Psyllid ID: psy9327


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-
MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGKLVLSMKSKHPIWKYCKPVKYCNPKHTLHICNRKMEPLCNIHENTRVKSGAWDESGVFIYTTSNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVSKSFFEGSFETAFKLLHDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTRKGPGIKENSHPATNIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQIINICKEYIVGTNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQK
cccccccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEEEcccEEEEccEEEEEEEcccccEEEEEEccccEEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEEccccccEEEEEEcccEEEEEEccccEEEEEcccccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEcccEEEEEEcccEEEEEEEEEcccEEEEcccccEEEEEEEEccHHHHHHHHcccEEEcccccEEEEEEccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEcccHHHHHHHcccccccEEccccHHHHHHHHccccEEEEcccccccEEEcccccccccccccccEEEEEHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHHcEEEEEEcccEEHHHcccccccEEEEccEEEEEEEcccEEEEEEcccccEEEEEccccEEEEHHHHcccHHHHHHHHHcccccHHHHHHHHHcc
cccEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEcccccEcccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEcccccccEEEEEEccccccccccccccccEEEEEEccccEEEEEEcccccEEEEcccccccEEEEEEccccEEEEEcccccEEEEEEEEEEEEccccEEEEEEcccccEEEEEEccccEEEEEEcccccHHHHHHccccccEEEEEEEEEEEHHHcccccEEEEcHHHccccccHHHccccHHcccccccccccccccccccccccHHHHcccccccHHHHHHccccHHHHHHHHHHccccEccHcHHHHHHHHHHccccccccccccccEEEEcccccHHHcccccccEcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcEEEEEccHHHHHHHHHHHHHHccEEEEEHHHHHEcccccccEEEEcccEEEEEEEcccEEEEEcccccEEEEEEccHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHcc
MLTKFETKSArvkglsfhpkrpwilssLHNGVIQLWDYRMNTLLEkfdehegpvrgicfhnqqpifvsgGKMIVMAYQGCilesrnepcLFRIksvlgddykikVWNYKQRKCIFTLLGHLDYIRttffhheypwilsasddqTIRIWYWQSRNcicvltghnhyvmcaqfhptddivvsasldQTIRVWDIsglrkknvapgmGKLVLSMkskhpiwkyckpvkycnpkhtlhicnrkmeplcnihentrvksgawdesgvFIYTTSNHIKYAIVngdhgiirtldlpiyitkikgnqvyyldrecsphvlridpteFKFKLALINHKYEEVLHIVRNSRLVGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESnlrtadpnatlptvhpeaqllrppapvaeaetnwplltvsksffEGSFETAFKLLHDQIGVKNFLPYRQMFLNSYLqsrtaystlpllapvmafptrkgpgikenshpatnIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQIINICKEYIVGTNHIKYAIVngdhgiirtldlpiyitkikgnqvyyldrecsphvlridpteFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQK
mltkfetksarvkglsfhpkrpwilsSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVwdisglrkknvapgmGKLVLSMKSKHPIWKYCKPVKYCNPKHTLHICNRKMEPLCNIHentrvksgawdESGVFIYTTSNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVSKSFFEGSFETAFKLLHDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTRKGPGIKENSHPATNIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQIINICKEYIVGTNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQK
MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGKLVLSMKSKHPIWKYCKPVKYCNPKHTLHICNRKMEPLCNIHENTRVKSGAWDESGVFIYTTSNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGEVGERIKILKSCGQTSLAYLTAATHGlseeaaelesNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVSKSFFEGSFETAFKLLHDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTRKGPGIKENSHPATNIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQIINICKEYIVGTNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQK
**************LSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGKLVLSMKSKHPIWKYCKPVKYCNPKHTLHICNRKMEPLCNIHENTRVKSGAWDESGVFIYTTSNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGEVGERIKILKSCGQTSLAYLTAATHG***************************************AETNWPLLTVSKSFFEGSFETAFKLLHDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTR***********ATNIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQIINICKEYIVGTNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYL***
MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGKLVLSMKSKHPIWKYCKPVKYCNPKHTLHICNRKMEPLCNIHENTRVKSGAWDESGVFIYTTSNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRP*APVAEAETNWPLLTVSKSFFEGSFETAFKLLHDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTRKGP***ENSHPATNIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQIINICKEYIVGTNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQK
*************GLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGKLVLSMKSKHPIWKYCKPVKYCNPKHTLHICNRKMEPLCNIHENTRVKSGAWDESGVFIYTTSNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVSKSFFEGSFETAFKLLHDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTRKGPGIKENSHPATNIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQIINICKEYIVGTNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQK
*LTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGKLVLSMKSKHPIWKYCKPVKYCNPKHTLHICNRKMEPLCNIHENTRVKSGAWDESGVFIYTTSNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVSKSFFEGSFETAFKLLHDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTRKGPGIKENSHPATNIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQIINICKEYIVGTNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGKLVLSMKSKHPIWKYCKPVKYCNPKHTLHICNRKMEPLCNIHENTRVKSGAWDESGVFIYTTSNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGEVGERIKILKSCGQTSLAYLTAATHGLSEEAAELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVSKSFFEGSFETAFKLLHDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTRKGPGIKENSHPATNIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQIINICKEYIVGTNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEVLHIVRNSRLVGQSIIAYLQQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query641 2.2.26 [Sep-21-2011]
P53621 1224 Coatomer subunit alpha OS yes N/A 0.273 0.142 0.763 3e-92
Q27954 1224 Coatomer subunit alpha OS yes N/A 0.273 0.142 0.758 6e-92
Q8CIE6 1224 Coatomer subunit alpha OS yes N/A 0.273 0.142 0.758 8e-92
Q94A40 1216 Coatomer subunit alpha-1 yes N/A 0.316 0.166 0.640 6e-85
Q9SJT9 1218 Coatomer subunit alpha-2 no N/A 0.273 0.143 0.694 2e-83
Q0J3D9 1218 Coatomer subunit alpha-3 yes N/A 0.316 0.166 0.627 1e-82
Q9AUR8 1218 Coatomer subunit alpha-1 yes N/A 0.316 0.166 0.627 1e-82
Q9AUR7 1218 Coatomer subunit alpha-2 yes N/A 0.316 0.166 0.627 4e-82
Q96WV5 1207 Putative coatomer subunit yes N/A 0.271 0.144 0.643 1e-79
P53622 1201 Coatomer subunit alpha OS yes N/A 0.291 0.155 0.581 2e-74
>sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 Back     alignment and function desciption
 Score =  340 bits (871), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 155/203 (76%), Positives = 169/203 (83%), Gaps = 28/203 (13%)

Query: 1   MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFH 60
           MLTKFETKSARVKGLSFHPKRPWIL+SLHNGVIQLWDYRM TL++KFDEH+GPVRGI FH
Sbjct: 1   MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH 60

Query: 61  NQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGH 120
            QQP+FVSGG                            DDYKIKVWNYK R+C+FTLLGH
Sbjct: 61  KQQPLFVSGG----------------------------DDYKIKVWNYKLRRCLFTLLGH 92

Query: 121 LDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVS 180
           LDYIRTTFFHHEYPWILSASDDQTIR+W WQSR C+CVLTGHNHYVMCAQFHPT+D+VVS
Sbjct: 93  LDYIRTTFFHHEYPWILSASDDQTIRVWNWQSRTCVCVLTGHNHYVMCAQFHPTEDLVVS 152

Query: 181 ASLDQTIRVWDISGLRKKNVAPG 203
           ASLDQT+RVWDISGLRKKN++PG
Sbjct: 153 ASLDQTVRVWDISGLRKKNLSPG 175




Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor.
Homo sapiens (taxid: 9606)
>sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 Back     alignment and function description
>sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 Back     alignment and function description
>sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=1 SV=2 Back     alignment and function description
>sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 Back     alignment and function description
>sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 Back     alignment and function description
>sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 Back     alignment and function description
>sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 Back     alignment and function description
>sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 Back     alignment and function description
>sp|P53622|COPA_YEAST Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query641
242015300 1222 coatomer alpha subunit, putative [Pedicu 0.279 0.146 0.797 9e-96
322780808 1209 hypothetical protein SINV_04529 [Solenop 0.288 0.153 0.769 1e-94
307188017 1208 Coatomer subunit alpha [Camponotus flori 0.288 0.153 0.769 3e-94
332026185 1209 Coatomer subunit alpha [Acromyrmex echin 0.288 0.153 0.765 7e-94
291222576 1223 PREDICTED: coatomer protein complex subu 0.288 0.151 0.760 2e-93
291222578 1209 PREDICTED: coatomer protein complex subu 0.288 0.153 0.760 2e-93
66504662 1214 PREDICTED: coatomer subunit alpha isofor 0.288 0.152 0.765 4e-93
380014926 1214 PREDICTED: LOW QUALITY PROTEIN: coatomer 0.288 0.152 0.765 5e-93
345488489 1146 PREDICTED: coatomer subunit alpha-like [ 0.279 0.156 0.782 8e-93
383850572 1214 PREDICTED: coatomer subunit alpha [Megac 0.288 0.152 0.755 4e-92
>gi|242015300|ref|XP_002428302.1| coatomer alpha subunit, putative [Pediculus humanus corporis] gi|212512887|gb|EEB15564.1| coatomer alpha subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  357 bits (917), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 165/207 (79%), Positives = 175/207 (84%), Gaps = 28/207 (13%)

Query: 1   MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFH 60
           MLTKFETKSARVKGLSFHPKRPWIL+SLHNGVIQLWDYRM TLL+KFDEH+GPVRGICFH
Sbjct: 1   MLTKFETKSARVKGLSFHPKRPWILASLHNGVIQLWDYRMCTLLDKFDEHDGPVRGICFH 60

Query: 61  NQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGH 120
           NQQP+FVSGG                            DDYKIKVWNYKQR+CIFTLLGH
Sbjct: 61  NQQPLFVSGG----------------------------DDYKIKVWNYKQRRCIFTLLGH 92

Query: 121 LDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVS 180
           LDYIRTT+FHHEYPWILSASDDQTIRIW WQSRNCICVLTGHNHYVMCAQFHP++DI+VS
Sbjct: 93  LDYIRTTYFHHEYPWILSASDDQTIRIWNWQSRNCICVLTGHNHYVMCAQFHPSEDIIVS 152

Query: 181 ASLDQTIRVWDISGLRKKNVAPGMGKL 207
           ASLDQT+RVWDISGLRKKNVAPG G L
Sbjct: 153 ASLDQTVRVWDISGLRKKNVAPGPGGL 179




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322780808|gb|EFZ10037.1| hypothetical protein SINV_04529 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307188017|gb|EFN72866.1| Coatomer subunit alpha [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332026185|gb|EGI66327.1| Coatomer subunit alpha [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|291222576|ref|XP_002731289.1| PREDICTED: coatomer protein complex subunit alpha-like isoform 1 [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|291222578|ref|XP_002731290.1| PREDICTED: coatomer protein complex subunit alpha-like isoform 2 [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|66504662|ref|XP_623198.1| PREDICTED: coatomer subunit alpha isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380014926|ref|XP_003691465.1| PREDICTED: LOW QUALITY PROTEIN: coatomer subunit alpha-like [Apis florea] Back     alignment and taxonomy information
>gi|345488489|ref|XP_001601104.2| PREDICTED: coatomer subunit alpha-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383850572|ref|XP_003700869.1| PREDICTED: coatomer subunit alpha [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query641
UNIPROTKB|G3V6T1 1224 Copa "Protein Copa" [Rattus no 0.251 0.131 0.628 3.8e-168
UNIPROTKB|F1RJX8 1224 COPA "Uncharacterized protein" 0.251 0.131 0.628 3.8e-168
UNIPROTKB|P53621 1224 COPA "Coatomer subunit alpha" 0.251 0.131 0.634 4.6e-168
UNIPROTKB|Q27954 1224 COPA "Coatomer subunit alpha" 0.251 0.131 0.628 7.8e-168
MGI|MGI:1334462 1224 Copa "coatomer protein complex 0.251 0.131 0.628 1.3e-167
UNIPROTKB|F1PU93 1214 COPA "Coatomer subunit alpha" 0.165 0.087 0.877 2.4e-165
ZFIN|ZDB-GENE-020905-2 1226 copa "coatomer protein complex 0.251 0.131 0.634 3e-162
UNIPROTKB|H9KZL3 1169 LOC100859596 "Uncharacterized 0.251 0.137 0.628 2.1e-150
UNIPROTKB|H9L3L2 1134 LOC100859596 "Uncharacterized 0.251 0.141 0.628 3e-150
FB|FBgn0025725 1234 alphaCop "alpha-coatomer prote 0.269 0.140 0.632 3.8e-138
UNIPROTKB|G3V6T1 Copa "Protein Copa" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 575 (207.5 bits), Expect = 3.8e-168, Sum P(4) = 3.8e-168
 Identities = 110/175 (62%), Positives = 132/175 (75%)

Query:    43 LLEKFDEHEGPVRGICFHNQQP-IFVS--GGKMIVMAYQGCIL----ESRNEPCL---FR 92
             +L KF+     V+G+ FH ++P I  S   G + +  Y+ C L    +  + P     F 
Sbjct:     1 MLTKFETKSARVKGLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFH 60

Query:    93 IKSVL----GDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIW 148
              +  L    GDDYKIKVWNYK R+C+FTLLGHLDYIRTTFFHHEYPWILSASDDQTIR+W
Sbjct:    61 KQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRVW 120

Query:   149 YWQSRNCICVLTGHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPG 203
              WQSR C+CVLTGHNHYVMCAQFHP++D+VVSASLDQT+RVWDISGLRKKN++PG
Sbjct:   121 NWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISGLRKKNLSPG 175


GO:0005198 "structural molecule activity" evidence=IEA
GO:0005615 "extracellular space" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0030126 "COPI vesicle coat" evidence=IEA
GO:0030157 "pancreatic juice secretion" evidence=IEA
UNIPROTKB|F1RJX8 COPA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P53621 COPA "Coatomer subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q27954 COPA "Coatomer subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1334462 Copa "coatomer protein complex subunit alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PU93 COPA "Coatomer subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020905-2 copa "coatomer protein complex, subunit alpha" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZL3 LOC100859596 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9L3L2 LOC100859596 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0025725 alphaCop "alpha-coatomer protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
pfam06957421 pfam06957, COPI_C, Coatomer (COPI) alpha subunit C 8e-47
pfam04053429 pfam04053, Coatomer_WDAD, Coatomer WD associated r 8e-38
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-37
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-32
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-32
pfam04053 429 pfam04053, Coatomer_WDAD, Coatomer WD associated r 4e-28
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-22
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-18
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 8e-15
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-14
smart0032040 smart00320, WD40, WD40 repeats 9e-10
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-07
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 3e-06
smart0032040 smart00320, WD40, WD40 repeats 4e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 4e-06
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-05
pfam04053429 pfam04053, Coatomer_WDAD, Coatomer WD associated r 3e-04
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 8e-04
>gnl|CDD|219240 pfam06957, COPI_C, Coatomer (COPI) alpha subunit C-terminus Back     alignment and domain information
 Score =  170 bits (432), Expect = 8e-47
 Identities = 70/131 (53%), Positives = 92/131 (70%), Gaps = 3/131 (2%)

Query: 426 GSFETAFKLLHDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTR--KGPGIK 483
           GSFETA +LLHDQ+GV NF P++ +FL  Y  SRT+Y  LP L  V  +P R       K
Sbjct: 131 GSFETAMRLLHDQLGVVNFAPFKDLFLQLYAGSRTSYRALPGLPSVSIYPERNWSESNSK 190

Query: 484 ENSHPATNIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQ 543
            N  PA   KL QL  ++Q  YQLTT+GKF +A+EK R++L+SIPL+VV +K+E+ EA+Q
Sbjct: 191 -NGPPAVGFKLSQLAKRLQAAYQLTTNGKFGEAVEKFRSILLSIPLIVVDSKQEVAEAQQ 249

Query: 544 IINICKEYIVG 554
           +I IC+EYIVG
Sbjct: 250 LITICREYIVG 260


This family represents the C-terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit. Coatomer (COPI) is a large cytosolic protein complex which forms a coat around vesicles budding from the Golgi apparatus. Such coatomer-coated vesicles have been proposed to play a role in many distinct steps of intracellular transport. Note that many family members also contain the pfam04053 domain. Length = 421

>gnl|CDD|217864 pfam04053, Coatomer_WDAD, Coatomer WD associated region Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|217864 pfam04053, Coatomer_WDAD, Coatomer WD associated region Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|217864 pfam04053, Coatomer_WDAD, Coatomer WD associated region Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 641
KOG0292|consensus1202 100.0
KOG0292|consensus 1202 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0272|consensus459 100.0
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 100.0
KOG0276|consensus 794 100.0
KOG0279|consensus315 100.0
KOG0271|consensus480 100.0
KOG0286|consensus343 100.0
KOG0285|consensus460 100.0
KOG0279|consensus315 100.0
KOG0284|consensus464 100.0
KOG0276|consensus 794 99.97
KOG0275|consensus508 99.97
KOG0273|consensus524 99.97
KOG0263|consensus707 99.97
KOG0295|consensus406 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0266|consensus456 99.97
KOG0645|consensus312 99.97
KOG0284|consensus464 99.97
KOG0296|consensus399 99.97
KOG0263|consensus707 99.97
KOG0286|consensus343 99.96
KOG0265|consensus338 99.96
KOG0315|consensus311 99.96
KOG0318|consensus603 99.96
KOG0282|consensus503 99.96
KOG0266|consensus456 99.96
KOG0318|consensus603 99.96
KOG0291|consensus893 99.96
KOG0316|consensus307 99.96
KOG0285|consensus460 99.96
KOG0291|consensus893 99.96
KOG0281|consensus499 99.96
KOG0295|consensus406 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG0273|consensus524 99.95
KOG0281|consensus499 99.95
KOG0645|consensus312 99.95
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.95
KOG0315|consensus311 99.95
KOG0319|consensus775 99.94
KOG0265|consensus338 99.94
KOG0283|consensus712 99.94
KOG0319|consensus775 99.94
KOG0274|consensus537 99.94
KOG0310|consensus487 99.94
PTZ00421493 coronin; Provisional 99.93
PTZ00421493 coronin; Provisional 99.93
KOG0310|consensus487 99.93
KOG0274|consensus537 99.93
KOG0301|consensus 745 99.93
PTZ00420568 coronin; Provisional 99.93
KOG0278|consensus334 99.93
KOG0300|consensus481 99.93
KOG0293|consensus519 99.93
PLN00181793 protein SPA1-RELATED; Provisional 99.92
KOG0643|consensus327 99.92
KOG0316|consensus307 99.92
KOG0282|consensus503 99.92
KOG0277|consensus311 99.92
KOG0296|consensus399 99.92
KOG0289|consensus506 99.92
KOG0973|consensus 942 99.92
KOG0305|consensus484 99.92
KOG1407|consensus313 99.92
KOG0640|consensus430 99.91
PTZ00420568 coronin; Provisional 99.91
KOG0973|consensus 942 99.91
KOG0268|consensus433 99.91
KOG0313|consensus423 99.91
KOG0289|consensus506 99.91
KOG0275|consensus508 99.91
KOG0288|consensus459 99.91
KOG0772|consensus641 99.91
KOG0308|consensus735 99.91
KOG0306|consensus888 99.91
KOG0294|consensus362 99.9
KOG0278|consensus334 99.9
KOG0313|consensus423 99.9
KOG1446|consensus311 99.9
KOG0267|consensus 825 99.9
KOG2096|consensus420 99.9
KOG0299|consensus479 99.9
KOG0300|consensus481 99.89
KOG0299|consensus479 99.89
KOG0277|consensus311 99.89
KOG0640|consensus430 99.89
KOG0306|consensus888 99.89
KOG0641|consensus350 99.89
KOG0643|consensus327 99.89
KOG0308|consensus735 99.89
KOG0269|consensus 839 99.88
KOG0647|consensus347 99.88
KOG0301|consensus745 99.88
KOG4283|consensus397 99.88
KOG1332|consensus299 99.88
KOG1036|consensus323 99.88
KOG0283|consensus712 99.87
KOG0288|consensus459 99.87
KOG0305|consensus484 99.87
KOG1274|consensus 933 99.87
KOG0641|consensus350 99.87
KOG0264|consensus422 99.86
KOG0267|consensus 825 99.86
KOG0294|consensus362 99.86
KOG4328|consensus498 99.85
KOG0293|consensus519 99.85
KOG1408|consensus1080 99.84
KOG0264|consensus422 99.84
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 99.84
KOG1446|consensus311 99.83
KOG2106|consensus626 99.83
KOG1273|consensus405 99.83
KOG0646|consensus476 99.83
KOG1407|consensus313 99.82
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.82
KOG0269|consensus839 99.82
KOG0321|consensus720 99.81
KOG2048|consensus691 99.81
KOG0639|consensus705 99.81
KOG0302|consensus440 99.81
KOG0302|consensus440 99.8
KOG1332|consensus299 99.8
KOG1539|consensus910 99.8
KOG2055|consensus514 99.79
KOG0646|consensus476 99.79
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.79
KOG0650|consensus733 99.79
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 99.78
KOG0647|consensus347 99.78
KOG1539|consensus910 99.78
KOG0639|consensus705 99.78
KOG0268|consensus433 99.76
KOG0772|consensus641 99.76
KOG4283|consensus397 99.76
KOG0649|consensus325 99.76
KOG0270|consensus463 99.76
KOG1034|consensus385 99.75
KOG0321|consensus720 99.74
KOG1009|consensus434 99.74
KOG0270|consensus463 99.74
KOG1063|consensus764 99.74
KOG1034|consensus385 99.74
KOG2445|consensus361 99.73
KOG2106|consensus626 99.73
KOG1408|consensus1080 99.71
KOG0642|consensus577 99.71
COG2319466 FOG: WD40 repeat [General function prediction only 99.7
KOG1188|consensus376 99.7
KOG4378|consensus673 99.7
KOG0303|consensus472 99.7
COG2319466 FOG: WD40 repeat [General function prediction only 99.7
KOG1274|consensus 933 99.7
KOG4378|consensus673 99.7
KOG1036|consensus323 99.7
KOG2055|consensus514 99.7
KOG0303|consensus472 99.7
KOG0307|consensus 1049 99.7
KOG0644|consensus 1113 99.68
KOG4328|consensus498 99.68
KOG1007|consensus370 99.67
KOG1063|consensus764 99.66
KOG1538|consensus 1081 99.66
KOG2048|consensus691 99.66
KOG2919|consensus406 99.65
KOG1188|consensus376 99.64
KOG0649|consensus325 99.64
KOG0307|consensus 1049 99.63
KOG1273|consensus405 99.62
KOG1524|consensus737 99.62
KOG1523|consensus361 99.61
KOG4227|consensus609 99.59
KOG2445|consensus361 99.58
KOG1007|consensus370 99.57
KOG1310|consensus758 99.57
KOG2110|consensus391 99.57
KOG1240|consensus1431 99.56
KOG1538|consensus 1081 99.56
KOG2110|consensus391 99.56
KOG0642|consensus577 99.55
KOG2919|consensus406 99.55
KOG0771|consensus398 99.54
KOG0322|consensus323 99.53
KOG1524|consensus 737 99.53
KOG1587|consensus555 99.52
PRK11028330 6-phosphogluconolactonase; Provisional 99.52
KOG0650|consensus733 99.52
KOG1009|consensus434 99.52
KOG1517|consensus1387 99.52
KOG1445|consensus1012 99.5
KOG0644|consensus 1113 99.5
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.48
KOG0290|consensus364 99.47
KOG1445|consensus1012 99.46
KOG2394|consensus636 99.46
KOG0322|consensus323 99.46
KOG2096|consensus420 99.46
KOG1272|consensus545 99.45
PRK01742429 tolB translocation protein TolB; Provisional 99.45
KOG1587|consensus555 99.44
KOG1334|consensus559 99.41
PRK11028330 6-phosphogluconolactonase; Provisional 99.4
KOG2139|consensus445 99.39
PRK05137435 tolB translocation protein TolB; Provisional 99.39
PRK04922433 tolB translocation protein TolB; Provisional 99.38
PRK01742429 tolB translocation protein TolB; Provisional 99.38
PRK03629429 tolB translocation protein TolB; Provisional 99.36
KOG2321|consensus703 99.36
KOG0290|consensus364 99.35
PRK02889427 tolB translocation protein TolB; Provisional 99.34
KOG1963|consensus792 99.32
KOG4497|consensus447 99.32
KOG1963|consensus792 99.31
KOG1523|consensus361 99.3
KOG2111|consensus346 99.29
KOG2394|consensus636 99.29
KOG4497|consensus447 99.29
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.28
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.27
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.27
KOG1310|consensus 758 99.25
PRK05137435 tolB translocation protein TolB; Provisional 99.24
KOG2111|consensus346 99.23
KOG1272|consensus545 99.2
KOG1409|consensus404 99.2
KOG3881|consensus412 99.19
KOG0974|consensus 967 99.19
KOG4227|consensus609 99.18
KOG0974|consensus 967 99.17
KOG4547|consensus541 99.17
PRK00178430 tolB translocation protein TolB; Provisional 99.15
KOG0771|consensus398 99.15
PRK03629429 tolB translocation protein TolB; Provisional 99.14
KOG1240|consensus1431 99.12
PRK02889427 tolB translocation protein TolB; Provisional 99.12
PRK04922433 tolB translocation protein TolB; Provisional 99.11
PRK04792448 tolB translocation protein TolB; Provisional 99.1
KOG1517|consensus1387 99.09
KOG1064|consensus2439 99.07
KOG4190|consensus1034 99.07
PRK01029428 tolB translocation protein TolB; Provisional 99.04
KOG3914|consensus390 99.03
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.03
KOG1832|consensus1516 99.03
KOG0280|consensus339 99.0
KOG3881|consensus412 98.99
KOG1409|consensus404 98.96
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.96
KOG2041|consensus 1189 98.94
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.94
KOG4547|consensus541 98.93
KOG1334|consensus559 98.93
KOG2321|consensus703 98.9
PRK00178430 tolB translocation protein TolB; Provisional 98.88
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.88
KOG1354|consensus433 98.86
KOG2139|consensus445 98.83
KOG0309|consensus 1081 98.82
PRK04792448 tolB translocation protein TolB; Provisional 98.81
PRK01029428 tolB translocation protein TolB; Provisional 98.8
KOG1354|consensus433 98.79
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.79
KOG0309|consensus 1081 98.77
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.76
KOG1064|consensus2439 98.75
KOG2695|consensus425 98.74
KOG2315|consensus566 98.73
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.69
KOG4714|consensus319 98.69
KOG1912|consensus 1062 98.68
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.65
COG4946668 Uncharacterized protein related to the periplasmic 98.64
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.63
KOG0280|consensus339 98.63
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.62
KOG4190|consensus1034 98.62
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.58
KOG2114|consensus 933 98.56
PRK04043419 tolB translocation protein TolB; Provisional 98.56
KOG2315|consensus566 98.56
COG4946668 Uncharacterized protein related to the periplasmic 98.56
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.53
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.53
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.51
KOG2314|consensus698 98.5
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.5
KOG2066|consensus 846 98.5
KOG3914|consensus390 98.5
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.49
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.49
KOG2695|consensus425 98.46
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.4
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.39
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.37
KOG1275|consensus 1118 98.34
KOG3617|consensus 1416 98.33
KOG1912|consensus 1062 98.33
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.32
KOG2314|consensus698 98.24
KOG4714|consensus319 98.23
KOG0882|consensus558 98.23
KOG4532|consensus344 98.22
PRK04043419 tolB translocation protein TolB; Provisional 98.21
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.21
KOG4532|consensus344 98.21
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.2
KOG3621|consensus726 98.19
KOG4649|consensus354 98.17
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.17
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.15
KOG2041|consensus 1189 98.13
KOG2066|consensus 846 98.13
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.13
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.09
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.03
KOG0882|consensus558 98.01
KOG1275|consensus 1118 97.99
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.95
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.93
KOG3617|consensus 1416 97.88
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.87
KOG1920|consensus 1265 97.84
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.83
KOG2114|consensus 933 97.79
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.72
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 97.66
KOG1645|consensus463 97.55
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.54
KOG1832|consensus1516 97.52
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.38
KOG3621|consensus 726 97.37
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.32
KOG1008|consensus783 97.31
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.31
KOG1920|consensus 1265 97.3
PRK02888635 nitrous-oxide reductase; Validated 97.19
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.12
PRK02888635 nitrous-oxide reductase; Validated 97.09
KOG4640|consensus665 97.09
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.07
KOG1645|consensus463 96.99
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.93
KOG4640|consensus665 96.9
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.87
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.75
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.65
COG3391381 Uncharacterized conserved protein [Function unknow 96.62
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.61
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.58
KOG1008|consensus 783 96.55
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.49
COG3391381 Uncharacterized conserved protein [Function unknow 96.46
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.44
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.4
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.39
KOG4649|consensus354 96.38
PF15390671 DUF4613: Domain of unknown function (DUF4613) 96.37
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.36
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.32
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.25
KOG2079|consensus 1206 96.22
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.21
KOG2079|consensus 1206 96.19
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.18
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.12
PRK13616591 lipoprotein LpqB; Provisional 96.12
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.02
KOG2444|consensus238 96.01
KOG2395|consensus644 95.9
KOG4499|consensus310 95.72
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.61
KOG2395|consensus644 95.59
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 95.35
KOG2444|consensus238 95.22
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.19
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.17
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.99
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.96
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.18
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 94.15
KOG1916|consensus 1283 94.04
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.97
PRK13616591 lipoprotein LpqB; Provisional 93.79
PF14727418 PHTB1_N: PTHB1 N-terminus 93.63
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 93.56
KOG1916|consensus 1283 93.27
COG3204316 Uncharacterized protein conserved in bacteria [Fun 93.08
PHA02713557 hypothetical protein; Provisional 92.97
PRK13684334 Ycf48-like protein; Provisional 92.91
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 92.64
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 92.52
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 92.51
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 92.5
KOG4441|consensus571 91.5
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 91.12
PRK10115686 protease 2; Provisional 90.73
PHA03098534 kelch-like protein; Provisional 90.36
PRK10115686 protease 2; Provisional 90.27
PF15390671 DUF4613: Domain of unknown function (DUF4613) 90.24
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 89.9
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 89.64
KOG4460|consensus741 89.61
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 89.58
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 89.46
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 89.43
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 89.38
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 89.13
PHA02713557 hypothetical protein; Provisional 89.11
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 89.08
PHA03098534 kelch-like protein; Provisional 89.06
KOG2247|consensus615 88.99
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 88.93
KOG2280|consensus 829 88.89
PLN00033398 photosystem II stability/assembly factor; Provisio 88.88
KOG2280|consensus 829 88.84
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 88.76
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 88.51
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 87.83
KOG4499|consensus310 87.65
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 87.4
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 87.38
KOG3630|consensus 1405 87.32
KOG1900|consensus 1311 87.32
COG5167776 VID27 Protein involved in vacuole import and degra 87.24
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 87.18
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 86.77
COG5167776 VID27 Protein involved in vacuole import and degra 86.51
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 86.24
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 85.05
KOG3630|consensus 1405 84.97
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 84.96
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 84.96
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 84.64
KOG1897|consensus1096 84.02
PF13449326 Phytase-like: Esterase-like activity of phytase 83.76
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 82.47
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 82.11
PHA02790480 Kelch-like protein; Provisional 81.23
PHA02790480 Kelch-like protein; Provisional 80.93
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 80.76
KOG2377|consensus657 80.69
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 80.65
>KOG0292|consensus Back     alignment and domain information
Probab=100.00  E-value=9e-100  Score=809.87  Aligned_cols=554  Identities=62%  Similarity=1.064  Sum_probs=506.2

Q ss_pred             CceeeccCCCCeEEEEEccCCCeEEEEeCCCcEEEEECccCcccccccccccCeEEEEEeCCCCEEEEeceeeEEeeece
Q psy9327           1 MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGC   80 (641)
Q Consensus         1 ll~~~~~H~~~V~~l~fspdg~~Lasg~~dg~I~iWD~~~~~~l~~~~~h~~~V~~i~fsp~~~~l~sgs~~~~~~~~~~   80 (641)
                      |+++|+..+++|++++|||..+|++++.++|.|++||++++.++.+|.+|++||++++|||++++|+|||          
T Consensus         1 mltkfEskSsRvKglsFHP~rPwILtslHsG~IQlWDYRM~tli~rFdeHdGpVRgv~FH~~qplFVSGG----------   70 (1202)
T KOG0292|consen    1 MLTKFESKSSRVKGLSFHPKRPWILTSLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVDFHPTQPLFVSGG----------   70 (1202)
T ss_pred             CcchhhcccccccceecCCCCCEEEEeecCceeeeehhhhhhHHhhhhccCCccceeeecCCCCeEEecC----------
Confidence            7899999999999999999999999999999999999999999999999999999999999999999998          


Q ss_pred             eeecccCCcceeeEEEeeCCCeEEEEECCCCeeEEEEccCCCCeEEEEEccCCCEEEEEeCCCeEEEEECCCCeeEEEEc
Q psy9327          81 ILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLT  160 (641)
Q Consensus        81 ~~~~~~~~~~~~~~~~~s~Dg~I~vWD~~t~~~~~~~~~h~~~V~~v~fsp~~~~l~sgs~Dg~I~vWd~~~~~~i~~l~  160 (641)
                                        +|.+|+||++++.++++++.||.++|+.+.||+..|||+|+|+|++|+||||++++|+..+.
T Consensus        71 ------------------DDykIkVWnYk~rrclftL~GHlDYVRt~~FHheyPWIlSASDDQTIrIWNwqsr~~iavlt  132 (1202)
T KOG0292|consen   71 ------------------DDYKIKVWNYKTRRCLFTLLGHLDYVRTVFFHHEYPWILSASDDQTIRIWNWQSRKCIAVLT  132 (1202)
T ss_pred             ------------------CccEEEEEecccceehhhhccccceeEEeeccCCCceEEEccCCCeEEEEeccCCceEEEEe
Confidence                              99999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCEEEEEEecCCCEEEEEeCCCeEEEEecCCCceeeeccCC---------------C------ceee-------ecc
Q psy9327         161 GHNHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGM---------------G------KLVL-------SMK  212 (641)
Q Consensus       161 ~h~~~V~sl~fsp~g~~lvSgs~DgtI~IWD~~~~~~~~~~~~~---------------~------~~v~-------s~~  212 (641)
                      ||+++|+|.+|||..+.++|||.|++|||||+.+.+.....++.               +      +.|+       ...
T Consensus       133 GHnHYVMcAqFhptEDlIVSaSLDQTVRVWDisGLRkk~~~pg~~e~~~~~~~~~~dLfg~~DaVVK~VLEGHDRGVNwa  212 (1202)
T KOG0292|consen  133 GHNHYVMCAQFHPTEDLIVSASLDQTVRVWDISGLRKKNKAPGSLEDQMRGQQGNSDLFGQTDAVVKHVLEGHDRGVNWA  212 (1202)
T ss_pred             cCceEEEeeccCCccceEEEecccceEEEEeecchhccCCCCCCchhhhhccccchhhcCCcCeeeeeeecccccccceE
Confidence            99999999999999999999999999999999987776655540               0      0000       000


Q ss_pred             cCCC-----------------------------------------------------------cee--------------
Q psy9327         213 SKHP-----------------------------------------------------------IWK--------------  219 (641)
Q Consensus       213 ~~~~-----------------------------------------------------------v~~--------------  219 (641)
                      ++||                                                           +|+              
T Consensus       213 AfhpTlpliVSG~DDRqVKlWrmnetKaWEvDtcrgH~nnVssvlfhp~q~lIlSnsEDksirVwDm~kRt~v~tfrren  292 (1202)
T KOG0292|consen  213 AFHPTLPLIVSGADDRQVKLWRMNETKAWEVDTCRGHYNNVSSVLFHPHQDLILSNSEDKSIRVWDMTKRTSVQTFRREN  292 (1202)
T ss_pred             EecCCcceEEecCCcceeeEEEeccccceeehhhhcccCCcceEEecCccceeEecCCCccEEEEecccccceeeeeccC
Confidence            1111                                                           111              


Q ss_pred             --------------------------------------------------------------------------------
Q psy9327         220 --------------------------------------------------------------------------------  219 (641)
Q Consensus       220 --------------------------------------------------------------------------------  219 (641)
                                                                                                      
T Consensus       293 dRFW~laahP~lNLfAAgHDsGm~VFkleRErpa~~v~~n~LfYvkd~~i~~~d~~t~~d~~v~~lr~~g~~~~~~~sms  372 (1202)
T KOG0292|consen  293 DRFWILAAHPELNLFAAGHDSGMIVFKLERERPAYAVNGNGLFYVKDRFIRSYDLRTQKDTAVASLRRPGTLWQPPRSLS  372 (1202)
T ss_pred             CeEEEEEecCCcceeeeecCCceEEEEEcccCceEEEcCCEEEEEccceEEeeeccccccceeEeccCCCcccCCcceee
Confidence                                                                                            


Q ss_pred             ---------eeee-------------------------------------------------------------------
Q psy9327         220 ---------YCKP-------------------------------------------------------------------  223 (641)
Q Consensus       220 ---------~~~~-------------------------------------------------------------------  223 (641)
                               +|..                                                                   
T Consensus       373 YNpae~~vlics~~~n~~y~L~~ipk~~~~~~~~~~~~k~tG~~a~fvarNrfavl~k~~~~v~ik~l~N~vtkkl~~~~  452 (1202)
T KOG0292|consen  373 YNPAENAVLICSNLDNGEYELVQIPKDSDGVSDGKDVKKGTGEGALFVARNRFAVLDKSNEQVVIKNLKNKVTKKLLLPE  452 (1202)
T ss_pred             eccccCeEEEEeccCCCeEEEEEecCcccccCCchhhhcCCCCceEEEEecceEEEEecCcceEEecccchhhhcccCcc
Confidence                     0000                                                                   


Q ss_pred             --------------------------------------------------eeeeCCCeeEEEecCCCcceeeecCCcceE
Q psy9327         224 --------------------------------------------------VKYCNPKHTLHICNRKMEPLCNIHENTRVK  253 (641)
Q Consensus       224 --------------------------------------------------l~s~~~d~~I~i~d~~~~~~~~~~~~~~I~  253 (641)
                                                                        .++--++|+|.|++++++.++++++..+|.
T Consensus       453 ~~~~IF~ag~g~lll~~~~~v~lfdvQq~~~~~si~~s~vkyvvws~dm~~vAll~Kh~i~i~~kkL~l~~sihEtirik  532 (1202)
T KOG0292|consen  453 STDDIFYAGTGNLLLRSPDSVTLFDVQQKKKVGSIKVSKVKYVVWSNDMSRVALLSKHTITIADKKLELLCSIHETIRIK  532 (1202)
T ss_pred             cccceeeccCccEEEEcCCeEEEEEeecceEEEEEecCceeEEEEcCccchhhhcccceEEEEecchhheecchheeEee
Confidence                                                              001116899999999999999999999999


Q ss_pred             EEEEcCCccEEEEecCCeEEEEEcCCCCeEeccccceEEEEEcCcEEEEEeCCCCeEEEEeCCcchhhhHHHhccchHHH
Q psy9327         254 SGAWDESGVFIYTTSNHIKYAIVNGDHGIIRTLDLPIYITKIKGNQVYYLDRECSPHVLRIDPTEFKFKLALINHKYEEV  333 (641)
Q Consensus       254 sla~~p~g~~L~t~s~~~k~~l~~~~~g~I~~~d~p~~~~~~~g~~v~~~~~dg~i~v~~~~~~~~~~k~~l~~~~~~~~  333 (641)
                      +.+|+.+|.+|++++++.+|.+-+|+.|.|+++|.|+|+++..|+.++|+++|+.+.+..+|+.+|+||+++.+++|+++
T Consensus       533 sgawde~gVfiYtT~nHikYal~~GD~GIikTLd~~iyitkv~gn~V~cl~rd~~~~~~~IDptEy~FKlALi~k~ydeV  612 (1202)
T KOG0292|consen  533 SGAWDEDGVFIYTTLNHIKYALENGDSGIIKTLDKPIYITKVKGNKVFCLNRDGEIECLTIDPTEYRFKLALLNKKYDEV  612 (1202)
T ss_pred             eceeccCceEEEEehhhhhhhhccCCcceEEecccceEEEEeeCCEEEEEecCCCeEEEeechHHHHHHHHHHhhhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCcccc---------------------------------------------------------------------
Q psy9327         334 LHIVRNSRLVG---------------------------------------------------------------------  344 (641)
Q Consensus       334 l~~~~~s~l~~---------------------------------------------------------------------  344 (641)
                      ++|+++++|+|                                                                     
T Consensus       613 l~lI~ns~LvGqaiIaYLqKkgypeiAL~FVkD~~tRF~LaLe~gnle~ale~akkldd~d~w~rLge~Al~qgn~~IaE  692 (1202)
T KOG0292|consen  613 LHLIKNSNLVGQAIIAYLQKKGYPEIALHFVKDERTRFELALECGNLEVALEAAKKLDDKDVWERLGEEALRQGNHQIAE  692 (1202)
T ss_pred             HHHHHhcCcccHHHHHHHHhcCCcceeeeeecCcchheeeehhcCCHHHHHHHHHhcCcHHHHHHHHHHHHHhcchHHHH
Confidence            99999999999                                                                     


Q ss_pred             -------------------------------------------------chHHHHHHHHhcCCccchhhhhhhcCCcHHH
Q psy9327         345 -------------------------------------------------EVGERIKILKSCGQTSLAYLTAATHGLSEEA  375 (641)
Q Consensus       345 -------------------------------------------------D~~~r~~~l~~~g~~~la~~~a~~~~~~~~~  375 (641)
                                                                       |+++|++|++++|++|+||++|++||+++.|
T Consensus       693 m~yQ~~knfekLsfLYliTgn~eKL~Km~~iae~r~D~~~~~qnalYl~dv~ervkIl~n~g~~~laylta~~~G~~~~a  772 (1202)
T KOG0292|consen  693 MCYQRTKNFEKLSFLYLITGNLEKLSKMMKIAEIRNDATGQFQNALYLGDVKERVKILENGGQLPLAYLTAAAHGLEDQA  772 (1202)
T ss_pred             HHHHHhhhhhheeEEEEEeCCHHHHHHHHHHHHhhhhhHHHHHHHHHhccHHHHHHHHHhcCcccHHHHHHhhcCcHHHH
Confidence                                                             9999999999999999999999999999999


Q ss_pred             HHHHhhcCCCCCCCccCCCCCCCccccCCccccccCCCccceeecccccC------------------------------
Q psy9327         376 AELESNLRTADPNATLPTVHPEAQLLRPPAPVAEAETNWPLLTVSKSFFE------------------------------  425 (641)
Q Consensus       376 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------------------------  425 (641)
                      +++.+..+.+.  .+||...+++.+++||.|+.+.+ ||||+.+++++|+                              
T Consensus       773 e~l~ee~~~~~--~~lP~~~~~a~ll~pP~p~~~l~-nwPLl~~s~~~fe~~~~~~~~~~av~~~~e~~~g~e~~~~e~~  849 (1202)
T KOG0292|consen  773 EKLGEELEKQV--PSLPEVDPNASLLQPPVPIMPLE-NWPLLSVSKGTFEGALLSRSSSLAVDRDDEGDWGEEGWDVELM  849 (1202)
T ss_pred             HHHHHhhcccc--CCCCCCCCcccccCCCCcccccc-CCchhhhhhhhhhHhhhhhcccCcccccccccccccchhhhhc
Confidence            99999988643  36998878889999999987665 9999999999996                              


Q ss_pred             ----------------------------------------------------------------------CcHHHHHHHH
Q psy9327         426 ----------------------------------------------------------------------GSFETAFKLL  435 (641)
Q Consensus       426 ----------------------------------------------------------------------g~~~~~~~~~  435 (641)
                                                                                            |+|++||++|
T Consensus       850 l~ed~~~~~d~~g~~~~dE~~gWdv~d~~l~pe~~~~~~~~~~~~~~p~~~~~~~~W~~nS~L~adhvaAGsf~tA~~lL  929 (1202)
T KOG0292|consen  850 LGEDGILFNDGAGEVGEDEGGGWDVGDLDLPPEEDTPKGADDGEFVVPAQGMSVSIWSNNSPLAADHVAAGSFETAMRLL  929 (1202)
T ss_pred             cccccccccccccccCcccccCcCcccccCCccccccccccccceecCCCCCcchhccccCcchhhhhhcCchHHHHHHH
Confidence                                                                                  8999999999


Q ss_pred             HhhcceeecCcchHHHHHHhhcCceeecCCCCCCceeeccCCC--CCCCCCCCCCcccccHHHHHHHHHhhhhhcccccH
Q psy9327         436 HDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTRK--GPGIKENSHPATNIKLEQLIAKIQQCYQLTTSGKF  513 (641)
Q Consensus       436 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  513 (641)
                      ++|+|+++|.|+|++|.+.|..+|+++++.|+.| ..++|-|+  +... ....|+++++++|+..++++||+++|.|||
T Consensus       930 ~dqvgvv~f~p~Kt~fl~iy~~sR~~l~~~~~~~-~~~~~~R~~se~~~-~~~~P~v~~~l~~l~~kl~~gy~ltt~gKf 1007 (1202)
T KOG0292|consen  930 HDQVGVVNFGPLKTHFLKIYAGSRTYLRATPCLP-VSLYPVRNWSETSS-KQGLPAVGFKLSQLNKKLQKGYKLTTEGKF 1007 (1202)
T ss_pred             HhhhcceecccHHhhhhhhccccceeccCCCCcc-cccccccccccchh-hccCCcccccHHHHHHHHHHHHhhhccCcH
Confidence            9999999999999999999999999999999988 66677776  4444 578999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhcceeeecCHHHHHHHHHHHHHHhHHHHHHHHHH--HhhcCCCcccccccccceeeeeeCcceeEE
Q psy9327         514 VDAIEKLRNVLISIPLLVVTTKKEIEEAKQIINICKEYIVGTNHIK--YAIVNGDHGIIRTLDLPIYITKIKGNQVYY  589 (641)
Q Consensus       514 ~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~--~~l~~~d~~~~r~le~~~y~t~~~~~~~~~  589 (641)
                      .+|+++||.+|+++|+++|++.+|++++++++.||+|||+|+.+|+  +.|+.  ....|.|||++|||||++|++|-
T Consensus      1008 ~eAie~Frsii~~i~l~vvd~~~e~aea~~li~i~~eYi~gL~~E~~Rr~l~~--~~~~~~~ElAaYFt~~~Lqp~H~ 1083 (1202)
T KOG0292|consen 1008 GEAIEKFRSIIYSIPLLVVDSKEEEAEADELIKICREYIVGLSVELERRKLKK--PNLEQQLELAAYFTHCKLQPMHR 1083 (1202)
T ss_pred             HHHHHHHHHHHhheeEEEecchhhHHHHHHHHHHHHHHHhhheeeeeecccCC--chHHHHHHHHHHhhcCCCCcHHH
Confidence            9999999999999999999999999999999999999999999998  55644  45578899999999999999884



>KOG0292|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query641
3mkr_B320 Crystal Structure Of Yeast AlphaEPSILON-Cop Subcomp 1e-36
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 8e-27
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 9e-27
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 1e-26
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 1e-26
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-18
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 4e-14
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 6e-16
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 7e-16
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 5e-14
2gnq_A336 Structure Of Wdr5 Length = 336 7e-16
2gnq_A336 Structure Of Wdr5 Length = 336 4e-14
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 1e-15
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 8e-14
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-15
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 6e-14
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 1e-15
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 8e-14
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-15
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 6e-14
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-15
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 7e-14
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 2e-15
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 7e-14
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 2e-15
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 7e-14
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 2e-15
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 8e-14
2h9l_A329 Wdr5delta23 Length = 329 2e-15
2h9l_A329 Wdr5delta23 Length = 329 7e-14
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 2e-15
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 7e-14
2g99_A308 Structural Basis For The Specific Recognition Of Me 2e-15
2g99_A308 Structural Basis For The Specific Recognition Of Me 8e-14
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-15
2g9a_A311 Structural Basis For The Specific Recognition Of Me 8e-14
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 2e-15
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 7e-14
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 2e-14
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-14
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 3e-14
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-14
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 9e-12
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 2e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 9e-12
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 4e-11
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 1e-11
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 2e-09
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 2e-09
3zey_7318 High-resolution Cryo-electron Microscopy Structure 1e-08
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 3e-07
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 3e-07
1r5m_A425 Crystal Structure Of The C-Terminal Wd40 Domain Of 8e-07
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 8e-07
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 2e-06
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 4e-06
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 1e-04
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-06
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 1e-04
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-06
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 1e-04
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 5e-06
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 1e-04
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 5e-06
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 1e-04
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 6e-06
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 8e-06
3mv2_A325 Crystal Structure Of A-Cop In Complex With E-Cop Le 3e-05
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 3e-05
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 4e-05
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 4e-05
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 4e-05
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 4e-05
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 5e-05
3mv3_A325 Crystal Structure Of A-Cop In Complex With E-Cop Le 8e-05
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 9e-05
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 9e-05
3jpx_A402 Eed: A Novel Histone Trimethyllysine Binder Within 2e-04
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 2e-04
2qxv_A361 Structural Basis Of Ezh2 Recognition By Eed Length 3e-04
3iiw_A365 Crystal Structure Of Eed In Complex With A Trimethy 3e-04
3jzn_A366 Structure Of Eed In Apo Form Length = 366 3e-04
3iiy_A365 Crystal Structure Of Eed In Complex With A Trimethy 3e-04
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 6e-04
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 9e-04
>pdb|3MKR|B Chain B, Crystal Structure Of Yeast AlphaEPSILON-Cop Subcomplex Of The Copi Vesicular Coat Length = 320 Back     alignment and structure

Iteration: 1

Score = 151 bits (381), Expect = 1e-36, Method: Compositional matrix adjust. Identities = 73/131 (55%), Positives = 95/131 (72%), Gaps = 3/131 (2%) Query: 426 GSFETAFKLLHDQIGVKNFLPYRQMFLNSYLQSRTAYSTLPLLAPVMAFPTR--KGPGIK 483 GSFETA +LLHDQ+GV F PY+Q+FL +Y + RT Y LP L + +P R K G+K Sbjct: 30 GSFETAMRLLHDQVGVTQFGPYKQLFLQTYARGRTTYQALPCLPSMYGYPNRNWKDAGLK 89 Query: 484 ENSHPATNIKLEQLIAKIQQCYQLTTSGKFVDAIEKLRNVLISIPLLVVTTKKEIEEAKQ 543 N PA +KL LI ++Q CYQLTT GKF +A+EK R++L+S+PLLVV K+EI EA+Q Sbjct: 90 -NGVPAVGLKLNDLIQRLQLCYQLTTVGKFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQ 148 Query: 544 IINICKEYIVG 554 +I IC+EYIVG Sbjct: 149 LITICREYIVG 159
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|1R5M|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Sif2 Length = 425 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3MV2|A Chain A, Crystal Structure Of A-Cop In Complex With E-Cop Length = 325 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|3MV3|A Chain A, Crystal Structure Of A-Cop In Complex With E-Cop Length = 325 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|3JPX|A Chain A, Eed: A Novel Histone Trimethyllysine Binder Within The Eed-Ezh2 Polycomb Complex Length = 402 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|2QXV|A Chain A, Structural Basis Of Ezh2 Recognition By Eed Length = 361 Back     alignment and structure
>pdb|3IIW|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H3k27 Peptide Length = 365 Back     alignment and structure
>pdb|3JZN|A Chain A, Structure Of Eed In Apo Form Length = 366 Back     alignment and structure
>pdb|3IIY|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H1k26 Peptide Length = 365 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query641
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3mkr_B320 Coatomer subunit alpha; tetratricopeptide repeats 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3mv2_A325 Coatomer subunit alpha; vesicular membrane coat CO 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.98
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.98
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.98
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.98
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.98
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.98
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.98
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.97
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.97
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.97
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.97
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.97
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.97
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.97
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.97
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.97
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.96
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.96
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.96
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.96
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.96
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.96
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.96
3jro_A 753 Fusion protein of protein transport protein SEC13 99.96
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.96
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.96
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.96
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.96
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.96
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.96
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.96
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.96
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.96
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.96
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.95
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.95
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.95
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.95
2pm7_B297 Protein transport protein SEC13, protein transport 99.95
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.95
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.95
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.95
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.95
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.95
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.95
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.94
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.94
3jrp_A379 Fusion protein of protein transport protein SEC13 99.94
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.94
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.94
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.94
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.94
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.94
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.94
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.93
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.93
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.93
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.93
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.93
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.92
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.92
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.92
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.92
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.91
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.91
3jro_A 753 Fusion protein of protein transport protein SEC13 99.91
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.91
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.89
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.85
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.84
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.83
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.83
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.82
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.82
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.81
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.8
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.8
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.79
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.79
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.79
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.79
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.78
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.76
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.76
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.76
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.75
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.74
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.74
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.74
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.73
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.73
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.73
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.72
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.7
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.69
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.68
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.68
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.67
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.65
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.64
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.64
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.62
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.62
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.6
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.57
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.55
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.52
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.51
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.5
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.5
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.5
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.5
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.49
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.48
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.47
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.47
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.46
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.44
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.44
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.43
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.42
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.42
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.41
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.4
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.4
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.38
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.37
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.36
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.35
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.33
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.3
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.27
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.26
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.25
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.24
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.24
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.22
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.22
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.2
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.17
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.16
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.16
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.14
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.14
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.14
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.12
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.1
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.09
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.07
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.07
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.04
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.03
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.98
2qe8_A343 Uncharacterized protein; structural genomics, join 98.96
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.94
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.92
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.91
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.91
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.84
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.78
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.77
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 98.7
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.69
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.68
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.68
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.66
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.62
2qe8_A343 Uncharacterized protein; structural genomics, join 98.62
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.61
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.6
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.58
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.57
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.56
2ece_A462 462AA long hypothetical selenium-binding protein; 98.55
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.53
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.51
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.48
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.47
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.47
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.45
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.39
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.38
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.37
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.35
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.34
2ece_A462 462AA long hypothetical selenium-binding protein; 98.21
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.21
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.16
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.15
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.13
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.12
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.12
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.08
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.06
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.01
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.99
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.98
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.97
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.96
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.91
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.91
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.9
3v65_B386 Low-density lipoprotein receptor-related protein; 97.86
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.85
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.75
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.73
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.72
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.71
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.69
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.66
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.63
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.55
3v65_B386 Low-density lipoprotein receptor-related protein; 97.55
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.52
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.51
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.5
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.5
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.48
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.46
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.45
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.44
3kya_A496 Putative phosphatase; structural genomics, joint c 97.43
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.43
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.41
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.38
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.27
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 97.27
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.14
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.11
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.09
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.03
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.0
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 96.99
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.75
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.66
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.64
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.63
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.62
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.61
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 96.51
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.45
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 96.33
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.31
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.18
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.15
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.08
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.02
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.02
3kya_A496 Putative phosphatase; structural genomics, joint c 95.93
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.86
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 95.43
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 95.36
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 95.13
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.07
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 95.04
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 94.52
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 93.45
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 93.3
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 93.07
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 92.92
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 92.59
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 92.07
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 91.92
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 91.67
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 90.79
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 90.34
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 90.04
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 90.01
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 90.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 89.43
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 89.18
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 88.61
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 88.3
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 87.9
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 87.31
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 86.98
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 86.57
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 85.21
3ott_A758 Two-component system sensor histidine kinase; beta 84.43
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 83.14
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 82.77
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 81.92
3ott_A 758 Two-component system sensor histidine kinase; beta 81.76
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 80.96
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 80.7
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 80.59
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 80.49
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
Probab=100.00  E-value=7.3e-37  Score=330.60  Aligned_cols=284  Identities=20%  Similarity=0.315  Sum_probs=247.6

Q ss_pred             eeeccCCCCeEEEEEccCCCeEEEEeCCCcEEEEECccCcccccccccccCeEEEEEeCCCCEEEEeceeeEEeeeceee
Q psy9327           3 TKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGCIL   82 (641)
Q Consensus         3 ~~~~~H~~~V~~l~fspdg~~Lasg~~dg~I~iWD~~~~~~l~~~~~h~~~V~~i~fsp~~~~l~sgs~~~~~~~~~~~~   82 (641)
                      ..+.+|.++|++++|+|++++|++|+.||+|++||+.+++....+.+|.++|.+++|+|++.+|++|+            
T Consensus       102 ~~l~gh~~~V~~~~~~p~~~~l~s~s~Dg~i~vwd~~~~~~~~~l~~h~~~V~~v~~~~~~~~l~sgs------------  169 (410)
T 1vyh_C          102 YALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCS------------  169 (410)
T ss_dssp             CEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEE------------
T ss_pred             EeecccCCcEEEEEEcCCCCEEEEEeCCCeEEEEECCCCcEEEEEeccCCcEEEEEEcCCCCEEEEEe------------
Confidence            46789999999999999999999999999999999999999999999999999999999999999998            


Q ss_pred             ecccCCcceeeEEEeeCCCeEEEEECCCCeeEEEEccCCCCeEEEEEccCCCEEEEEeCCCeEEEEECCCCeeEEEEccC
Q psy9327          83 ESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGH  162 (641)
Q Consensus        83 ~~~~~~~~~~~~~~~s~Dg~I~vWD~~t~~~~~~~~~h~~~V~~v~fsp~~~~l~sgs~Dg~I~vWd~~~~~~i~~l~~h  162 (641)
                                      .|++|++||+.+++++.++.+|.+.|.+++|+|++.++++|+.|++|++||++++.++.++.+|
T Consensus       170 ----------------~D~~i~iwd~~~~~~~~~~~~h~~~V~~v~~~p~~~~l~s~s~D~~i~~wd~~~~~~~~~~~~h  233 (410)
T 1vyh_C          170 ----------------ADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH  233 (410)
T ss_dssp             ----------------TTSCCCEEETTSSCEEECCCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETTTCCEEEEEECC
T ss_pred             ----------------CCCeEEEEeCCCCceeEEEcCCCCCEEEEEEeCCCCEEEEEeCCCeEEEEECCCCcEEEEEeCC
Confidence                            9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCEEEEEEecCCCEEEEEeCCCeEEEEecCCCceeeeccCCCceeeecccCCCc-e-e--------------eeeeeee
Q psy9327         163 NHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGKLVLSMKSKHPI-W-K--------------YCKPVKY  226 (641)
Q Consensus       163 ~~~V~sl~fsp~g~~lvSgs~DgtI~IWD~~~~~~~~~~~~~~~~v~s~~~~~~v-~-~--------------~~~~l~s  226 (641)
                      ...|.++.|+|++.++++|+.|++|++||+.+++....+.+|...+.++.....- + .              ....+++
T Consensus       234 ~~~v~~~~~~~~g~~l~s~s~D~~v~vwd~~~~~~~~~~~~h~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~l~s  313 (410)
T 1vyh_C          234 REWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLS  313 (410)
T ss_dssp             SSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEE
T ss_pred             CccEEEEEECCCCCEEEEEcCCCeEEEEECCCCceeeEecCCCceEEEEEEcCcccccchhhhccccccccCCCCCEEEE
Confidence            9999999999999999999999999999999999998888888777765432110 0 0              0112778


Q ss_pred             eCCCeeEEEec-CCCcceeeec-CCcceEEEEEcCCccEEEEecCCeEEEEEcCCCCe-Eecc---ccceEE--EEEcCc
Q psy9327         227 CNPKHTLHICN-RKMEPLCNIH-ENTRVKSGAWDESGVFIYTTSNHIKYAIVNGDHGI-IRTL---DLPIYI--TKIKGN  298 (641)
Q Consensus       227 ~~~d~~I~i~d-~~~~~~~~~~-~~~~I~sla~~p~g~~L~t~s~~~k~~l~~~~~g~-I~~~---d~p~~~--~~~~g~  298 (641)
                      ++.|+.|++|| ..+..+..+. +...|.+++|+|+|.++++++.|+.+.+|+..++. +..+   ..++..  ++.++.
T Consensus       314 gs~D~~i~iwd~~~~~~~~~~~~h~~~v~~v~~~~~g~~l~s~s~D~~i~vwd~~~~~~~~~~~~h~~~v~~l~~~~~~~  393 (410)
T 1vyh_C          314 GSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAP  393 (410)
T ss_dssp             EETTSEEEEEETTTTEEEEEEECCSSCEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEECCSSCEEEEEECSSSS
T ss_pred             EeCCCeEEEEECCCCceEEEEECCCCcEEEEEEcCCCCEEEEEeCCCeEEEEECCCCceEEEEcCCCCcEEEEEEcCCCC
Confidence            88999999999 5556665554 57789999999999999999999999999976653 3333   223333  445678


Q ss_pred             EEEEEeCCCCeEEEEe
Q psy9327         299 QVYYLDRECSPHVLRI  314 (641)
Q Consensus       299 ~v~~~~~dg~i~v~~~  314 (641)
                      .+++++.||.+++|+.
T Consensus       394 ~l~sgs~D~~i~vW~~  409 (410)
T 1vyh_C          394 YVVTGSVDQTVKVWEC  409 (410)
T ss_dssp             CEEEEETTSEEEEEC-
T ss_pred             EEEEEeCCCcEEEEeC
Confidence            9999999999999975



>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 641
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-30
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-19
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-18
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-11
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-24
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-17
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-04
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-20
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-14
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-07
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-07
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-18
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-14
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-12
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 4e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-17
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-14
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-14
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.003
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-13
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-11
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-11
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-08
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-12
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 4e-11
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-10
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.001
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-12
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 5e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-12
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-12
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 9e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-11
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-11
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-10
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 5e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 7e-11
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 6e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-04
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-10
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 3e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.001
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-09
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-07
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 9e-08
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 2e-05
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.002
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-04
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.001
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.004
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  119 bits (298), Expect = 2e-30
 Identities = 45/191 (23%), Positives = 81/191 (42%), Gaps = 8/191 (4%)

Query: 1   MLTKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFH 60
            +  F      V+ +  +     I S  ++  +++W         +  EH   V  I + 
Sbjct: 135 CVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECISWA 194

Query: 61  NQQPIFVSGGKMIVMAYQGCILESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGH 120
            +               +                     D  IK+W+     C+ TL+GH
Sbjct: 195 PESSYSSISEATGSETKKSGKPGPFLLSG--------SRDKTIKMWDVSTGMCLMTLVGH 246

Query: 121 LDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGHNHYVMCAQFHPTDDIVVS 180
            +++R   FH    +ILS +DD+T+R+W ++++ C+  L  H H+V    FH T   VV+
Sbjct: 247 DNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVT 306

Query: 181 ASLDQTIRVWD 191
            S+DQT++VW+
Sbjct: 307 GSVDQTVKVWE 317


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query641
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.98
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.96
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.95
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.93
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.93
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.92
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.91
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.91
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.89
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.89
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.89
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.88
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.88
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.87
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.85
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.83
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.81
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.79
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.79
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.78
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.74
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.73
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.67
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.66
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.64
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.62
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.58
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.53
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.46
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.42
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.26
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.22
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.21
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.2
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.14
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.1
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.95
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.78
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.71
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.64
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.6
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.57
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.54
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.53
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.45
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.43
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.39
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.38
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.23
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.02
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.96
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.89
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.87
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.81
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 97.76
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.64
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.28
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.24
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.85
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.48
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.48
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.92
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.9
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.74
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 95.5
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 95.36
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.7
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 94.41
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 93.21
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 93.18
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 92.81
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 92.47
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 91.8
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.14
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.77
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 90.71
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.39
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.52
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 89.08
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 87.9
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 87.32
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 86.54
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 85.55
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 83.72
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 83.09
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=4.8e-33  Score=280.41  Aligned_cols=283  Identities=20%  Similarity=0.311  Sum_probs=244.6

Q ss_pred             eeeccCCCCeEEEEEccCCCeEEEEeCCCcEEEEECccCcccccccccccCeEEEEEeCCCCEEEEeceeeEEeeeceee
Q psy9327           3 TKFETKSARVKGLSFHPKRPWILSSLHNGVIQLWDYRMNTLLEKFDEHEGPVRGICFHNQQPIFVSGGKMIVMAYQGCIL   82 (641)
Q Consensus         3 ~~~~~H~~~V~~l~fspdg~~Lasg~~dg~I~iWD~~~~~~l~~~~~h~~~V~~i~fsp~~~~l~sgs~~~~~~~~~~~~   82 (641)
                      .+|+||+++|++++|+|++++|++|+.||+|+|||+.+++.+..+..|.++|.+++|+|++.++++++            
T Consensus        11 ~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~------------   78 (317)
T d1vyhc1          11 YALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCS------------   78 (317)
T ss_dssp             CEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEE------------
T ss_pred             EEEcCCCCCeEEEEEcCCCCEEEEEeCCCeEEEEECCCCCEEEEEeCCCCcEEEEeeecccccccccc------------
Confidence            57899999999999999999999999999999999999999999999999999999999999999997            


Q ss_pred             ecccCCcceeeEEEeeCCCeEEEEECCCCeeEEEEccCCCCeEEEEEccCCCEEEEEeCCCeEEEEECCCCeeEEEEccC
Q psy9327          83 ESRNEPCLFRIKSVLGDDYKIKVWNYKQRKCIFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRIWYWQSRNCICVLTGH  162 (641)
Q Consensus        83 ~~~~~~~~~~~~~~~s~Dg~I~vWD~~t~~~~~~~~~h~~~V~~v~fsp~~~~l~sgs~Dg~I~vWd~~~~~~i~~l~~h  162 (641)
                                      .++.+.+|+....+....+.+|...+.++.|+|+++.+++++.|+.+++||+++++.+..+.+|
T Consensus        79 ----------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~  142 (317)
T d1vyhc1          79 ----------------ADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGH  142 (317)
T ss_dssp             ----------------TTSCCCEEETTSSCEEECCCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETTTCCEEEEEECC
T ss_pred             ----------------cccccccccccccccccccccccccceeeeccCCCceEEeeccCcceeEeecccceeeeEEccC
Confidence                            8999999999999998999999999999999999999999999999999999999999999999


Q ss_pred             CCCEEEEEEecCCCEEEEEeCCCeEEEEecCCCceeeeccCCCceeeecccCCCc----------------eeeeeeeee
Q psy9327         163 NHYVMCAQFHPTDDIVVSASLDQTIRVWDISGLRKKNVAPGMGKLVLSMKSKHPI----------------WKYCKPVKY  226 (641)
Q Consensus       163 ~~~V~sl~fsp~g~~lvSgs~DgtI~IWD~~~~~~~~~~~~~~~~v~s~~~~~~v----------------~~~~~~l~s  226 (641)
                      ...+.+++|+|++.++++++.|+.|++||+.+++....+.++...+.++......                ......+.+
T Consensus       143 ~~~~~~~~~~~~~~~l~~~~~d~~v~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  222 (317)
T d1vyhc1         143 REWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLS  222 (317)
T ss_dssp             SSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEEECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEE
T ss_pred             CCcceeeecccCCCEEEEEeCCCeEEEEeeccceeeEEEecCCCCceEEEEeeccccceeeccccceeeeeccCCceeEe
Confidence            9999999999999999999999999999999999888888776666543321110                000011567


Q ss_pred             eCCCeeEEEec-CCCcceeeec-CCcceEEEEEcCCccEEEEecCCeEEEEEcCCCCe-Eecc---ccceEE--EEEcCc
Q psy9327         227 CNPKHTLHICN-RKMEPLCNIH-ENTRVKSGAWDESGVFIYTTSNHIKYAIVNGDHGI-IRTL---DLPIYI--TKIKGN  298 (641)
Q Consensus       227 ~~~d~~I~i~d-~~~~~~~~~~-~~~~I~sla~~p~g~~L~t~s~~~k~~l~~~~~g~-I~~~---d~p~~~--~~~~g~  298 (641)
                      ++.|+.+++|| .+...+..+. +...|.+++|+|++.+|++++.++.+.+|+..++. +..+   ..++..  +..++.
T Consensus       223 ~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~h~~~V~~~~~s~~~~  302 (317)
T d1vyhc1         223 GSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAP  302 (317)
T ss_dssp             EETTSEEEEEETTTTEEEEEEECCSSCEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEECCSSCEEEEEECSSSS
T ss_pred             ccCCCEEEEEECCCCcEEEEEeCCCCCEEEEEECCCCCEEEEEECCCeEEEEECCCCcEEEEEcCCCCCEEEEEEcCCCC
Confidence            78999999999 4556555554 47789999999999999999999999999987664 3333   334433  445678


Q ss_pred             EEEEEeCCCCeEEEE
Q psy9327         299 QVYYLDRECSPHVLR  313 (641)
Q Consensus       299 ~v~~~~~dg~i~v~~  313 (641)
                      .+++++.||.+++|+
T Consensus       303 ~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         303 YVVTGSVDQTVKVWE  317 (317)
T ss_dssp             CEEEEETTSEEEEEC
T ss_pred             EEEEEeCCCeEEEeC
Confidence            999999999999995



>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure