Psyllid ID: psy9319


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430--
MEGQNFIPLLGLNPRPSLYQSSVLTDISPKQLDFKFKEHHKLEEQNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKVYDICIQAATFTVAWHPKQYLLAYACDDKYDRKQDCGNLKVFGFLPEPIKKRKRGGTMSSWVKAAKVNQKTHRERHQPEDRRKLGLLEKKKDYRVRADHFNKKKKTLQILKKKALEKNEDEFHTHMINARLVDGEHFENPKPEAEDSEEQKLLMDTQDAKYVSSRRVMEKRKIEKIKAGNHMIDAANQIENTHVFFVDNEAEAKKFDVVKQLKTLPELLPRKTNRLKVEDIAEMSVAQHVKSKMKLVKARQAEKLGKRLERERNLGVVERKLFVQRFLSEKPKLVKPGTPDSAPVYKWKFERKK
ccccccEEEEEEcccccEEEEEEccccccccccEEEEcccccccccccccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEcccccccEEEEEEEccccccEEEccccccccccccccEEEEEEEEccccEEEEEEEcccHHHHHHHHHHHcccccccccccEEEEEEEcccccccccccccccHHHHHHHHcccHHHHHHHHHcHHHHHHHHHHccccEEccccccccEEEEEccHHHHccccHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccc
ccccccEEEEEEcccccEEEEcccccccEEEEEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEcccccccccEEEcccccEEEEcccccEEEEEccccccHHHHccccccEEEEEEccccccHHHHHHHHHHHHccccHHHEEEEEEEccccEEEEEccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcHEEccccccccEEEEEccHHHHHcccHHHHHcccHHHHccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEcccccccccEEEEEEEccc
megqnfipllglnprpslyqssvltdispkqldfkFKEHHKLEEQNilkahpvtciciefdptgkyfavGSKDALVSLWDAAELTCIrtfqrldwpvraisfshdgaliasgsedltidiahvesgkkVYDICIQAAtftvawhpKQYLLAYAcddkydrkqdcgnlkvfgflpepikkrkrggtmSSWVKAAKVNQkthrerhqpedrrklgllekkkDYRVRADHFNKKKKTLQILKKKALEKNEDEFHTHMINArlvdgehfenpkpeaedsEEQKLLMDTQDAKYVSSRRVMEKRKIEKIKAGNHMIDAANqienthvffvdneaeakkFDVVKQLKtlpellprktnrlkveDIAEMSVAQHVKSKMKLVKARQAEKLGKRLERERNLGVVERKLFVQRFlsekpklvkpgtpdsapvykwkferkk
MEGQNFIPLLGLNPRPSLYQSSVLTDISPKQLDFKFKEHHKLEEQNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKVYDICIQAATftvawhpkQYLLAYACDDKYDRKQDCGNLkvfgflpepikkrkrggtmsswVKAAkvnqkthrerhqpedrrklgllekkkdyrvradhfnkkkktlqiLKKKALEKNEDEFHTHMINARLVDGEHFENPKPEAEDSEEQKLLmdtqdakyvssrrvmEKRKIEKIKAGNHMIDAANQIENTHVFFVDNEAEAKKFDVVkqlktlpellprktnrlkvedIAEMSvaqhvkskmkLVKARQAeklgkrlerernlgvverklfvqrflsekpklvkpgtpdsapvykwkferkk
MEGQNFIPLLGLNPRPSLYQSSVLTDISPKQLDFKFKEHHKLEEQNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKVYDICIQAATFTVAWHPKQYLLAYACDDKYDRKQDCGNLKVFGFLPEPIKKRKRGGTMSSWVKAAKVNQKTHRERHQPEDRRKLGLLEKKKDYRVRADHFNkkkktlqilkkkalEKNEDEFHTHMINARLVDGEHFENPKPEAEDSEEQKLLMDTQDAKYVSSRRVMEKRKIEKIKAGNHMIDAANQIENTHVFFVDNEAEAKKFDVVKQLKTLPELLPRKTNRLKVEDIAEMSVAQHVKSKMKLVKARQAEKLGKRLERERNLGVVERKLFVQRFLSEKPKLVKPGTPDSAPVYKWKFERKK
******IPLLGL*****LYQSSVLTDISPKQLDFKFKEHHKLEEQNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKVYDICIQAATFTVAWHPKQYLLAYACDDKYDRKQDCGNLKVFGFLPEPI****************************************************************************MI************************************************IKAGNHMIDAANQIENTHVFFVDNEAEAKKFDVVKQLKTLPELLPR****LKV***********************************NLGVVERKLFVQRFL**************************
MEGQNFIPLLGLNPRPSLYQSSVLTDISPKQLDFKFKEHHKLEEQNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKVYDICIQAATFTVAWHPKQYLLAYACDDKYDRKQDCGNLKVFGFLPEPIKKRKRGGTMSSWVKAAKVNQKTHRERHQPEDRRKLGLLEKKKDYRVRADHFNKKKKTLQILKKKALEKNEDEFHTHMINA*********************KLLMDTQDAKYVSSRRVMEK*********************THVFFVDNEAEAKKFDVVKQLKTLPELLPRKTN*****************************************GVV***************************YKWKFERK*
MEGQNFIPLLGLNPRPSLYQSSVLTDISPKQLDFKFKEHHKLEEQNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKVYDICIQAATFTVAWHPKQYLLAYACDDKYDRKQDCGNLKVFGFLPEPIKK*********WVKAA*************EDRRKLGLLEKKKDYRVRADHFNKKKKTLQILKKKALEKNEDEFHTHMINARLVDGEHFE*************LLMDTQDAKYVSSRRVMEKRKIEKIKAGNHMIDAANQIENTHVFFVDNEAEAKKFDVVKQLKTLPELLPRKTNRLKVEDIAEMSVAQHVKSKMKLVKARQAEKLGKRLERERNLGVVERKLFVQRFLSEKPKLVKPGTPDSAPVYKWKFERKK
***QNFIPLLGLNPRPSLYQSSVLTDISPKQLDFKFKEHHKLEEQNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKVYDICIQAATFTVAWHPKQYLLAYACDDKYDRKQDCGNLKVFGFLPEPIKKRKRGGTMSSWVKAAKVNQKTHRERHQPEDRRKLGLLEKKKDYRVRADHFNKKKKTLQILKKKALEKNEDEFHTHMINARLVDGEHFENPKPEAEDSEEQKLLMDTQDAKYVSSRRVMEKRKIEKIKAGNHMIDAANQIENTHVFFVDNEAEAKKFDVVKQLKTLPELLPRKTNRLKVEDIAEMSVAQHVKSKMKLVKARQAEKLGKRLERERNLGVVERKLFVQRFLSEKPKLVKPGTPDSAPVYKWKFER**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGQNFIPLLGLNPRPSLYQSSVLTDISPKQLDFKFKEHHKLEEQNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKVYDICIQAATFTVAWHPKQYLLAYACDDKYDRKQDCGNLKVFGFLPEPIKKRKRGGTMSSWVKAAKVNQKTHRERHQPEDRRKLGLLEKKKDYRVRADHFNKKKKTLQILKKKALEKNEDEFHTHMINARLVDGEHFENPKPEAEDSEEQKLLMDTQDAKYVSSRRVMEKRKIEKIKAGNHMIDAANQIENTHVFFVDNEAEAKKFDVVKQLKTLPELLPRKTNRLKVEDIAEMSVAQHVKSKMKLVKARQAEKLGKRLERERNLGVVERKLFVQRFLSEKPKLVKPGTPDSAPVYKWKFERKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query432 2.2.26 [Sep-21-2011]
Q29RH4351 THO complex subunit 3 OS= yes N/A 0.289 0.356 0.617 7e-44
Q96J01351 THO complex subunit 3 OS= yes N/A 0.289 0.356 0.617 8e-44
Q8VE80351 THO complex subunit 3 OS= yes N/A 0.289 0.356 0.617 9e-44
Q9CZJ1253 Probable U3 small nucleol no N/A 0.564 0.964 0.418 1e-40
Q9Y3A2253 Probable U3 small nucleol no N/A 0.567 0.968 0.416 1e-40
Q9W3C0237 Probable U3 small nucleol no N/A 0.534 0.974 0.426 9e-40
Q8R5K5253 Probable U3 small nucleol no N/A 0.567 0.968 0.408 3e-39
Q09462262 Probable U3 small nucleol yes N/A 0.567 0.935 0.420 5e-39
Q9USL1309 Uncharacterized WD repeat no N/A 0.277 0.388 0.424 1e-25
Q10106249 Probable U3 small nucleol yes N/A 0.567 0.983 0.362 1e-25
>sp|Q29RH4|THOC3_BOVIN THO complex subunit 3 OS=Bos taurus GN=THOC3 PE=2 SV=1 Back     alignment and function desciption
 Score =  178 bits (452), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 79/128 (61%), Positives = 98/128 (76%), Gaps = 3/128 (2%)

Query: 48  LKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAISFSHDGA 107
           + AHP  CICI+FDP GKYFA GS DALVSLWD  EL C+R F RLDWPVR +SFSHDG 
Sbjct: 220 INAHPSNCICIKFDPMGKYFATGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGK 279

Query: 108 LIASGSEDLTIDIAHVESGKKVYDICIQAATFTVAWHPKQYLLAYACDD---KYDRKQDC 164
           ++AS SED  IDIA VE+G K++++  ++ TFTVAWHPK+ LLA+ACDD   KYD  ++ 
Sbjct: 280 MLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREA 339

Query: 165 GNLKVFGF 172
           G +K+FG 
Sbjct: 340 GTVKLFGL 347




Component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. DDX39B functions as a bridge between ALYREF/THOC4 and the THO complex.
Bos taurus (taxid: 9913)
>sp|Q96J01|THOC3_HUMAN THO complex subunit 3 OS=Homo sapiens GN=THOC3 PE=1 SV=1 Back     alignment and function description
>sp|Q8VE80|THOC3_MOUSE THO complex subunit 3 OS=Mus musculus GN=Thoc3 PE=2 SV=1 Back     alignment and function description
>sp|Q9CZJ1|UTP11_MOUSE Probable U3 small nucleolar RNA-associated protein 11 OS=Mus musculus GN=Utp11l PE=2 SV=1 Back     alignment and function description
>sp|Q9Y3A2|UTP11_HUMAN Probable U3 small nucleolar RNA-associated protein 11 OS=Homo sapiens GN=UTP11L PE=1 SV=2 Back     alignment and function description
>sp|Q9W3C0|UTP11_DROME Probable U3 small nucleolar RNA-associated protein 11 OS=Drosophila melanogaster GN=CG1789 PE=2 SV=1 Back     alignment and function description
>sp|Q8R5K5|UTP11_RAT Probable U3 small nucleolar RNA-associated protein 11 OS=Rattus norvegicus GN=Utp11l PE=2 SV=1 Back     alignment and function description
>sp|Q09462|UTP11_CAEEL Probable U3 small nucleolar RNA-associated protein 11 OS=Caenorhabditis elegans GN=C16C10.2 PE=3 SV=1 Back     alignment and function description
>sp|Q9USL1|YJKA_SCHPO Uncharacterized WD repeat-containing protein C18B5.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18B5.10c PE=4 SV=1 Back     alignment and function description
>sp|Q10106|UTP11_SCHPO Probable U3 small nucleolar RNA-associated protein 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18G6.06 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query432
242013763252 conserved hypothetical protein [Pediculu 0.569 0.976 0.501 1e-59
332024891252 Putative U3 small nucleolar RNA-associat 0.567 0.972 0.507 8e-59
307184583253 Probable U3 small nucleolar RNA-associat 0.569 0.972 0.523 1e-58
380026299253 PREDICTED: probable U3 small nucleolar R 0.569 0.972 0.488 2e-58
110751074253 PREDICTED: probable U3 small nucleolar R 0.569 0.972 0.484 2e-58
340710527253 PREDICTED: probable U3 small nucleolar R 0.569 0.972 0.484 3e-58
357621041252 UTP11-like U3 small nucleolar ribonucleo 0.567 0.972 0.5 4e-57
289742691262 putative U3 small nucleolar RNA-associat 0.571 0.942 0.473 2e-56
307203273252 Probable U3 small nucleolar RNA-associat 0.567 0.972 0.5 5e-55
156538100253 PREDICTED: probable U3 small nucleolar R 0.569 0.972 0.503 7e-55
>gi|242013763|ref|XP_002427570.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212511985|gb|EEB14832.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  237 bits (604), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/253 (50%), Positives = 181/253 (71%), Gaps = 7/253 (2%)

Query: 186 MSSWVKAAKVNQKTHRERHQPEDRRKLGLLEKKKDYRVRADHFNKKKKTLQILKKKALEK 245
           MSSW KAAK +QK HRERHQPE+R  LGLLEKKKDY++RA+ +N+KK+TL++L+K+AL K
Sbjct: 1   MSSWKKAAKSHQKNHRERHQPENRAHLGLLEKKKDYKLRAEDYNRKKRTLRLLRKRALNK 60

Query: 246 NEDEFHTHMINARLVDGEHFENPKPEAEDSEEQKLLMDTQDAKYVSSRRVMEKRKIEKIK 305
           N DEF+ HMIN+++ DG H E  K + E + EQ +LM+TQD KY++ +R ME RKIE ++
Sbjct: 61  NPDEFYFHMINSKIEDGIHHELEKDD-EHTPEQLMLMNTQDLKYITMKRTMEMRKIENLQ 119

Query: 306 AGNHMIDAANQIENTHVFFVDNEAEAKKFDVVKQLKTLPELLPRKTNRLKVEDIAEMSVA 365
           A  HM+D AN   N HVFFVD++ EAK FDVVK L T P LL ++ NR+K++++ +M + 
Sbjct: 120 AQLHMLDVANDTPNEHVFFVDSKEEAKNFDVVKHLDTHPSLLDQRINRIKLDELRKMKLN 179

Query: 366 QHVKSKMKLV--KARQAEKLGKRLERERNLGVVERKLFVQRFLSE----KPKLVKPGTPD 419
              +S   +   K +  +KL KR+ERE+ LG++++KL ++R L      +PK ++  T  
Sbjct: 180 IDEESIRNIANQKKKMYQKLAKRVEREKELGIIQQKLEIKRHLIASKHLQPKKIRNATKK 239

Query: 420 SAPVYKWKFERKK 432
           SA +YK+  ERKK
Sbjct: 240 SAAIYKFSSERKK 252




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332024891|gb|EGI65079.1| Putative U3 small nucleolar RNA-associated protein 11 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307184583|gb|EFN70923.1| Probable U3 small nucleolar RNA-associated protein 11 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380026299|ref|XP_003696889.1| PREDICTED: probable U3 small nucleolar RNA-associated protein 11-like isoform 1 [Apis florea] gi|380026301|ref|XP_003696890.1| PREDICTED: probable U3 small nucleolar RNA-associated protein 11-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|110751074|ref|XP_001120245.1| PREDICTED: probable U3 small nucleolar RNA-associated protein 11-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340710527|ref|XP_003393839.1| PREDICTED: probable U3 small nucleolar RNA-associated protein 11-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|357621041|gb|EHJ73018.1| UTP11-like U3 small nucleolar ribonucleoprotein [Danaus plexippus] Back     alignment and taxonomy information
>gi|289742691|gb|ADD20093.1| putative U3 small nucleolar RNA-associated protein 11 [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|307203273|gb|EFN82428.1| Probable U3 small nucleolar RNA-associated protein 11 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156538100|ref|XP_001608149.1| PREDICTED: probable U3 small nucleolar RNA-associated protein 11-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query432
FB|FBgn0037569320 tex "tex" [Drosophila melanoga 0.303 0.409 0.681 1.4e-46
ZFIN|ZDB-GENE-040808-14322 thoc3 "THO complex 3" [Danio r 0.291 0.391 0.638 9.3e-43
UNIPROTKB|E1BU24253 UTP11L "Uncharacterized protei 0.555 0.948 0.405 5.2e-42
UNIPROTKB|E1BDF6351 E1BDF6 "Uncharacterized protei 0.307 0.378 0.598 6.6e-42
UNIPROTKB|Q29RH4351 THOC3 "THO complex subunit 3" 0.307 0.378 0.598 6.6e-42
UNIPROTKB|E2RC43351 THOC3 "Uncharacterized protein 0.307 0.378 0.598 6.6e-42
UNIPROTKB|Q96J01351 THOC3 "THO complex subunit 3" 0.307 0.378 0.598 6.6e-42
UNIPROTKB|F1S386351 THOC3 "Uncharacterized protein 0.307 0.378 0.598 6.6e-42
MGI|MGI:1920916351 Thoc3 "THO complex 3" [Mus mus 0.307 0.378 0.598 6.6e-42
RGD|1311669351 Thoc3 "THO complex 3" [Rattus 0.307 0.378 0.598 6.6e-42
FB|FBgn0037569 tex "tex" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 488 (176.8 bits), Expect = 1.4e-46, P = 1.4e-46
 Identities = 90/132 (68%), Positives = 104/132 (78%)

Query:    42 LEEQNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAIS 101
             LE Q  LKAHP  CICIEF PTGKYFA GS DA VSLWDA EL C+R   RL+WPVR IS
Sbjct:   187 LEHQMTLKAHPANCICIEFGPTGKYFATGSADAQVSLWDANELACLRMISRLEWPVRTIS 246

Query:   102 FSHDGALIASGSEDLTIDIAHVESGKKVYDICIQAATFTVAWHPKQYLLAYACDDK-YDR 160
             FSHD  +IA  SEDL IDIA  E+G++V DI + A+TFTVAWHPKQYLLAYACD+K  DR
Sbjct:   247 FSHDERMIALASEDLIIDIAFTETGERVTDILVDASTFTVAWHPKQYLLAYACDEKDNDR 306

Query:   161 KQDCGNLKVFGF 172
             ++D GN+K++GF
Sbjct:   307 RRDAGNVKIYGF 318




GO:0005875 "microtubule associated complex" evidence=IDA
ZFIN|ZDB-GENE-040808-14 thoc3 "THO complex 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BU24 UTP11L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDF6 E1BDF6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RH4 THOC3 "THO complex subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RC43 THOC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96J01 THOC3 "THO complex subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S386 THOC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1920916 Thoc3 "THO complex 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311669 Thoc3 "THO complex 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
pfam03998239 pfam03998, Utp11, Utp11 protein 2e-64
COG5223240 COG5223, COG5223, Uncharacterized conserved protei 2e-28
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-15
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-14
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-14
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-13
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-13
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-11
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-11
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-10
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-09
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-08
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-07
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-06
smart0032040 smart00320, WD40, WD40 repeats 9e-06
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-05
smart0032040 smart00320, WD40, WD40 repeats 1e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 9e-04
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 0.002
>gnl|CDD|217834 pfam03998, Utp11, Utp11 protein Back     alignment and domain information
 Score =  206 bits (527), Expect = 2e-64
 Identities = 103/240 (42%), Positives = 148/240 (61%), Gaps = 5/240 (2%)

Query: 197 QKTHRERHQPEDRRKLGLLEKKKDYRVRADHFNKKKKTLQILKKKALEKNEDEFHTHMIN 256
           ++ HRER QPE R+ LGLLEKKKDY++RA  ++KK+KTL+ LK+KA E+N DEF+  MI+
Sbjct: 1   RRQHRERSQPESRKHLGLLEKKKDYKLRAKDYHKKEKTLKALKEKAAERNPDEFYFGMIS 60

Query: 257 ARLVDGEHFENPKPEAEDSEEQKLLMDTQDAKYVSSRRVMEKRKIEKIKAGNHMIDAANQ 316
           ++  DG H    + +   S+EQ  L+ TQD  YV ++R  E +KIEK+K   H+ D+ + 
Sbjct: 61  SKTDDGVHILKREEKEVLSKEQVKLLKTQDLNYVRTKRQAEAKKIEKLKEELHLTDSGSA 120

Query: 317 IENTHVFFVDNEAEAKKFDVVKQLKTLPELLPRKTNRLKVEDIAEMS-VAQHVKSKMKLV 375
               H+ FVD+E E K FD  +   T PELL R+ NR ++  + + S V +  K K    
Sbjct: 121 G-PKHIVFVDDEEEQKSFDPAEYFDTTPELLDRRENRPRISQLEKTSLVDEKQKKKSAKK 179

Query: 376 KARQAEKLGKRLERERNLGVVERKLFVQRFLSEKPKLVK---PGTPDSAPVYKWKFERKK 432
           K +  ++L +R ERE+ L  VE++L +QR L +K K  K       D   VYKWK ERK+
Sbjct: 180 KRKLYKELKERKEREKKLKKVEQRLELQRELMKKGKGKKKKIVKDKDGKVVYKWKKERKR 239


This protein is found to be part of a large ribonucleoprotein complex containing the U3 snoRNA. Depletion of the Utp proteins impedes production of the 18S rRNA, indicating that they are part of the active pre-rRNA processing complex. This large RNP complex has been termed the small subunit (SSU) processome. Length = 239

>gnl|CDD|227548 COG5223, COG5223, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 432
KOG3237|consensus250 100.0
PF03998243 Utp11: Utp11 protein; InterPro: IPR007144 A large 100.0
COG5223240 Uncharacterized conserved protein [Function unknow 100.0
KOG0272|consensus459 99.95
KOG0263|consensus707 99.94
KOG0271|consensus480 99.94
KOG0272|consensus459 99.94
KOG0279|consensus315 99.93
KOG0271|consensus480 99.93
KOG0286|consensus343 99.92
KOG0263|consensus707 99.91
KOG0279|consensus315 99.91
KOG0266|consensus456 99.91
KOG0266|consensus456 99.91
KOG0286|consensus343 99.89
KOG0277|consensus311 99.89
KOG0291|consensus 893 99.88
KOG0285|consensus460 99.88
KOG0295|consensus406 99.87
KOG0315|consensus311 99.87
KOG0284|consensus464 99.87
KOG0292|consensus 1202 99.87
KOG0284|consensus464 99.87
KOG0265|consensus338 99.87
KOG0273|consensus524 99.87
KOG0295|consensus406 99.87
KOG0285|consensus460 99.86
KOG0645|consensus312 99.86
PTZ00421493 coronin; Provisional 99.86
PTZ00420 568 coronin; Provisional 99.86
PTZ00421493 coronin; Provisional 99.86
KOG0276|consensus 794 99.86
KOG0276|consensus 794 99.85
KOG0273|consensus524 99.85
KOG0319|consensus775 99.84
PTZ00420568 coronin; Provisional 99.84
KOG0269|consensus 839 99.84
KOG0292|consensus 1202 99.84
KOG0282|consensus503 99.84
KOG0283|consensus712 99.84
KOG0319|consensus775 99.84
KOG0275|consensus508 99.83
KOG0293|consensus519 99.83
KOG0291|consensus893 99.83
KOG0316|consensus307 99.83
KOG0315|consensus311 99.82
KOG0645|consensus312 99.82
KOG0640|consensus430 99.81
PLN00181793 protein SPA1-RELATED; Provisional 99.81
KOG0282|consensus503 99.81
KOG0281|consensus499 99.8
KOG0647|consensus347 99.79
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.79
KOG0281|consensus499 99.79
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.79
KOG0306|consensus888 99.79
KOG0264|consensus422 99.79
KOG0274|consensus537 99.78
KOG0310|consensus487 99.78
KOG0318|consensus603 99.77
KOG0274|consensus537 99.77
KOG0277|consensus311 99.77
KOG0313|consensus423 99.77
KOG0310|consensus487 99.77
KOG0296|consensus399 99.77
KOG0275|consensus508 99.77
KOG0646|consensus476 99.76
KOG0640|consensus430 99.76
KOG0293|consensus519 99.76
KOG0316|consensus307 99.75
KOG0973|consensus 942 99.75
KOG0294|consensus362 99.75
KOG0305|consensus484 99.75
KOG0289|consensus506 99.75
KOG0318|consensus603 99.75
KOG0643|consensus327 99.75
KOG0641|consensus350 99.75
KOG0306|consensus888 99.74
KOG0302|consensus440 99.74
KOG0296|consensus399 99.74
KOG0267|consensus 825 99.74
KOG1407|consensus313 99.74
KOG0265|consensus338 99.73
PLN00181793 protein SPA1-RELATED; Provisional 99.73
KOG0973|consensus 942 99.73
KOG0264|consensus422 99.73
KOG0308|consensus 735 99.72
KOG0267|consensus 825 99.72
KOG0641|consensus350 99.72
KOG1446|consensus311 99.72
KOG0313|consensus423 99.71
KOG0278|consensus334 99.71
KOG0269|consensus 839 99.7
KOG1407|consensus313 99.7
KOG0308|consensus 735 99.7
KOG0772|consensus641 99.7
KOG0772|consensus641 99.7
KOG1273|consensus405 99.69
KOG0643|consensus327 99.69
KOG0289|consensus506 99.69
KOG1036|consensus323 99.68
KOG0283|consensus712 99.68
KOG0305|consensus484 99.68
KOG0300|consensus481 99.68
KOG0301|consensus 745 99.67
KOG0302|consensus440 99.67
KOG1273|consensus405 99.67
KOG0268|consensus433 99.65
KOG1332|consensus299 99.65
KOG0294|consensus362 99.64
KOG4283|consensus397 99.64
KOG0639|consensus705 99.63
KOG0300|consensus481 99.62
KOG4283|consensus397 99.62
KOG1063|consensus764 99.62
KOG1274|consensus 933 99.62
KOG0299|consensus479 99.61
KOG0278|consensus334 99.61
KOG0303|consensus472 99.61
KOG1446|consensus311 99.61
KOG0288|consensus459 99.6
KOG0646|consensus476 99.59
KOG0268|consensus433 99.59
KOG4328|consensus498 99.59
KOG0301|consensus 745 99.58
KOG1539|consensus910 99.58
KOG0303|consensus472 99.57
KOG0647|consensus347 99.57
KOG0642|consensus577 99.57
KOG0270|consensus463 99.57
KOG0270|consensus463 99.57
KOG0288|consensus459 99.56
KOG0299|consensus479 99.56
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.56
KOG2096|consensus420 99.54
KOG2445|consensus361 99.54
KOG1009|consensus434 99.54
KOG2048|consensus 691 99.53
KOG1445|consensus1012 99.53
KOG2096|consensus420 99.53
KOG0639|consensus705 99.52
KOG1274|consensus 933 99.51
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.5
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.48
KOG0307|consensus 1049 99.47
KOG2110|consensus391 99.46
KOG1408|consensus 1080 99.46
KOG0321|consensus 720 99.46
KOG1332|consensus299 99.45
KOG2394|consensus636 99.41
KOG1034|consensus385 99.4
KOG2055|consensus514 99.39
KOG1007|consensus370 99.39
KOG2919|consensus406 99.39
KOG1007|consensus370 99.38
KOG1538|consensus 1081 99.38
KOG4378|consensus 673 99.38
KOG1034|consensus385 99.38
KOG1408|consensus1080 99.37
KOG2055|consensus514 99.37
KOG2048|consensus 691 99.36
KOG2919|consensus406 99.36
KOG1523|consensus361 99.35
KOG0771|consensus398 99.35
KOG1310|consensus 758 99.34
KOG0649|consensus325 99.34
KOG4328|consensus498 99.34
KOG0290|consensus364 99.32
KOG1445|consensus1012 99.32
KOG2394|consensus636 99.31
KOG2110|consensus391 99.3
KOG1240|consensus1431 99.29
KOG0649|consensus325 99.28
KOG1063|consensus764 99.28
COG2319466 FOG: WD40 repeat [General function prediction only 99.28
KOG1036|consensus323 99.27
KOG0321|consensus 720 99.27
KOG2106|consensus626 99.26
KOG0322|consensus323 99.26
KOG2445|consensus361 99.25
KOG4378|consensus 673 99.24
KOG0642|consensus577 99.24
KOG2106|consensus 626 99.24
KOG1188|consensus376 99.24
KOG0307|consensus 1049 99.23
KOG1009|consensus434 99.22
KOG1310|consensus 758 99.22
PRK01742429 tolB translocation protein TolB; Provisional 99.22
KOG0290|consensus364 99.22
KOG0650|consensus733 99.21
COG2319466 FOG: WD40 repeat [General function prediction only 99.21
KOG1272|consensus545 99.21
KOG0644|consensus 1113 99.21
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.2
KOG1539|consensus 910 99.2
KOG0771|consensus398 99.18
KOG1188|consensus376 99.18
KOG1272|consensus545 99.16
KOG2111|consensus346 99.16
KOG0644|consensus 1113 99.15
KOG4227|consensus 609 99.14
PRK04922433 tolB translocation protein TolB; Provisional 99.13
PRK05137435 tolB translocation protein TolB; Provisional 99.12
KOG4227|consensus 609 99.12
PRK03629429 tolB translocation protein TolB; Provisional 99.12
PRK03629429 tolB translocation protein TolB; Provisional 99.11
PRK01742429 tolB translocation protein TolB; Provisional 99.11
PRK02889427 tolB translocation protein TolB; Provisional 99.1
KOG1523|consensus361 99.08
PRK11028330 6-phosphogluconolactonase; Provisional 99.07
KOG1963|consensus 792 99.05
KOG2139|consensus445 99.05
KOG0974|consensus 967 99.05
KOG2111|consensus346 99.05
PRK11028330 6-phosphogluconolactonase; Provisional 99.04
PRK04922433 tolB translocation protein TolB; Provisional 99.03
KOG2139|consensus445 99.03
KOG1524|consensus 737 99.03
PRK05137435 tolB translocation protein TolB; Provisional 99.03
KOG1524|consensus 737 99.02
PRK01029428 tolB translocation protein TolB; Provisional 99.02
PRK02889427 tolB translocation protein TolB; Provisional 98.99
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.98
KOG0650|consensus733 98.98
KOG3881|consensus412 98.97
KOG1587|consensus555 98.94
PRK00178430 tolB translocation protein TolB; Provisional 98.91
KOG0280|consensus339 98.9
PRK04792448 tolB translocation protein TolB; Provisional 98.89
KOG1587|consensus555 98.89
KOG2321|consensus 703 98.87
KOG1517|consensus1387 98.86
KOG2315|consensus566 98.86
KOG1538|consensus 1081 98.85
KOG3881|consensus412 98.85
KOG0974|consensus 967 98.84
KOG1963|consensus 792 98.83
PRK00178430 tolB translocation protein TolB; Provisional 98.82
KOG1517|consensus1387 98.81
KOG0322|consensus323 98.78
KOG2321|consensus703 98.77
KOG4547|consensus 541 98.77
PRK01029428 tolB translocation protein TolB; Provisional 98.74
KOG1064|consensus2439 98.73
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.73
KOG0309|consensus 1081 98.69
PRK04792448 tolB translocation protein TolB; Provisional 98.69
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.67
KOG0280|consensus339 98.67
KOG4497|consensus447 98.66
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.65
KOG4497|consensus447 98.61
PRK04043419 tolB translocation protein TolB; Provisional 98.58
KOG4547|consensus541 98.57
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.57
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.57
KOG1409|consensus404 98.55
KOG3914|consensus390 98.53
KOG3914|consensus390 98.51
COG4946668 Uncharacterized protein related to the periplasmic 98.48
KOG2695|consensus425 98.47
KOG1240|consensus1431 98.42
PRK04043419 tolB translocation protein TolB; Provisional 98.42
KOG2315|consensus566 98.39
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.35
KOG4532|consensus344 98.34
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.33
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.32
KOG4190|consensus1034 98.28
KOG1912|consensus 1062 98.28
KOG2314|consensus 698 98.27
KOG1334|consensus559 98.27
KOG1354|consensus433 98.24
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.23
KOG4714|consensus319 98.22
COG4946668 Uncharacterized protein related to the periplasmic 98.22
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.21
KOG1409|consensus404 98.21
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.19
KOG1334|consensus559 98.19
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.13
KOG1064|consensus2439 98.12
KOG2041|consensus 1189 98.12
KOG2695|consensus425 98.12
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.04
KOG2066|consensus 846 98.02
KOG4714|consensus319 98.0
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.0
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.99
KOG2314|consensus698 97.98
KOG0309|consensus 1081 97.96
PRK02888635 nitrous-oxide reductase; Validated 97.93
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.92
KOG2041|consensus 1189 97.9
KOG1354|consensus433 97.9
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.87
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.87
KOG1645|consensus463 97.87
KOG4190|consensus1034 97.85
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.83
KOG4532|consensus344 97.82
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 97.81
KOG1832|consensus1516 97.75
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.68
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.63
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.63
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.62
KOG2066|consensus 846 97.59
KOG4640|consensus 665 97.58
KOG1275|consensus 1118 97.57
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.56
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.54
KOG3617|consensus 1416 97.52
KOG1645|consensus463 97.52
KOG1912|consensus 1062 97.47
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.47
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 97.47
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.42
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.37
KOG3621|consensus 726 97.37
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.36
KOG1275|consensus 1118 97.21
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.17
KOG1008|consensus 783 97.14
KOG0882|consensus558 97.1
KOG1008|consensus 783 97.08
KOG1832|consensus1516 97.03
PRK13616591 lipoprotein LpqB; Provisional 97.02
KOG2114|consensus 933 97.01
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.0
KOG0882|consensus558 97.0
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.98
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 96.97
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.93
KOG1920|consensus 1265 96.91
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 96.9
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 96.64
KOG4640|consensus 665 96.63
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.62
COG3391381 Uncharacterized conserved protein [Function unknow 96.59
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.54
PRK02888635 nitrous-oxide reductase; Validated 96.44
KOG3617|consensus 1416 96.35
PRK13616591 lipoprotein LpqB; Provisional 96.33
KOG2079|consensus 1206 96.31
COG3391381 Uncharacterized conserved protein [Function unknow 96.26
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.24
KOG1920|consensus 1265 96.22
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.19
KOG3621|consensus 726 96.03
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 95.98
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.97
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.96
KOG2444|consensus238 95.94
KOG4649|consensus354 95.91
KOG2114|consensus 933 95.9
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.89
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 95.87
KOG2395|consensus644 95.76
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.69
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.56
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.51
KOG4649|consensus354 95.49
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.48
KOG2079|consensus 1206 95.32
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 95.32
KOG4499|consensus310 95.13
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 95.1
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.01
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 94.93
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 94.89
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 94.88
PRK10115 686 protease 2; Provisional 94.84
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 94.75
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.64
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.55
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.37
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 94.26
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 94.24
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.2
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.11
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.09
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.53
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.47
KOG3630|consensus 1405 93.1
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 93.05
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 92.81
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 92.49
KOG3630|consensus 1405 92.45
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 92.41
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 92.37
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 91.83
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 91.83
PRK10115 686 protease 2; Provisional 91.81
KOG2444|consensus238 91.79
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 91.75
KOG2395|consensus644 91.61
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 91.51
COG3386307 Gluconolactonase [Carbohydrate transport and metab 91.29
KOG4441|consensus571 91.11
PHA02713557 hypothetical protein; Provisional 91.0
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 90.98
KOG1916|consensus 1283 90.85
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 90.74
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 90.71
KOG4499|consensus310 90.69
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 90.46
KOG2377|consensus 657 90.46
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 90.04
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 89.76
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 89.75
KOG4441|consensus571 89.12
PRK13684334 Ycf48-like protein; Provisional 89.01
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 88.75
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 88.75
PF13449326 Phytase-like: Esterase-like activity of phytase 88.71
KOG4460|consensus 741 88.56
KOG1916|consensus 1283 88.52
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 88.15
PHA03098534 kelch-like protein; Provisional 88.04
TIGR03032335 conserved hypothetical protein TIGR03032. This pro 88.0
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 87.85
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 87.47
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 87.38
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 87.36
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 87.04
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 87.0
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 86.91
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 86.01
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 85.56
PHA03098534 kelch-like protein; Provisional 85.49
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 85.45
PF13449326 Phytase-like: Esterase-like activity of phytase 84.88
PHA02713557 hypothetical protein; Provisional 84.75
PF12768281 Rax2: Cortical protein marker for cell polarity 83.69
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 83.39
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 81.37
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 81.25
COG5167776 VID27 Protein involved in vacuole import and degra 81.09
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 80.89
PF05935477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 80.88
COG3204316 Uncharacterized protein conserved in bacteria [Fun 80.75
>KOG3237|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-68  Score=466.63  Aligned_cols=246  Identities=48%  Similarity=0.664  Sum_probs=234.1

Q ss_pred             chhhhHHhhhcccccccccCccccccccceeccCcceeecccchhHHHHHHHHHHHHhhhCCCcceeeeeeeeeecceee
Q psy9319         186 MSSWVKAAKVNQKTHRERHQPEDRRKLGLLEKKKDYRVRADHFNKKKKTLQILKKKALEKNEDEFHTHMINARLVDGEHF  265 (432)
Q Consensus       186 mss~~~a~~~~~~~h~er~qp~~r~~~glLe~~~D~~lR~~d~~~k~~~l~~L~~ka~~~np~ef~~~m~~~~~~~g~~~  265 (432)
                      ||||.++..+.+++|++|+||..|.++|+||+++||++|+.||+.++.+|+.||++|+++|||||||+|+++++.+|+|+
T Consensus         1 mss~~~a~ks~rk~HRERsQP~~Rrk~G~LEKkKDY~~RA~dy~kKq~tLK~LrekA~eKNpDEfyh~M~~~K~~dG~hi   80 (250)
T KOG3237|consen    1 MSSFVNASKSRRKVHRERSQPEARRKYGFLEKKKDYKKRAQDYHKKQDTLKKLREKALEKNPDEFYHKMHNSKTKDGRHI   80 (250)
T ss_pred             CcchhhcchhhhhHHHhhcChhHHHhhhhHHhhhHHHHHHHHHHHHHHHHHHHHHHHHhcChHHHHHHHhhccccCCccc
Confidence            79999999988999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCCCCCCCCHHHHHHhhhcchhHHHHHHHHHHHHHHHHHhcccccccccCCCCceEEEEeChHHhhccChhhhcccccc
Q psy9319         266 ENPKPEAEDSEEQKLLMDTQDAKYVSSRRVMEKRKIEKIKAGNHMIDAANQIENTHVFFVDNEAEAKKFDVVKQLKTLPE  345 (432)
Q Consensus       266 ~~~~~~~~~~~~~~~~~~tqd~~y~~~~~~~~~~ki~~l~~~l~~~~~~~~~~~~~~~f~d~~~~~~~~~~~~~~~~~~~  345 (432)
                      +....+ ++|+|||+||+|||++||+++|++|++|||+|.++||+++.....+|+||+||||.+|+++|||+.+|+|+++
T Consensus        81 ~k~e~~-e~t~eqlklmktQDi~YV~~kr~~ErkKIerlka~L~~~~~~~~~s~kH~~F~d~~~ea~~Fdp~~~f~tt~e  159 (250)
T KOG3237|consen   81 EKDEVD-EPTMEQLKLMKTQDIGYVRMKRQRERKKIERLKAQLHCVDRNKGESNKHTKFVDDREEAKSFDPAKFFQTTLE  159 (250)
T ss_pred             cccccc-cCCHHHHHHHhhhhHHHHHHHHHHHHHHHHHHhcccccccccccccCceeEEeccHHHHhccChHHHhcccHH
Confidence            998777 7999999999999999999999999999999999999999766779999999999999999999999999999


Q ss_pred             ccccccCCCchhhhhhhhh-hhchhhHHhHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCC-ceeCCCCCCCC
Q psy9319         346 LLPRKTNRLKVEDIAEMSV-AQHVKSKMKLV--KARQAEKLGKRLERERNLGVVERKLFVQRFLSEKP-KLVKPGTPDSA  421 (432)
Q Consensus       346 ~~~~~~~~~~~~~l~~~~~-~~~~~~~~~~~--~~~~~~~l~~~~~r~~~l~~~~~~~~~~~~~~~~~-~~~~~~~~~~~  421 (432)
                      |++|.+||++.++++.... ..++..++.++  +.++|++|.+|.+|+++|.+|+++|+|++.||+|+ +|+++++.+++
T Consensus       160 lv~R~~nr~~keei~~~~~~~~~~~~~k~~~k~~~k~~~eL~kR~eR~k~L~~v~qkv~l~k~L~~k~~~k~Kk~~v~~~  239 (250)
T KOG3237|consen  160 LVGRSENRLKKEEIQKEISKATSPMPKKSLDKKKQKRYNELKKRREREKKLNVVEQKVELQKELQKKKKRKVKKKTVDSP  239 (250)
T ss_pred             HhhhhhhhhhHHHHHHHHHhccCccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccchhhccch
Confidence            9999999999999988765 23556666666  88999999999999999999999999999999998 89999999999


Q ss_pred             ceeeeccccCC
Q psy9319         422 PVYKWKFERKK  432 (432)
Q Consensus       422 ~~~k~~~~rk~  432 (432)
                      |||||.++|||
T Consensus       240 ~vyk~~~erkr  250 (250)
T KOG3237|consen  240 AVYKWRYERKR  250 (250)
T ss_pred             hhhcchhhccC
Confidence            99999999997



>PF03998 Utp11: Utp11 protein; InterPro: IPR007144 A large ribonuclear protein complex is required for the processing of the small-ribosomal-subunit rRNA - the small-subunit (SSU) processome [, ] Back     alignment and domain information
>COG5223 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>TIGR03032 conserved hypothetical protein TIGR03032 Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query432
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 3e-07
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 6e-07
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 9e-07
2gnq_A336 Structure Of Wdr5 Length = 336 1e-06
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 1e-06
2h9l_A329 Wdr5delta23 Length = 329 1e-06
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 1e-06
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-06
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-06
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-06
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-06
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-06
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-06
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-06
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-06
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-06
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-06
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-06
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-06
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 9e-06
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 1e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 1e-05
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 3e-04
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure

Iteration: 1

Score = 53.1 bits (126), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 39/122 (31%), Positives = 54/122 (44%), Gaps = 11/122 (9%) Query: 45 QNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAELTCIRTFQRLDWPVRAISFSH 104 + LK H + I FD +GK A S D + LWD CIRT D V ++S Sbjct: 143 ERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMP 202 Query: 105 DGALIASGSEDLTIDIAHVESGKKVYDICIQAATFTVAW----HPKQ--YLLAYACDDKY 158 +G I S S D TI + V++G C++ T W P Q L+A +D+ Sbjct: 203 NGDHIVSASRDKTIKMWEVQTG-----YCVKTFTGHREWVRMVRPNQDGTLIASCSNDQT 257 Query: 159 DR 160 R Sbjct: 258 VR 259
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query432
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.96
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.95
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.94
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.94
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.94
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.94
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.94
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.94
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.93
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.93
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.93
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.93
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.93
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.93
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.93
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.93
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.92
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.92
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.92
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.92
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.92
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.92
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.91
2pm7_B297 Protein transport protein SEC13, protein transport 99.91
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.91
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.91
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.91
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.91
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.91
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.9
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.9
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.9
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.9
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.9
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.9
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.9
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.9
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.9
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.89
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.89
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.89
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.89
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.89
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.89
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.89
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.89
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.89
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.88
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.88
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.88
3jrp_A379 Fusion protein of protein transport protein SEC13 99.88
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.88
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.88
2pm7_B297 Protein transport protein SEC13, protein transport 99.88
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.88
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.88
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.88
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.87
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.87
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.87
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.87
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.87
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.87
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.87
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.87
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.87
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.86
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.86
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.86
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.86
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.86
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.86
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.86
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.86
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.86
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.85
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.85
3jrp_A379 Fusion protein of protein transport protein SEC13 99.85
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.85
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.85
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.85
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.85
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.85
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.85
3jro_A 753 Fusion protein of protein transport protein SEC13 99.85
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.84
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.84
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.84
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.84
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.84
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.84
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.84
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.84
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.84
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.84
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.84
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.84
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.84
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.83
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.83
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.83
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.83
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.83
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.83
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.82
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.82
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.82
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.82
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.82
3jro_A 753 Fusion protein of protein transport protein SEC13 99.82
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.81
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.81
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.81
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.81
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.81
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.81
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.8
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.79
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.78
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.78
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.77
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.76
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.76
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.74
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.74
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.73
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.72
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.7
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.69
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.66
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.61
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.55
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.54
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.53
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.52
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.5
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.5
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.5
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.5
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.49
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.48
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.48
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.48
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.47
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.46
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.44
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.43
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.43
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.43
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.42
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.41
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.41
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.41
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.4
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.39
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.38
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.37
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.36
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.32
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.3
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.27
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.26
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.23
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.23
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.23
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.21
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.2
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.17
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.15
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.13
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.13
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.13
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.11
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.1
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.08
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.08
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.06
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.06
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.05
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.01
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.0
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 98.99
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.98
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 98.95
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 98.95
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.93
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.93
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.93
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 98.9
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.89
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.85
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.84
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.84
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.84
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.77
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.74
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.71
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.68
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.67
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.64
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.62
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.59
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.58
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.57
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.55
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.55
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.54
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.53
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.49
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.49
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.47
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.45
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.44
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.41
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.41
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.4
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.4
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.4
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.39
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.34
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.34
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.31
2qe8_A343 Uncharacterized protein; structural genomics, join 98.3
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.21
2qe8_A343 Uncharacterized protein; structural genomics, join 98.2
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.19
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.19
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.17
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.16
2ece_A462 462AA long hypothetical selenium-binding protein; 98.13
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.09
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.03
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.02
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 97.98
2ece_A462 462AA long hypothetical selenium-binding protein; 97.98
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.92
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.89
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.75
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.71
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.69
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.68
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.64
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 97.64
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.6
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.59
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.58
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.53
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 97.47
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.47
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.37
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.36
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.33
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.31
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.3
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.28
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.26
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.22
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.16
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.1
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.09
3v65_B386 Low-density lipoprotein receptor-related protein; 97.07
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.03
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.01
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.01
3v65_B386 Low-density lipoprotein receptor-related protein; 96.84
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.81
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 96.8
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 96.71
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 96.67
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.66
4a2l_A795 BT_4663, two-component system sensor histidine kin 96.57
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 96.49
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.47
3kya_A496 Putative phosphatase; structural genomics, joint c 96.43
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.43
3p5b_L400 Low density lipoprotein receptor variant; B-propel 96.34
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 96.31
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.27
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.23
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 96.22
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.19
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.17
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 96.16
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 96.03
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.89
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 95.82
3v9f_A781 Two-component system sensor histidine kinase/RESP 95.77
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.75
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 95.71
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 95.71
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 95.46
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.21
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 95.06
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.06
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 95.04
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.02
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 95.01
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 94.93
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 94.59
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 94.56
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 94.47
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 94.43
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 94.43
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 94.23
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.21
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 94.13
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 94.09
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 93.84
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 93.78
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 93.47
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 93.02
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 92.51
3kya_A496 Putative phosphatase; structural genomics, joint c 92.47
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 92.07
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 91.91
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 91.56
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 91.46
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 91.32
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 91.15
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 90.95
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 90.94
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 90.79
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 90.7
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 90.35
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 90.34
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 89.74
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 89.26
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 88.33
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 88.23
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 87.09
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 86.83
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 86.51
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 86.24
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 86.04
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 85.8
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 85.53
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 84.92
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 84.46
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=99.96  E-value=3.5e-27  Score=226.86  Aligned_cols=206  Identities=14%  Similarity=0.168  Sum_probs=174.2

Q ss_pred             CcccccccCCCCcceeeeeeecCCCceeEEEEeecCcceeeEEEccCCcCEEEEEEcCCCCEEEEEeCCCeEEEEeCCCC
Q psy9319           5 NFIPLLGLNPRPSLYQSSVLTDISPKQLDFKFKEHHKLEEQNILKAHPVTCICIEFDPTGKYFAVGSKDALVSLWDAAEL   84 (432)
Q Consensus         5 n~I~~l~~~p~~~~l~~s~s~D~~~~~~~i~~~d~~~~~~~~~l~~h~~~V~~l~~spdg~~L~sgs~dg~I~iwd~~~~   84 (432)
                      +.|.+++|+|++..+ ++++.|+     .+++||..++..+..+.+|..+|.+++|+|++++|++|+.|++|++||+.++
T Consensus        14 ~~V~~~~fsp~~~~l-~s~~~dg-----~v~lWd~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~s~d~~i~vwd~~~~   87 (304)
T 2ynn_A           14 DRVKGIDFHPTEPWV-LTTLYSG-----RVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTG   87 (304)
T ss_dssp             SCEEEEEECSSSSEE-EEEETTS-----EEEEEETTTTEEEEEEECCSSCEEEEEEEGGGTEEEEEETTSEEEEEETTTC
T ss_pred             CceEEEEECCCCCEE-EEEcCCC-----cEEEEECCCCceeEEeeccCCcEEEEEEeCCCCEEEEECCCCEEEEEECCCC
Confidence            468999999999877 7777776     4567788899999999999999999999999999999999999999999999


Q ss_pred             eeEEEEeeCCCCEEEEEEeeCCCEEEEEeCCCeEEEEeCCCCcEE-EEEe-cCCceEEEEEcc-CCcEEEEEECCCeEEE
Q psy9319          85 TCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKV-YDIC-IQAATFTVAWHP-KQYLLAYACDDKYDRK  161 (432)
Q Consensus        85 ~~~~~~~~h~~~V~~i~~spdg~~l~sgs~dg~V~vwd~~~~~~~-~~~~-~~~~V~~l~fsp-dg~~l~s~s~d~~I~v  161 (432)
                      .++..+.+|...|.+++|+|++.+|++|+.|++|++||+.++..+ ..+. |...|.+++|+| ++..|++|+.|+.|++
T Consensus        88 ~~~~~~~~h~~~v~~~~~~~~~~~l~sgs~D~~v~lWd~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~l~sgs~D~~v~i  167 (304)
T 2ynn_A           88 EKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKV  167 (304)
T ss_dssp             CEEEEEECCSSCEEEEEECSSSSEEEEEETTSCEEEEEGGGTTEEEEEECCCCSCEEEEEECTTCTTEEEEEETTSEEEE
T ss_pred             cEEEEEeCCCCcEEEEEEcCCCCEEEEECCCCeEEEEECCCCcchhhhhcccCCcEEEEEECCCCCCEEEEEeCCCeEEE
Confidence            999999999999999999999999999999999999999988544 4444 888999999999 6799999999999999


Q ss_pred             EeCC-------------------------------------ceEEeecCCCceeeeecCCCchhhhHHhhhccccccccc
Q psy9319         162 QDCG-------------------------------------NLKVFGFLPEPIKKRKRGGTMSSWVKAAKVNQKTHRERH  204 (432)
Q Consensus       162 wd~~-------------------------------------~i~vwd~~~~~~~~~~~g~~mss~~~a~~~~~~~h~er~  204 (432)
                      ||++                                     .|++||+.++.++..+.+|.....           ....
T Consensus       168 wd~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~l~s~s~D~~i~iWd~~~~~~~~~~~~h~~~v~-----------~~~~  236 (304)
T 2ynn_A          168 WSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVS-----------FAVF  236 (304)
T ss_dssp             EETTCSSCSEEEECCCTTCEEEEEECCSTTCCEEEEEETTSEEEEEETTTTEEEEEEECCSSCEE-----------EEEE
T ss_pred             EECCCCCccceeccCCcCcEEEEEEEEcCCCCEEEEEcCCCeEEEEeCCCCccceeeCCCCCCEE-----------EEEE
Confidence            9962                                     267788887777777777643211           1112


Q ss_pred             CccccccccceeccCcceeecccchh
Q psy9319         205 QPEDRRKLGLLEKKKDYRVRADHFNK  230 (432)
Q Consensus       205 qp~~r~~~glLe~~~D~~lR~~d~~~  230 (432)
                      .|.+..   +++++.|..+|+||...
T Consensus       237 ~p~~~~---l~s~s~Dg~i~iWd~~~  259 (304)
T 2ynn_A          237 HPTLPI---IISGSEDGTLKIWNSST  259 (304)
T ss_dssp             CSSSSE---EEEEETTSCEEEEETTT
T ss_pred             CCCCCE---EEEEcCCCeEEEEECCC
Confidence            344444   88999999999999765



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 432
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-15
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-14
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-05
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-15
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-04
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-14
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-13
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-07
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-06
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-14
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 6e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.001
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-07
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.003
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 6e-12
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-12
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-09
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.003
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 9e-11
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-07
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-10
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 6e-09
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-09
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-09
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-08
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 7e-08
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-07
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 5e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 7e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-05
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 6e-08
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 4e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.002
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-05
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.004
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.003
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 6e-06
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 8e-04
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 7e-06
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 0.001
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.001
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.003
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.001
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 74.4 bits (181), Expect = 2e-15
 Identities = 23/143 (16%), Positives = 54/143 (37%), Gaps = 9/143 (6%)

Query: 24  LTDISPKQLDFKFKEHHKL--------EEQNILKAHPVTCICIEFDPTGKYFAVGSKDAL 75
           +  ++ K+   + +EH  +        E      +        +    G +   GS+D  
Sbjct: 169 VWVVATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKT 228

Query: 76  VSLWDAAELTCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKVYDI-CI 134
           + +WD +   C+ T    D  VR + F   G  I S ++D T+ +   ++ + +  +   
Sbjct: 229 IKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAH 288

Query: 135 QAATFTVAWHPKQYLLAYACDDK 157
           +    ++ +H     +     D+
Sbjct: 289 EHFVTSLDFHKTAPYVVTGSVDQ 311


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query432
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.92
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.92
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.91
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.9
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.89
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.88
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.88
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.88
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.88
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.87
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.85
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.85
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.84
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.84
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.84
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.84
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.81
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.79
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.77
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.75
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.75
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.72
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.71
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.71
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.71
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.7
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.7
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.68
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.68
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.67
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.51
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.49
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.47
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.45
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.43
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.42
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.41
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.41
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.37
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.28
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.17
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.16
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.15
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.07
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.04
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.0
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.9
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.78
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 98.75
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.71
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.4
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.34
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.29
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.27
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.13
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.06
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.05
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.02
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.93
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.9
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.88
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.86
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.8
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.8
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.73
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.67
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.53
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.49
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.38
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.2
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.15
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.5
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.48
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.01
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.95
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 95.28
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 94.43
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 94.05
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.04
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 93.77
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 93.49
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 93.24
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.24
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 91.9
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 91.78
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 91.72
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 91.67
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 90.76
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.41
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 90.03
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.94
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 88.77
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 87.68
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 87.18
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 86.72
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 85.73
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 81.37
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]
Probab=99.92  E-value=5.5e-24  Score=203.20  Aligned_cols=199  Identities=17%  Similarity=0.155  Sum_probs=162.4

Q ss_pred             CcccccccCCCCcceeeeeeecCCCceeEEEEeecCcceeeEEEccCCcCEEEEEEcCCCCE-EEEEeCCCeEEEEeCCC
Q psy9319           5 NFIPLLGLNPRPSLYQSSVLTDISPKQLDFKFKEHHKLEEQNILKAHPVTCICIEFDPTGKY-FAVGSKDALVSLWDAAE   83 (432)
Q Consensus         5 n~I~~l~~~p~~~~l~~s~s~D~~~~~~~i~~~d~~~~~~~~~l~~h~~~V~~l~~spdg~~-L~sgs~dg~I~iwd~~~   83 (432)
                      ..|.+++|+|++..+ ++++.+..   ..+.+|+..+++....+.+|...|++++|+|++.+ |++|+.|+.|++||+.+
T Consensus       103 ~~v~~v~~s~d~~~l-~~~~~~~~---~~~~v~~~~~~~~~~~l~~h~~~v~~v~~~~~~~~~l~sgs~d~~i~i~d~~~  178 (311)
T d1nr0a1         103 GPVKDISWDSESKRI-AAVGEGRE---RFGHVFLFDTGTSNGNLTGQARAMNSVDFKPSRPFRIISGSDDNTVAIFEGPP  178 (311)
T ss_dssp             SCEEEEEECTTSCEE-EEEECCSS---CSEEEEETTTCCBCBCCCCCSSCEEEEEECSSSSCEEEEEETTSCEEEEETTT
T ss_pred             Ccccccccccccccc-cccccccc---ccccccccccccccccccccccccccccccccceeeecccccccccccccccc
Confidence            467899999999877 45444322   23566777788899999999999999999999875 78899999999999999


Q ss_pred             CeeEEEEeeCCCCEEEEEEeeCCCEEEEEeCCCeEEEEeCCCCcEEEEEe--------cCCceEEEEEccCCcEEEEEEC
Q psy9319          84 LTCIRTFQRLDWPVRAISFSHDGALIASGSEDLTIDIAHVESGKKVYDIC--------IQAATFTVAWHPKQYLLAYACD  155 (432)
Q Consensus        84 ~~~~~~~~~h~~~V~~i~~spdg~~l~sgs~dg~V~vwd~~~~~~~~~~~--------~~~~V~~l~fspdg~~l~s~s~  155 (432)
                      +.....+.+|..+|+++.|+|++.+|++|+.|+.|++||+.++..+..+.        |.+.|.+++|+|++.+|++|+.
T Consensus       179 ~~~~~~~~~~~~~i~~v~~~p~~~~l~~~~~d~~v~~~d~~~~~~~~~~~~~~~~~~~h~~~V~~~~~s~~~~~l~tgs~  258 (311)
T d1nr0a1         179 FKFKSTFGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVDGTKTGVFEDDSLKNVAHSGSVFGLTWSPDGTKIASASA  258 (311)
T ss_dssp             BEEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEECBCTTSSSCSSSSCEEEEEECTTSSEEEEEET
T ss_pred             cccccccccccccccccccCccccccccccccccccccccccccccccccccccccccccccccccccCCCCCEEEEEeC
Confidence            99999999999999999999999999999999999999999998887763        5678999999999999999999


Q ss_pred             CCeEEEEeCCceEEeecCCCceeeeecCCCchhhhHHhhhcccccccccCccccccccceeccCcceeecccc
Q psy9319         156 DKYDRKQDCGNLKVFGFLPEPIKKRKRGGTMSSWVKAAKVNQKTHRERHQPEDRRKLGLLEKKKDYRVRADHF  228 (432)
Q Consensus       156 d~~I~vwd~~~i~vwd~~~~~~~~~~~g~~mss~~~a~~~~~~~h~er~qp~~r~~~glLe~~~D~~lR~~d~  228 (432)
                      |+.        |++||+.++.++..+..+.-.......          ..+..   -.++.+..|..|++||.
T Consensus       259 Dg~--------v~iwd~~t~~~~~~l~~~~~~~~~~~~----------~~~~~---~~l~s~s~dG~i~~wd~  310 (311)
T d1nr0a1         259 DKT--------IKIWNVATLKVEKTIPVGTRIEDQQLG----------IIWTK---QALVSISANGFINFVNP  310 (311)
T ss_dssp             TSE--------EEEEETTTTEEEEEEECCSSGGGCEEE----------EEECS---SCEEEEETTCCEEEEET
T ss_pred             CCe--------EEEEECCCCcEEEEEECCCCccceEEE----------EEecC---CEEEEEECCCEEEEEeC
Confidence            999        777777788888777655321110000          01111   23788899999999986



>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure