 | Crystal Structure Of Human Auh Protein, An Rna-Bind | 2e-08 | ||
| 3qxz_A | 265 | Crystal Structure Of A Probable Enoyl-Coa Hydratase | 2e-08 | ||
| 3myb_A | 286 | Crystal Structure Of Enoyl-Coa Hydratase Mycobacter | 5e-08 | ||
| 3m6m_A | 305 | Crystal Structure Of Rpff Complexed With Rec Domain | 8e-08 | ||
| 1nzy_A | 269 | 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo | 3e-07 | ||
| 1jxz_A | 269 | Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coe | 4e-07 | ||
| 1nzy_B | 269 | 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo | 4e-07 | ||
| 2ej5_A | 257 | Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydr | 4e-07 | ||
| 3rrv_A | 276 | Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS | 8e-07 | ||
| 3hin_A | 275 | Crystal Structure Of Putative Enoyl-Coa Hydratase F | 1e-06 | ||
| 3qka_A | 261 | Crystal Structure Of Enoyl-Coa Hydratase Echa5 From | 1e-06 | ||
| 3qxi_A | 265 | Crystal Structure Of Enoyl-Coa Hydratase Echa1 From | 1e-06 | ||
| 3njb_A | 333 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 1e-06 | ||
| 3i47_A | 268 | Crystal Structure Of Putative Enoyl Coa HydrataseIS | 2e-06 | ||
| 3lke_A | 263 | Crystal Structure Of Enoyl-Coa Hydratase From Bacil | 3e-06 | ||
| 1o8u_A | 257 | The 2 Angstrom Structure Of 6-oxo Camphor Hydrolase | 3e-06 | ||
| 1szo_A | 257 | Crystal Structure Analysis Of The 6-Oxo Camphor Hyd | 3e-06 | ||
| 3r9q_A | 262 | Structure Of A Probable Enoyl-Coa HydrataseISOMERAS | 5e-06 | ||
| 2j5g_D | 263 | The Native Structure Of A Beta-Diketone Hydrolase F | 8e-06 | ||
| 2j5g_A | 263 | The Native Structure Of A Beta-Diketone Hydrolase F | 9e-06 | ||
| 3qmj_A | 256 | Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 Fr | 2e-05 | ||
| 2pg8_A | 417 | Crystal Structure Of R254k Mutanat Of Dpgc With Bou | 2e-05 | ||
| 3qre_A | 298 | Crystal Structure Of An Enoyl-Coa Hydratase Echa12_ | 3e-05 | ||
| 3p5m_A | 255 | Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS | 3e-05 | ||
| 2np9_A | 440 | Crystal Structure Of A Dioxygenase In The Crotonase | 3e-05 | ||
| 3l3s_A | 263 | Crystal Structure Of An Enoyl-Coa HydrotaseISOMERAS | 6e-05 | ||
| 4hdt_A | 353 | Crystal Structure Of A Carnitinyl-Coa Dehydratase F | 6e-05 | ||
| 2w3p_A | 556 | Boxc Crystal Structure Length = 556 | 1e-04 | ||
| 3bpt_A | 363 | Crystal Structure Of Human Beta-Hydroxyisobutyryl-C | 2e-04 | ||
| 2f6q_A | 280 | The Crystal Structure Of Human Peroxisomal Delta3, | 3e-04 | ||
| 3he2_A | 264 | Crystal Structure Of Enoyl-Coa Hydratase From Mycob | 5e-04 | ||
| 3oc7_A | 267 | Crystal Structure Of An Enoyl-Coa Hydratase From My | 7e-04 |
| >pdb|1DUB|A Chain A, 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6.5 Length = 261 | Back alignment and structure |
|
| >pdb|1MJ3|A Chain A, Crystal Structure Analysis Of Rat Enoyl-Coa Hydratase In Complex With Hexadienoyl-Coa Length = 260 | Back alignment and structure |
| >pdb|1EY3|A Chain A, Structure Of Enoyl-Coa Hydratase Complexed With The Substrate Dac-Coa Length = 258 | Back alignment and structure |
| >pdb|2HW5|A Chain A, The Crystal Structure Of Human Enoyl-Coenzyme A (Coa) Hydratase Short Chain 1, Echs1 Length = 286 | Back alignment and structure |
| >pdb|3MOY|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycob Smegmatis Length = 263 | Back alignment and structure |
| >pdb|4FZW|A Chain A, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 258 | Back alignment and structure |
| >pdb|3Q0J|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Complex With The Inhibitor Acetoacetylcoa Length = 258 | Back alignment and structure |
| >pdb|3PZK|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Apo Form Length = 257 | Back alignment and structure |
| >pdb|3H81|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 278 | Back alignment and structure |
| >pdb|2PBP|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates Subunit I (Gk_2039) From Geobacillus Kaustophilus Hta426 Length = 258 | Back alignment and structure |
| >pdb|3KQF|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis. Length = 265 | Back alignment and structure |
| >pdb|2PPY|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates (Gk_1992) From Geobacillus Kaustophilus Hta426 Length = 265 | Back alignment and structure |
| >pdb|3PEA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis Str. 'ames Ancestor' Length = 261 | Back alignment and structure |
| >pdb|2IEX|A Chain A, Crystal Structure Of Dihydroxynapthoic Acid Synthetase (Gk2873) From Geobacillus Kaustophilus Hta426 Length = 272 | Back alignment and structure |
| >pdb|3RSI|A Chain A, The Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 265 | Back alignment and structure |
| >pdb|3TRR|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 256 | Back alignment and structure |
| >pdb|4EML|A Chain A, Synechocystis Sp. Pcc 6803 1,4-Dihydroxy-2-Naphthoyl-Coenzyme A Synthase (Menb) In Complex With Bicarbonate Length = 275 | Back alignment and structure |
| >pdb|3R0O|A Chain A, Crystal Structure Of Carnitinyl-Coa Hydratase From Mycobacterium Avium Length = 273 | Back alignment and structure |
| >pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa Length = 273 | Back alignment and structure |
| >pdb|3T88|A Chain A, Crystal Structure Of Escherichia Coli Menb In Complex With Substrate Analogue, Osb-Ncoa Length = 289 | Back alignment and structure |
| >pdb|4ELS|A Chain A, Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Coenzyme A Synthases (Menb) In Complex With Bicarbonate Length = 285 | Back alignment and structure |
| >pdb|1UIY|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Thermus Thermophilus Hb8 Length = 253 | Back alignment and structure |
| >pdb|3SWX|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 | Back alignment and structure |
| >pdb|4DI1|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa17 From Mycobacterium Marinum Length = 277 | Back alignment and structure |
| >pdb|3H0U|A Chain A, Crystal Structure Of A Putative Enoyl-Coa Hydratase From Streptomyces Avermitilis Length = 289 | Back alignment and structure |
| >pdb|2VX2|A Chain A, Crystal Structure Of Human Enoyl Coenzyme A Hydratase Domain-Containing Protein 3 (Echdc3) Length = 287 | Back alignment and structure |
| >pdb|3H02|A Chain A, 2.15 Angstrom Resolution Crystal Structure Of Naphthoate Synthase From Salmonella Typhimurium. Length = 288 | Back alignment and structure |
| >pdb|4F47|A Chain A, The Structure Of Enoyl-Coa Hydratase Echa19 From Mycobacterium Marinum Length = 278 | Back alignment and structure |
| >pdb|3LAO|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Pseudomonas Aeruginosa Pa01 Length = 258 | Back alignment and structure |
| >pdb|4FZW|C Chain C, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 274 | Back alignment and structure |
| >pdb|3T3W|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycobacterium Thermoresistibile Length = 279 | Back alignment and structure |
| >pdb|2GTR|A Chain A, Human Chromodomain Y-Like Protein Length = 261 | Back alignment and structure |
| >pdb|2WTB|A Chain A, Arabidopsis Thaliana Multifuctional Protein, Mfp2 Length = 725 | Back alignment and structure |
| >pdb|3PE8|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 256 | Back alignment and structure |
| >pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 715 | Back alignment and structure |
| >pdb|3R9S|A Chain A, Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Avium 104 Length = 267 | Back alignment and structure |
| >pdb|3R9T|A Chain A, Structure Of Echa1_1 From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 267 | Back alignment and structure |
| >pdb|2VSS|E Chain E, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 | Back alignment and structure |
| >pdb|1DCI|A Chain A, Dienoyl-Coa Isomerase Length = 275 | Back alignment and structure |
| >pdb|1EF8|A Chain A, Crystal Structure Of Methylmalonyl Coa Decarboxylase Length = 261 | Back alignment and structure |
| >pdb|2J5I|B Chain B, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 | Back alignment and structure |
| >pdb|2VSS|F Chain F, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 | Back alignment and structure |
| >pdb|2J5I|I Chain I, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 | Back alignment and structure |
| >pdb|2J5I|A Chain A, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 | Back alignment and structure |
| >pdb|2VSU|E Chain E, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 | Back alignment and structure |
| >pdb|2VSU|A Chain A, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism. Length = 276 | Back alignment and structure |
| >pdb|2VSU|F Chain F, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 | Back alignment and structure |
| >pdb|2VSU|C Chain C, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 275 | Back alignment and structure |
| >pdb|3OME|A Chain A, Crystal Structure Of A Probable Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 282 | Back alignment and structure |
| >pdb|3GKB|A Chain A, Crystal Structure Of A Putative Enoyl-coa Hydratase From Streptomyces Avermitilis Length = 287 | Back alignment and structure |
| >pdb|3QYR|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 | Back alignment and structure |
| >pdb|3P85|A Chain A, Crystal Structure Enoyl-Coa Hydratase From Mycobacterium Avium Length = 270 | Back alignment and structure |
| >pdb|2FBM|A Chain A, Acetyltransferase Domain Of Cdy1 Length = 291 | Back alignment and structure |
| >pdb|1RJM|A Chain A, Crystal Structure Of Menb (rv0548c) From Mycobacterium Tuberculosis Length = 339 | Back alignment and structure |
| >pdb|1Q51|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Menb In Complex With Acetoacetyl-Coenzyme A, A Key Enzyme In Vitamin K2 Biosynthesis Length = 314 | Back alignment and structure |
| >pdb|3T8A|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Menb In Complex With Substrate Analogue, Osb-Ncoa Length = 334 | Back alignment and structure |
| >pdb|2VRE|A Chain A, Crystal Structure Of Human Peroxisomal Delta3,5, Delta2,4-Dienoyl Coa Isomerase Length = 296 | Back alignment and structure |
| >pdb|2X58|A Chain A, The Crystal Structure Of Mfe1 Liganded With Coa Length = 727 | Back alignment and structure |
| >pdb|3ZW8|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) In Apo Form Length = 742 | Back alignment and structure |
| >pdb|3HRX|A Chain A, Crystal Structure Of Phenylacetic Acid Degradation Protein Paag Length = 254 | Back alignment and structure |
| >pdb|3SLL|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 290 | Back alignment and structure |
| >pdb|2FW2|A Chain A, Catalytic Domain Of Cdy Length = 260 | Back alignment and structure |
| >pdb|3ZWB|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) Complexed With 2trans-hexenoyl-coa Length = 742 | Back alignment and structure |
| >pdb|3TLF|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 274 | Back alignment and structure |
| >pdb|1HZD|A Chain A, Crystal Structure Of Human Auh Protein, An Rna-Binding Homologue Of Enoyl-Coa Hydratase Length = 272 | Back alignment and structure |
| >pdb|3QXZ|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 | Back alignment and structure |
| >pdb|3MYB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Mycobacterium Smegm Length = 286 | Back alignment and structure |
| >pdb|3M6M|A Chain A, Crystal Structure Of Rpff Complexed With Rec Domain Of Rpfc Length = 305 | Back alignment and structure |
| >pdb|1NZY|A Chain A, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 | Back alignment and structure |
| >pdb|1JXZ|A Chain A, Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coenzyme A Dehalogenase Complexed With 4-Hydroxybenzoyl-Coenzyme A (Product) Length = 269 | Back alignment and structure |
| >pdb|1NZY|B Chain B, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 | Back alignment and structure |
| >pdb|2EJ5|A Chain A, Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydratase Subunit Ii) From Geobacillus Kaustophilus Length = 257 | Back alignment and structure |
| >pdb|3RRV|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 276 | Back alignment and structure |
| >pdb|3HIN|A Chain A, Crystal Structure Of Putative Enoyl-Coa Hydratase From Rhodopseudomonas Palustris Cga009 Length = 275 | Back alignment and structure |
| >pdb|3QKA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa5 From Mycobacterium Marinum Length = 261 | Back alignment and structure |
| >pdb|3QXI|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa1 From Mycobacterium Marinum Length = 265 | Back alignment and structure |
| >pdb|3NJB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis, Iodide Soak Length = 333 | Back alignment and structure |
| >pdb|3I47|A Chain A, Crystal Structure Of Putative Enoyl Coa HydrataseISOMERASE (Crotonase) From Legionella Pneumophila Subsp. Pneumophila Str. Philadelphia 1 Length = 268 | Back alignment and structure |
| >pdb|3LKE|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Halodurans Length = 263 | Back alignment and structure |
| >pdb|1O8U|A Chain A, The 2 Angstrom Structure Of 6-oxo Camphor Hydrolase: New Structural Diversity In The Crotonase Superfamily Length = 257 | Back alignment and structure |
| >pdb|1SZO|A Chain A, Crystal Structure Analysis Of The 6-Oxo Camphor Hydrolase His122ala Mutant Bound To Its Natural Product (2s,4s)- Alpha-Campholinic Acid Length = 257 | Back alignment and structure |
| >pdb|3R9Q|A Chain A, Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 262 | Back alignment and structure |
| >pdb|2J5G|D Chain D, The Native Structure Of A Beta-Diketone Hydrolase From The Cyanobacterium Anabaena Sp. Pcc 7120 Length = 263 | Back alignment and structure |
| >pdb|2J5G|A Chain A, The Native Structure Of A Beta-Diketone Hydrolase From The Cyanobacterium Anabaena Sp. Pcc 7120 Length = 263 | Back alignment and structure |
| >pdb|3QMJ|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 From Mycobacterium Marinum Length = 256 | Back alignment and structure |
| >pdb|2PG8|A Chain A, Crystal Structure Of R254k Mutanat Of Dpgc With Bound Substrate Analog Length = 417 | Back alignment and structure |
| >pdb|3QRE|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase Echa12_1 From Mycobacterium Marinum Length = 298 | Back alignment and structure |
| >pdb|3P5M|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Avium Length = 255 | Back alignment and structure |
| >pdb|2NP9|A Chain A, Crystal Structure Of A Dioxygenase In The Crotonase Superfamily Length = 440 | Back alignment and structure |
| >pdb|3L3S|A Chain A, Crystal Structure Of An Enoyl-Coa HydrotaseISOMERASE FAMILY Protein From Silicibacter Pomeroyi Length = 263 | Back alignment and structure |
| >pdb|4HDT|A Chain A, Crystal Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Thermoresistibile Length = 353 | Back alignment and structure |
| >pdb|2W3P|A Chain A, Boxc Crystal Structure Length = 556 | Back alignment and structure |
| >pdb|3BPT|A Chain A, Crystal Structure Of Human Beta-Hydroxyisobutyryl-Coa Hydrolase In Complex With Quercetin Length = 363 | Back alignment and structure |
| >pdb|2F6Q|A Chain A, The Crystal Structure Of Human Peroxisomal Delta3, Delta2 Enoyl Coa Isomerase (Peci) Length = 280 | Back alignment and structure |
| >pdb|3HE2|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 264 | Back alignment and structure |
| >pdb|3OC7|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase From Mycobacterium Avium Length = 267 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 152 | |||
| 1mj3_A | 260 | Enoyl-COA hydratase, mitochondrial; homohexamer, l | 3e-66 | |
| 3moy_A | 263 | Probable enoyl-COA hydratase; ssgcid, seattle stru | 9e-66 | |
| 3pea_A | 261 | Enoyl-COA hydratase/isomerase family protein; stru | 1e-65 | |
| 2pbp_A | 258 | Enoyl-COA hydratase subunit I; B-oxidation, struct | 2e-65 | |
| 3h81_A | 278 | Enoyl-COA hydratase ECHA8; niaid, decode, infectio | 2e-65 | |
| 4di1_A | 277 | Enoyl-COA hydratase ECHA17; structural genomics, s | 4e-65 | |
| 1ef8_A | 261 | Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc | 2e-64 | |
| 3rsi_A | 265 | Putative enoyl-COA hydratase/isomerase; structural | 3e-64 | |
| 2j5i_A | 276 | P-hydroxycinnamoyl COA hydratase/lyase; vanillin, | 2e-63 | |
| 3kqf_A | 265 | Enoyl-COA hydratase/isomerase family protein; IDP0 | 4e-63 | |
| 3hin_A | 275 | Putative 3-hydroxybutyryl-COA dehydratase; structu | 5e-63 | |
| 4f47_A | 278 | Enoyl-COA hydratase ECHA19; ssgcid, seattle struct | 8e-63 | |
| 3swx_A | 265 | Probable enoyl-COA hydratase/isomerase; structural | 8e-63 | |
| 3qxi_A | 265 | Enoyl-COA hydratase ECHA1; structural genomics, se | 1e-62 | |
| 3trr_A | 256 | Probable enoyl-COA hydratase/isomerase; ssgcid, st | 1e-62 | |
| 3pe8_A | 256 | Enoyl-COA hydratase; emerald biostructures, struct | 2e-62 | |
| 3lao_A | 258 | Enoyl-COA hydratase/isomerase; alpha-beta sandwich | 2e-62 | |
| 3gkb_A | 287 | Putative enoyl-COA hydratase; structural genomics, | 4e-61 | |
| 2a7k_A | 250 | CARB; crotonase, antibiotic, beta-lactam, biosynth | 4e-61 | |
| 2ppy_A | 265 | Enoyl-COA hydratase; beta-oxidation, fatty acid me | 1e-60 | |
| 3h0u_A | 289 | Putative enoyl-COA hydratase; structural genomics, | 2e-60 | |
| 2q35_A | 243 | CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} | 2e-59 | |
| 3tlf_A | 274 | Enoyl-COA hydratase/isomerase; structural genomics | 2e-59 | |
| 1uiy_A | 253 | Enoyl-COA hydratase; lyase, beta-oxidation, croton | 3e-59 | |
| 4eml_A | 275 | Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe | 3e-59 | |
| 3r9t_A | 267 | ECHA1_1; ssgcid, seattle structural genomics cente | 4e-59 | |
| 1hzd_A | 272 | AUH, AU-binding protein/enoyl-COA hydratase; RNA-b | 6e-59 | |
| 3t89_A | 289 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 2e-58 | |
| 3sll_A | 290 | Probable enoyl-COA hydratase/isomerase; structural | 1e-57 | |
| 3r9q_A | 262 | Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome | 4e-57 | |
| 1nzy_A | 269 | Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen | 6e-57 | |
| 2uzf_A | 273 | Naphthoate synthase; lyase, menaquinone biosynthes | 6e-57 | |
| 2gtr_A | 261 | CDY-like, chromodomain Y-like protein; structural | 1e-56 | |
| 3m6n_A | 305 | RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X | 2e-56 | |
| 2fbm_A | 291 | Y chromosome chromodomain protein 1, telomeric IS; | 2e-56 | |
| 1sg4_A | 260 | 3,2-trans-enoyl-COA isomerase, mitochondrial; crot | 4e-56 | |
| 1dci_A | 275 | Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg | 4e-56 | |
| 2vx2_A | 287 | Enoyl-COA hydratase domain-containing protein 3; i | 1e-55 | |
| 3rrv_A | 276 | Enoyl-COA hydratase/isomerase; structural genomics | 2e-55 | |
| 3qmj_A | 256 | Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, | 3e-55 | |
| 3t3w_A | 279 | Probable enoyl-COA hydratase; ssgcid, structural g | 3e-55 | |
| 3he2_A | 264 | Enoyl-COA hydratase ECHA6; fatty acid metabolism, | 4e-54 | |
| 3r6h_A | 233 | Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m | 1e-53 | |
| 2np9_A | 440 | DPGC; protein inhibitor complex, oxidoreductase; H | 2e-53 | |
| 3qxz_A | 265 | Enoyl-COA hydratase/isomerase; structural genomics | 3e-52 | |
| 3ot6_A | 232 | Enoyl-COA hydratase/isomerase family protein; stru | 5e-52 | |
| 1szo_A | 257 | 6-oxocamphor hydrolase; enzyme-product complex; HE | 7e-52 | |
| 3myb_A | 286 | Enoyl-COA hydratase; ssgcid, struct genomics, seat | 2e-51 | |
| 2j5g_A | 263 | ALR4455 protein; enzyme evolution, C-C bond hydrol | 3e-51 | |
| 3qk8_A | 272 | Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB | 5e-51 | |
| 3isa_A | 254 | Putative enoyl-COA hydratase/isomerase; structural | 9e-51 | |
| 1wz8_A | 264 | Enoyl-COA hydratase; lyase, crotonase, hexamer, st | 1e-50 | |
| 2ej5_A | 257 | Enoyl-COA hydratase subunit II; structural genomic | 3e-50 | |
| 3fdu_A | 266 | Putative enoyl-COA hydratase/isomerase; structural | 2e-49 | |
| 3lke_A | 263 | Enoyl-COA hydratase; nysgrc, target 11251J, struct | 4e-49 | |
| 3t8b_A | 334 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 3e-48 | |
| 3i47_A | 268 | Enoyl COA hydratase/isomerase (crotonase); structu | 3e-48 | |
| 3l3s_A | 263 | Enoyl-COA hydratase/isomerase family protein; crot | 7e-47 | |
| 3qre_A | 298 | Enoyl-COA hydratase, ECHA12_1; structural genomics | 1e-46 | |
| 3gow_A | 254 | PAAG, probable enoyl-COA hydratase; the spiral fol | 2e-46 | |
| 3p5m_A | 255 | Enoyl-COA hydratase/isomerase; seattle structural | 4e-46 | |
| 2f6q_A | 280 | Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis | 3e-43 | |
| 3g64_A | 279 | Putative enoyl-COA hydratase; alpha-beta structure | 1e-41 | |
| 3njd_A | 333 | Enoyl-COA hydratase; ssgcid, mycobacerium smegmati | 1e-41 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 3e-41 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 2e-11 | |
| 1pjh_A | 280 | Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral | 1e-39 | |
| 3hp0_A | 267 | Putative polyketide biosynthesis enoyl-COA hydrata | 9e-39 | |
| 3oc7_A | 267 | Enoyl-COA hydratase; seattle structural genomics c | 6e-34 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 3e-30 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 1e-29 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 4e-29 | |
| 3ju1_A | 407 | Enoyl-COA hydratase/isomerase family protein; alph | 1e-08 | |
| 3bpt_A | 363 | 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet | 3e-08 |
| >1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 | Back alignment and structure |
|---|
Score = 201 bits (513), Expect = 3e-66
Identities = 75/107 (70%), Positives = 92/107 (85%)
Query: 36 LGGGCELAMMCDIIYAGEKAKFGQPEIIIGTMPGAGGTQRLTRAAGKSNAMEICLTGNQF 95
LGGGCELAMMCDIIYAGEKA+FGQPEI++GT+PGAGGTQRLTRA GKS AME+ LTG++
Sbjct: 109 LGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRI 168
Query: 96 TAQEAKEMGVVSKIFPPEKLLEETIKLAERIGEHSPLIVTQVKEAVN 142
+AQ+AK+ G+VSKIFP E L+EE I+ AE+I +S +IV KE+VN
Sbjct: 169 SAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVN 215
|
| >3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 | Back alignment and structure |
|---|
| >3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 | Back alignment and structure |
|---|
| >2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 | Back alignment and structure |
|---|
| >3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 | Back alignment and structure |
|---|
| >4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 | Back alignment and structure |
|---|
| >1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 | Back alignment and structure |
|---|
| >3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 | Back alignment and structure |
|---|
| >3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 | Back alignment and structure |
|---|
| >3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 | Back alignment and structure |
|---|
| >4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 | Back alignment and structure |
|---|
| >3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 | Back alignment and structure |
|---|
| >3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 | Back alignment and structure |
|---|
| >3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 | Back alignment and structure |
|---|
| >3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 | Back alignment and structure |
|---|
| >3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 | Back alignment and structure |
|---|
| >2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 | Back alignment and structure |
|---|
| >2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 | Back alignment and structure |
|---|
| >3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 | Back alignment and structure |
|---|
| >2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 | Back alignment and structure |
|---|
| >3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 | Back alignment and structure |
|---|
| >1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 | Back alignment and structure |
|---|
| >4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 | Back alignment and structure |
|---|
| >3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 | Back alignment and structure |
|---|
| >1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 | Back alignment and structure |
|---|
| >3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 | Back alignment and structure |
|---|
| >3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 | Back alignment and structure |
|---|
| >3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 | Back alignment and structure |
|---|
| >1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 | Back alignment and structure |
|---|
| >2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 | Back alignment and structure |
|---|
| >2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 | Back alignment and structure |
|---|
| >3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 | Back alignment and structure |
|---|
| >2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 | Back alignment and structure |
|---|
| >1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 | Back alignment and structure |
|---|
| >1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 | Back alignment and structure |
|---|
| >2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287 | Back alignment and structure |
|---|
| >3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 | Back alignment and structure |
|---|
| >3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 | Back alignment and structure |
|---|
| >3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 | Back alignment and structure |
|---|
| >3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 | Back alignment and structure |
|---|
| >3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 | Back alignment and structure |
|---|
| >2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 | Back alignment and structure |
|---|
| >3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 | Back alignment and structure |
|---|
| >1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 | Back alignment and structure |
|---|
| >3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 | Back alignment and structure |
|---|
| >2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 | Back alignment and structure |
|---|
| >3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 | Back alignment and structure |
|---|
| >3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 | Back alignment and structure |
|---|
| >1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 | Back alignment and structure |
|---|
| >2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 | Back alignment and structure |
|---|
| >3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 | Back alignment and structure |
|---|
| >3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 | Back alignment and structure |
|---|
| >3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 | Back alignment and structure |
|---|
| >3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 | Back alignment and structure |
|---|
| >3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 | Back alignment and structure |
|---|
| >3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 | Back alignment and structure |
|---|
| >3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 | Back alignment and structure |
|---|
| >2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 | Back alignment and structure |
|---|
| >3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 | Back alignment and structure |
|---|
| >3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 | Back alignment and structure |
|---|
| >1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 | Back alignment and structure |
|---|
| >3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 | Back alignment and structure |
|---|
| >3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 | Back alignment and structure |
|---|
| >3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Length = 407 | Back alignment and structure |
|---|
| >3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Length = 363 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 152 | |||
| 3hrx_A | 254 | Probable enoyl-COA hydratase; the spiral fold, the | 100.0 | |
| 4fzw_A | 258 | 2,3-dehydroadipyl-COA hydratase; structural genomi | 100.0 | |
| 3kqf_A | 265 | Enoyl-COA hydratase/isomerase family protein; IDP0 | 100.0 | |
| 4fzw_C | 274 | 1,2-epoxyphenylacetyl-COA isomerase; structural ge | 100.0 | |
| 3pea_A | 261 | Enoyl-COA hydratase/isomerase family protein; stru | 100.0 | |
| 3hin_A | 275 | Putative 3-hydroxybutyryl-COA dehydratase; structu | 100.0 | |
| 3qmj_A | 256 | Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, | 100.0 | |
| 3r9q_A | 262 | Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome | 100.0 | |
| 3r6h_A | 233 | Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m | 100.0 | |
| 3i47_A | 268 | Enoyl COA hydratase/isomerase (crotonase); structu | 100.0 | |
| 4di1_A | 277 | Enoyl-COA hydratase ECHA17; structural genomics, s | 100.0 | |
| 3lao_A | 258 | Enoyl-COA hydratase/isomerase; alpha-beta sandwich | 100.0 | |
| 3gow_A | 254 | PAAG, probable enoyl-COA hydratase; the spiral fol | 100.0 | |
| 3h81_A | 278 | Enoyl-COA hydratase ECHA8; niaid, decode, infectio | 100.0 | |
| 3moy_A | 263 | Probable enoyl-COA hydratase; ssgcid, seattle stru | 100.0 | |
| 3p5m_A | 255 | Enoyl-COA hydratase/isomerase; seattle structural | 100.0 | |
| 3g64_A | 279 | Putative enoyl-COA hydratase; alpha-beta structure | 100.0 | |
| 3ot6_A | 232 | Enoyl-COA hydratase/isomerase family protein; stru | 100.0 | |
| 3trr_A | 256 | Probable enoyl-COA hydratase/isomerase; ssgcid, st | 100.0 | |
| 3qxi_A | 265 | Enoyl-COA hydratase ECHA1; structural genomics, se | 100.0 | |
| 2ej5_A | 257 | Enoyl-COA hydratase subunit II; structural genomic | 100.0 | |
| 3r9t_A | 267 | ECHA1_1; ssgcid, seattle structural genomics cente | 100.0 | |
| 3lke_A | 263 | Enoyl-COA hydratase; nysgrc, target 112 structural | 100.0 | |
| 3swx_A | 265 | Probable enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 3qxz_A | 265 | Enoyl-COA hydratase/isomerase; structural genomics | 100.0 | |
| 2gtr_A | 261 | CDY-like, chromodomain Y-like protein; structural | 100.0 | |
| 3sll_A | 290 | Probable enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 3qre_A | 298 | Enoyl-COA hydratase, ECHA12_1; structural genomics | 100.0 | |
| 3gkb_A | 287 | Putative enoyl-COA hydratase; structural genomics, | 100.0 | |
| 3pe8_A | 256 | Enoyl-COA hydratase; emerald biostructures, struct | 100.0 | |
| 4f47_A | 278 | Enoyl-COA hydratase ECHA19; ssgcid, seattle struct | 100.0 | |
| 1mj3_A | 260 | Enoyl-COA hydratase, mitochondrial; homohexamer, l | 100.0 | |
| 2pbp_A | 258 | Enoyl-COA hydratase subunit I; B-oxidation, struct | 100.0 | |
| 1nzy_A | 269 | Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen | 100.0 | |
| 3tlf_A | 274 | Enoyl-COA hydratase/isomerase; structural genomics | 100.0 | |
| 2j5i_A | 276 | P-hydroxycinnamoyl COA hydratase/lyase; vanillin, | 100.0 | |
| 2ppy_A | 265 | Enoyl-COA hydratase; beta-oxidation, fatty acid me | 100.0 | |
| 3h0u_A | 289 | Putative enoyl-COA hydratase; structural genomics, | 100.0 | |
| 1sg4_A | 260 | 3,2-trans-enoyl-COA isomerase, mitochondrial; crot | 100.0 | |
| 3qk8_A | 272 | Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB | 100.0 | |
| 2fbm_A | 291 | Y chromosome chromodomain protein 1, telomeric IS; | 99.98 | |
| 2a7k_A | 250 | CARB; crotonase, antibiotic, beta-lactam, biosynth | 99.98 | |
| 2f6q_A | 280 | Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis | 99.98 | |
| 2q35_A | 243 | CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} | 99.98 | |
| 1ef8_A | 261 | Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc | 99.98 | |
| 4eml_A | 275 | Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe | 99.98 | |
| 3m6n_A | 305 | RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X | 99.98 | |
| 3fdu_A | 266 | Putative enoyl-COA hydratase/isomerase; structural | 99.98 | |
| 2vx2_A | 287 | Enoyl-COA hydratase domain-containing protein 3; i | 99.98 | |
| 1wz8_A | 264 | Enoyl-COA hydratase; lyase, crotonase, hexamer, st | 99.98 | |
| 3l3s_A | 263 | Enoyl-COA hydratase/isomerase family protein; crot | 99.98 | |
| 3myb_A | 286 | Enoyl-COA hydratase; ssgcid, struct genomics, seat | 99.98 | |
| 1uiy_A | 253 | Enoyl-COA hydratase; lyase, beta-oxidation, croton | 99.98 | |
| 1dci_A | 275 | Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg | 99.97 | |
| 3t8b_A | 334 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 99.97 | |
| 3rsi_A | 265 | Putative enoyl-COA hydratase/isomerase; structural | 99.97 | |
| 1hzd_A | 272 | AUH, AU-binding protein/enoyl-COA hydratase; RNA-b | 99.97 | |
| 3t89_A | 289 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 99.97 | |
| 3rrv_A | 276 | Enoyl-COA hydratase/isomerase; structural genomics | 99.97 | |
| 2uzf_A | 273 | Naphthoate synthase; lyase, menaquinone biosynthes | 99.97 | |
| 1pjh_A | 280 | Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral | 99.97 | |
| 3isa_A | 254 | Putative enoyl-COA hydratase/isomerase; structural | 99.97 | |
| 1szo_A | 257 | 6-oxocamphor hydrolase; enzyme-product complex; HE | 99.97 | |
| 2j5g_A | 263 | ALR4455 protein; enzyme evolution, C-C bond hydrol | 99.97 | |
| 4hdt_A | 353 | 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti | 99.97 | |
| 3oc7_A | 267 | Enoyl-COA hydratase; seattle structural genomics c | 99.97 | |
| 3hp0_A | 267 | Putative polyketide biosynthesis enoyl-COA hydrata | 99.97 | |
| 3njd_A | 333 | Enoyl-COA hydratase; ssgcid, mycobacerium smegmati | 99.97 | |
| 3he2_A | 264 | Enoyl-COA hydratase ECHA6; fatty acid metabolism, | 99.97 | |
| 3t3w_A | 279 | Enoyl-COA hydratase; ssgcid, structural genomics, | 99.97 | |
| 3bpt_A | 363 | 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet | 99.96 | |
| 3ju1_A | 407 | Enoyl-COA hydratase/isomerase family protein; alph | 99.96 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 99.95 | |
| 2np9_A | 440 | DPGC; protein inhibitor complex, oxidoreductase; H | 99.95 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 99.94 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 99.94 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 99.94 | |
| 3viv_A | 230 | 441AA long hypothetical NFED protein; protein-pept | 99.31 | |
| 3rst_A | 240 | Signal peptide peptidase SPPA; alpha/beta protein | 99.31 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 99.27 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 99.1 | |
| 2f9y_A | 339 | Acetyl-COA carboxylase, carboxyltransferase alpha; | 98.97 | |
| 2f9i_A | 327 | Acetyl-coenzyme A carboxylase carboxyl transferase | 98.95 | |
| 2f9y_B | 304 | Acetyl-coenzyme A carboxylase carboxyl transferas | 98.75 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 98.31 | |
| 2cby_A | 208 | ATP-dependent CLP protease proteolytic subunit 1; | 97.97 | |
| 3qwd_A | 203 | ATP-dependent CLP protease proteolytic subunit; ca | 97.45 | |
| 2f6i_A | 215 | ATP-dependent CLP protease, putative; structural g | 97.31 | |
| 1yg6_A | 193 | ATP-dependent CLP protease proteolytic subunit; en | 97.24 | |
| 1tg6_A | 277 | Putative ATP-dependent CLP protease proteolytic S; | 97.22 | |
| 3p2l_A | 201 | ATP-dependent CLP protease proteolytic subunit; st | 97.21 | |
| 1pix_A | 587 | Glutaconyl-COA decarboxylase A subunit; biotin-dep | 97.19 | |
| 4gm2_A | 205 | ATP-dependent CLP protease proteolytic subunit; st | 96.95 | |
| 3iav_A | 530 | Propionyl-COA carboxylase complex B subunit; accas | 95.81 | |
| 2f9i_B | 285 | Acetyl-coenzyme A carboxylase carboxyl transferase | 95.78 | |
| 3n6r_B | 531 | Propionyl-COA carboxylase, beta subunit; protein c | 95.72 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 95.17 | |
| 1on3_A | 523 | Methylmalonyl-COA carboxyltransferase 12S subunit; | 94.29 | |
| 2bzr_A | 548 | Propionyl-COA carboxylase beta chain 5; fatty acid | 93.37 | |
| 3u9r_B | 555 | MCC beta, methylcrotonyl-COA carboxylase, beta-sub | 93.21 | |
| 1x0u_A | 522 | Hypothetical methylmalonyl-COA decarboxylase ALPH; | 92.74 | |
| 1vrg_A | 527 | Propionyl-COA carboxylase, beta subunit; TM0716, s | 91.09 | |
| 1x0u_A | 522 | Hypothetical methylmalonyl-COA decarboxylase ALPH; | 90.69 | |
| 1vrg_A | 527 | Propionyl-COA carboxylase, beta subunit; TM0716, s | 89.48 | |
| 3k8x_A | 758 | Acetyl-COA carboxylase; transferase, carboxyltrans | 88.6 | |
| 1pix_A | 587 | Glutaconyl-COA decarboxylase A subunit; biotin-dep | 85.57 | |
| 1on3_A | 523 | Methylmalonyl-COA carboxyltransferase 12S subunit; | 84.91 | |
| 2x24_A | 793 | Acetyl-COA carboxylase; fatty acid biosynthesis, l | 83.43 | |
| 3gf3_A | 588 | Glutaconyl-COA decarboxylase subunit A; sodium ION | 80.28 |
| >3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} | Back alignment and structure |
|---|
Probab=100.00 E-value=6.7e-35 Score=224.48 Aligned_cols=142 Identities=26% Similarity=0.338 Sum_probs=128.5
Q ss_pred cccccCCCCCCcchhhhhhhchhhh---------hhhh-------------hhchHHHHHHHHcCeeEecCCeEEecccc
Q psy9281 5 EKLFILIDYEQKDLYRSKNLKFIQC---------LKIW-------------IYLGGGCELAMMCDIIYAGEKAKFGQPEI 62 (152)
Q Consensus 5 ~k~Fs~~~caG~Dl~~~~~~~~~~~---------~~~~-------------~a~G~G~~lal~cD~ria~~~a~f~~pe~ 62 (152)
.|+|| +|.||+++........ +..+ +|+|||++|+++||+||++++++|++||+
T Consensus 54 g~~F~----aG~Dl~~~~~~~~~~~~~~~~~~~~~~~l~~~~kPvIAav~G~a~GgG~~lalacD~ria~~~a~f~~pe~ 129 (254)
T 3hrx_A 54 GRAFS----AGQDLTEFGDRKPDYEAHLRRYNRVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFV 129 (254)
T ss_dssp TTCSB----CCBCGGGTTTSCCCHHHHTHHHHHHHHHHHTCSSCEEEEECSEEETHHHHHHTTCSEEEEETTCEEECCGG
T ss_pred CCCcc----cCccHHHhcccchhhHHHHHHHHHHHHHHHhCCCCEEEEECCEeeehhhhhhhccceeeEcCCCEEEchhh
Confidence 47899 9999999855332211 1111 99999999999999999999999999999
Q ss_pred cccccCCccHHHHHHHHhCHHHHHHHHHcCCCCCHHHHHHcCCccccCCcchHHHHHHHHHHHHhcCCHHHHHHHHHHHh
Q psy9281 63 IIGTMPGAGGTQRLTRAAGKSNAMEICLTGNQFTAQEAKEMGVVSKIFPPEKLLEETIKLAERIGEHSPLIVTQVKEAVN 142 (152)
Q Consensus 63 ~~G~~p~~~~~~~l~~~~g~~~a~~lll~g~~~~a~ea~~~Glv~~v~~~~~l~~~~~~~a~~l~~~~~~a~~~~K~~l~ 142 (152)
++|++|+.|++++|++++|+++|++++++|++++++||+++||||+++|++++.+++.+++++++..||.+++.+|+.++
T Consensus 130 ~lGl~p~~g~~~~L~r~vG~~~A~~llltg~~i~A~eA~~~GLv~~vv~~~~l~~~a~~~a~~la~~~~~a~~~~K~~~~ 209 (254)
T 3hrx_A 130 RIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTKKLLL 209 (254)
T ss_dssp GGTCCCCTTHHHHHHHHHCHHHHHHHHHHCCCEEHHHHHHHTSCSEEECGGGHHHHHHHHHHHHHTSCHHHHHHHHHHHH
T ss_pred CcCcCCcccHHHHHHHHhCcchHHHHhhcCcccCHHHHHHCCCeEEecCcHHHHHHHHHHHHHhhccchHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccCCCC
Q psy9281 143 IDDTEGLN 150 (152)
Q Consensus 143 ~~~~~~l~ 150 (152)
+....+++
T Consensus 210 ~~~~~~~~ 217 (254)
T 3hrx_A 210 ETYRLSLT 217 (254)
T ss_dssp HGGGSCHH
T ss_pred HHHcCCHH
Confidence 88776654
|
| >4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A | Back alignment and structure |
|---|
| >3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* | Back alignment and structure |
|---|
| >3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* | Back alignment and structure |
|---|
| >3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A | Back alignment and structure |
|---|
| >3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A | Back alignment and structure |
|---|
| >3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} | Back alignment and structure |
|---|
| >3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A | Back alignment and structure |
|---|
| >4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* | Back alignment and structure |
|---|
| >2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A | Back alignment and structure |
|---|
| >1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* | Back alignment and structure |
|---|
| >3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* | Back alignment and structure |
|---|
| >2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A | Back alignment and structure |
|---|
| >3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A | Back alignment and structure |
|---|
| >2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* | Back alignment and structure |
|---|
| >2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A | Back alignment and structure |
|---|
| >1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* | Back alignment and structure |
|---|
| >4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} | Back alignment and structure |
|---|
| >3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A | Back alignment and structure |
|---|
| >3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} | Back alignment and structure |
|---|
| >2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A | Back alignment and structure |
|---|
| >3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A | Back alignment and structure |
|---|
| >3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A | Back alignment and structure |
|---|
| >3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A | Back alignment and structure |
|---|
| >3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A | Back alignment and structure |
|---|
| >3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A | Back alignment and structure |
|---|
| >2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D | Back alignment and structure |
|---|
| >4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A | Back alignment and structure |
|---|
| >3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A | Back alignment and structure |
|---|
| >3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A | Back alignment and structure |
|---|
| >3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A | Back alignment and structure |
|---|
| >3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A | Back alignment and structure |
|---|
| >2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A | Back alignment and structure |
|---|
| >1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A | Back alignment and structure |
|---|
| >3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A | Back alignment and structure |
|---|
| >2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* | Back alignment and structure |
|---|
| >2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A | Back alignment and structure |
|---|
| >3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B | Back alignment and structure |
|---|
| >1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A | Back alignment and structure |
|---|
| >1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* | Back alignment and structure |
|---|
| >2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* | Back alignment and structure |
|---|
| >3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 152 | ||||
| d1mj3a_ | 260 | c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat | 3e-27 | |
| d1szoa_ | 249 | c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus | 2e-09 | |
| d1hzda_ | 266 | c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [T | 3e-09 | |
| d2f6qa1 | 245 | c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-C | 3e-09 | |
| d1uiya_ | 253 | c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {The | 5e-09 | |
| d1pjha_ | 266 | c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 | 1e-07 | |
| d1wdka4 | 310 | c.14.1.3 (A:1-310) Fatty oxidation complex alpha s | 7e-07 | |
| d2a7ka1 | 230 | c.14.1.3 (A:1-230) Carbapenem biosynthes protein C | 3e-06 | |
| d1sg4a1 | 249 | c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-d | 0.001 |
| >d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Crotonase-like domain: Enoyl-CoA hydratase (crotonase) species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 100 bits (249), Expect = 3e-27
Identities = 75/107 (70%), Positives = 92/107 (85%)
Query: 36 LGGGCELAMMCDIIYAGEKAKFGQPEIIIGTMPGAGGTQRLTRAAGKSNAMEICLTGNQF 95
LGGGCELAMMCDIIYAGEKA+FGQPEI++GT+PGAGGTQRLTRA GKS AME+ LTG++
Sbjct: 109 LGGGCELAMMCDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRI 168
Query: 96 TAQEAKEMGVVSKIFPPEKLLEETIKLAERIGEHSPLIVTQVKEAVN 142
+AQ+AK+ G+VSKIFP E L+EE I+ AE+I +S +IV KE+VN
Sbjct: 169 SAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVN 215
|
| >d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 249 | Back information, alignment and structure |
|---|
| >d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Length = 253 | Back information, alignment and structure |
|---|
| >d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266 | Back information, alignment and structure |
|---|
| >d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 310 | Back information, alignment and structure |
|---|
| >d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Length = 230 | Back information, alignment and structure |
|---|
| >d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 152 | |||
| d2a7ka1 | 230 | Carbapenem biosynthes protein CarB {Pectobacterium | 100.0 | |
| d2f6qa1 | 245 | Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( | 100.0 | |
| d1mj3a_ | 260 | Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve | 100.0 | |
| d2fw2a1 | 258 | Chromodomain protein CDY2A {Human (Homo sapiens) [ | 99.98 | |
| d1wz8a1 | 263 | Probable enoyl-CoA hydratase TTHA0218 {Thermus the | 99.97 | |
| d1sg4a1 | 249 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 99.97 | |
| d1ef8a_ | 261 | Methylmalonyl CoA decarboxylase {Escherichia coli | 99.97 | |
| d1nzya_ | 269 | 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., | 99.97 | |
| d1hzda_ | 266 | AUH protein {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1szoa_ | 249 | 6-oxo camphor hydrolase {Rhodococcus erythropolis | 99.96 | |
| d1uiya_ | 253 | Enoyl-CoA hydratase (crotonase) {Thermus thermophi | 99.96 | |
| d1wdka4 | 310 | Fatty oxidation complex alpha subunit, N-terminal | 99.96 | |
| d1pjha_ | 266 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 99.96 | |
| d1dcia_ | 275 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 99.96 | |
| d1q52a_ | 297 | Naphthoate synthase MenB {Mycobacterium tuberculos | 99.95 | |
| d2cbya1 | 179 | Clp protease, ClpP subunit {Mycobacterium tubercul | 97.37 | |
| d1y7oa1 | 192 | Clp protease, ClpP subunit {Streptococcus pneumoni | 97.27 | |
| d2f6ia1 | 190 | Clp protease, ClpP subunit {Plasmodium falciparum | 97.27 | |
| d1tg6a1 | 193 | Clp protease, ClpP subunit {Human (Homo sapiens), | 97.23 | |
| d1yg6a1 | 183 | Clp protease, ClpP subunit {Escherichia coli [TaxI | 97.06 | |
| d1on3a1 | 253 | Methylmalonyl-CoA carboxyltransferase (transcarbox | 95.52 | |
| d2a7sa1 | 258 | Propionyl-CoA carboxylase complex B subunit, PccB | 95.0 | |
| d2f9ya1 | 316 | Acetyl-coenzyme A carboxylase carboxyl transferase | 94.93 | |
| d1xnya1 | 258 | Propionyl-CoA carboxylase complex B subunit, PccB | 94.57 | |
| d1vrga1 | 251 | Propionyl-CoA carboxylase complex B subunit, PccB | 94.5 | |
| d2f9yb1 | 263 | Acetyl-coenzyme A carboxylase carboxyl transferase | 94.24 | |
| d1pixa2 | 287 | Glutaconyl-CoA decarboxylase A subunit {Acidaminoc | 91.68 | |
| d1uyra1 | 333 | Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc | 87.66 |
| >d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Crotonase-like domain: Carbapenem biosynthes protein CarB species: Pectobacterium carotovorum [TaxId: 554]
Probab=100.00 E-value=4.4e-34 Score=215.23 Aligned_cols=140 Identities=23% Similarity=0.232 Sum_probs=124.3
Q ss_pred cccccCCCCCCcchhhhhhhchhhh-----------hhhh-------------hhchHHHHHHHHcCeeEecCCeEEecc
Q psy9281 5 EKLFILIDYEQKDLYRSKNLKFIQC-----------LKIW-------------IYLGGGCELAMMCDIIYAGEKAKFGQP 60 (152)
Q Consensus 5 ~k~Fs~~~caG~Dl~~~~~~~~~~~-----------~~~~-------------~a~G~G~~lal~cD~ria~~~a~f~~p 60 (152)
+|+|| +|.|++++......+. +..+ +|+|||++|+++||+||++++++|++|
T Consensus 55 ~~~F~----aG~Dl~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~kpvIaav~G~a~GgG~~lal~~D~~ia~~~a~f~~p 130 (230)
T d2a7ka1 55 ERSFS----AGGDFNEVKQLSRSEDIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMP 130 (230)
T ss_dssp TSCSB----CBSCHHHHHTC-CHHHHHHHHHHHHHHHHHHHTCCSCEEEEECSEEETHHHHHHTTSSEEEEETTCEEECC
T ss_pred hhhhh----hhcccccccccccccccccchhhhhhhhhcccchhcceeeecccccccccccchhccchhhccccchhhhc
Confidence 57999 9999999866433221 1111 999999999999999999999999999
Q ss_pred cccccccCCccHHHHHHHHhCHHHHHHHHHcCCCCCHHHHHHcCCccccCCcchHHHHHHHHHHHHhcCCHHHHHHHHHH
Q psy9281 61 EIIIGTMPGAGGTQRLTRAAGKSNAMEICLTGNQFTAQEAKEMGVVSKIFPPEKLLEETIKLAERIGEHSPLIVTQVKEA 140 (152)
Q Consensus 61 e~~~G~~p~~~~~~~l~~~~g~~~a~~lll~g~~~~a~ea~~~Glv~~v~~~~~l~~~~~~~a~~l~~~~~~a~~~~K~~ 140 (152)
|+++|++|+.++ .+|++++|++++++++++|++++++||+++||||+++|++++.+++.++++++++.||.+++.+|+.
T Consensus 131 e~~~G~~p~~g~-~~l~~~iG~~~a~~l~l~g~~~~a~eA~~~Glv~~vv~~~~l~~~a~~~a~~ia~~~~~a~~~~K~~ 209 (230)
T d2a7ka1 131 ELKHGIGCSVGA-AILGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFINTKRA 209 (230)
T ss_dssp GGGGTCCCHHHH-HHHHHHHCHHHHHHHHHHCCCBCHHHHHHHTCCSEEECHHHHHHHHHHHHHHHHTSCHHHHHHHHHH
T ss_pred cccccccccccc-cccccccccccccccccccccchHHHHHHhhhcccCCChHHHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence 999999988775 5699999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HhccccCCC
Q psy9281 141 VNIDDTEGL 149 (152)
Q Consensus 141 l~~~~~~~l 149 (152)
+++.+...+
T Consensus 210 l~~~~~~~l 218 (230)
T d2a7ka1 210 VNKPFIHLL 218 (230)
T ss_dssp HHHHHHHHH
T ss_pred HHHHHhccH
Confidence 988765544
|
| >d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|