Psyllid ID: psy9376

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320

MTDEKLVCEKQLAAALLRVVFITKVGGNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACNLLDAANCFKKTDNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFKGEESNSSANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCHLCIDVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIEEQNVDGFTEAVKDYDSISRLDQWYTTVLLRIKKQVGRTSLDSSLLKYSAKEYFFRAALCHLCIDVINAYTQYKANY

cccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc

cccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccc

MTDEKLVCEKQLAAALLRVVFITKVGGNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLhmksgtkhDAACNLLDAAncfkktdnEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYfkgeesnssaNKCLLKVAHHAALLQNYNKAIQIYEEVGrtsldssllKYSAKEYFFRAALCHLCIDVINahnaidryktiypafqdsREYKLLRILIEHIEEQNVDGFTEAVKDYDSISRLDQWYTTVLLRIKKQvgrtsldssllKYSAKEYFFRAALCHLCIDVINAYTQYKANY

MTDEKLVCEKQLAAALLRVVFItkvggnkidEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACNLLDAANCFKKTDNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFKGEESNSSANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCHLCIDVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIeeqnvdgfteaVKDYDSISRLDQWYTTVLLRIkkqvgrtsldsslLKYSAKEYFFRAALCHLCIDVINAYTQYKANY

*****LVCEKQLAAALLRVVFITKVGGNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACNLLDAANCFKKTDNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFKG******ANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCHLCIDVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIEEQNVDGFTEAVKDYDSISRLDQWYTTVLLRIKKQVGRTSLDSSLLKYSAKEYFFRAALCHLCIDVINAYTQY****

***EKLV*****************VG*NKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACNLLDAANCFKKTDNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFKGEESNSSANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCHLCIDVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIEEQNVDGFTEAVKDYDSISRLDQWYTTVLLRIKKQV*********LKYSAKEYFFRAALCHLCIDVINAYT******

*****LVCEKQL*****RVVFI***GGNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACNLLDAANCFKKTDNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFKGEESNSSANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCHLCIDVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIEEQNVDGFTEAVKDYDSISRLDQWYTTVLLRIKKQVGRTSLDSSLLKYSAKEYFFRAALCHLCIDVINAYTQYKANY

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		320	2.2.26 [Sep-21-2011]
Q23983		292	Soluble NSF attachment pr	yes	N/A	0.787	0.863	0.678	1e-103
P54920		295	Alpha-soluble NSF attachm	yes	N/A	0.728	0.789	0.665	6e-97
Q9DB05		295	Alpha-soluble NSF attachm	yes	N/A	0.728	0.789	0.665	7e-97
P54921		295	Alpha-soluble NSF attachm	yes	N/A	0.728	0.789	0.661	1e-96
P81125		295	Alpha-soluble NSF attachm	yes	N/A	0.728	0.789	0.657	3e-95
P28663		298	Beta-soluble NSF attachme	no	N/A	0.862	0.926	0.616	1e-94
Q9H115		298	Beta-soluble NSF attachme	no	N/A	0.862	0.926	0.616	1e-94
P81126		298	Beta-soluble NSF attachme	no	N/A	0.862	0.926	0.609	5e-94
P85969		297	Beta-soluble NSF attachme	no	N/A	0.859	0.925	0.612	1e-92
Q54NP6		291	Alpha-soluble NSF attachm	yes	N/A	0.803	0.883	0.459	5e-60

>sp\|Q23983\|SNAP_DROME Soluble NSF attachment protein OS=Drosophila melanogaster GN=Snap PE=1 SV=1	Back alignment and function desciption

 Score =  374 bits (961), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/252 (67%), Positives = 216/252 (85%)

Query: 26  GGNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACNLLDAANCFK 85
           G NK+++AIECY RA NMFKM+K W  AG+ F EAA LH ++G++HDA    +DA+NC+K
Sbjct: 32  GSNKVEDAIECYQRAGNMFKMSKNWTKAGECFCEAATLHARAGSRHDAGTCYVDASNCYK 91

Query: 86  KTDNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFK 145
           K D E+A++CL K+I IYTDMGRFTMAAKHHQ+IAE+YE+D  +  K+++HYEQAA YFK
Sbjct: 92  KVDVESAVNCLMKSIDIYTDMGRFTMAAKHHQSIAEMYESDPNNLAKSIQHYEQAADYFK 151

Query: 146 GEESNSSANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCH 205
           GEES SSANKC+LKVA +AA L++Y KAI IYE+V  +SL+SSLLKYSAKEYFFRAALCH
Sbjct: 152 GEESVSSANKCMLKVAQYAAQLEDYEKAISIYEQVAASSLESSLLKYSAKEYFFRAALCH 211

Query: 206 LCIDVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIEEQNVDGFTEAVKDYDSISRLD 265
           L +D++NA +AI++Y   YPAFQDSRE+KL+++L E++EEQN++GFTEAVKDYDSISRLD
Sbjct: 212 LSVDLLNAQHAIEKYAQQYPAFQDSREFKLIKVLCENLEEQNIEGFTEAVKDYDSISRLD 271

Query: 266 QWYTTVLLRIKK 277
           QWYTT+LLRIKK
Sbjct: 272 QWYTTILLRIKK 283

Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus. Also between the endosome and phagosome.
Drosophila melanogaster (taxid: 7227)

>sp\|P54920\|SNAA_HUMAN Alpha-soluble NSF attachment protein OS=Homo sapiens GN=NAPA PE=1 SV=3	Back alignment and function description

>sp\|Q9DB05\|SNAA_MOUSE Alpha-soluble NSF attachment protein OS=Mus musculus GN=Napa PE=1 SV=1	Back alignment and function description

>sp\|P54921\|SNAA_RAT Alpha-soluble NSF attachment protein OS=Rattus norvegicus GN=Napa PE=1 SV=2	Back alignment and function description

>sp\|P81125\|SNAA_BOVIN Alpha-soluble NSF attachment protein OS=Bos taurus GN=NAPA PE=1 SV=1	Back alignment and function description

>sp\|P28663\|SNAB_MOUSE Beta-soluble NSF attachment protein OS=Mus musculus GN=Napb PE=1 SV=2	Back alignment and function description

>sp\|Q9H115\|SNAB_HUMAN Beta-soluble NSF attachment protein OS=Homo sapiens GN=NAPB PE=1 SV=2	Back alignment and function description

>sp\|P81126\|SNAB_BOVIN Beta-soluble NSF attachment protein OS=Bos taurus GN=NAPB PE=1 SV=1	Back alignment and function description

>sp\|P85969\|SNAB_RAT Beta-soluble NSF attachment protein OS=Rattus norvegicus GN=Napb PE=1 SV=1	Back alignment and function description

>sp\|Q54NP6\|SNAA_DICDI Alpha-soluble NSF attachment protein OS=Dictyostelium discoideum GN=snpA PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		320
242024716		292	Soluble NSF attachment protein, putative	0.637	0.698	0.755	1e-114
322785539		336	hypothetical protein SINV_07924 [Solenop	0.859	0.818	0.706	1e-113
307188146		292	Soluble NSF attachment protein [Camponot	0.859	0.941	0.710	1e-112
383849884		292	PREDICTED: soluble NSF attachment protei	0.668	0.732	0.755	1e-112
66519254		292	PREDICTED: soluble NSF attachment protei	0.715	0.784	0.755	1e-111
380015858		292	PREDICTED: soluble NSF attachment protei	0.668	0.732	0.751	1e-111
91082745		291	PREDICTED: similar to AGAP003192-PA [Tri	0.821	0.903	0.715	1e-111
340721388		292	PREDICTED: soluble NSF attachment protei	0.840	0.921	0.704	1e-110
157130506		293	soluble nsf attachment protein (snap) [A	0.793	0.866	0.732	1e-109
58383926		293	AGAP003192-PA [Anopheles gambiae str. PE	0.793	0.866	0.728	1e-109

>gi\|242024716\|ref\|XP_002432772.1\| Soluble NSF attachment protein, putative [Pediculus humanus corporis] gi\|212518281\|gb\|EEB20034.1\| Soluble NSF attachment protein, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 192/254 (75%), Positives = 229/254 (90%)

Query: 26  GGNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACNLLDAANCFK 85
           G +K++EA+ECYTRAANMFKMAKKW  AG AF EAA+LH K+G++HDAA N +DAANC+K
Sbjct: 32  GSSKVEEAVECYTRAANMFKMAKKWGQAGSAFCEAASLHAKAGSRHDAATNYVDAANCYK 91

Query: 86  KTDNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFK 145
           K+D   +++CL KAI IYTDMGRFTMAAKHHQTIAE+YET+  D E+AV+HYEQAA YFK
Sbjct: 92  KSDPNESVNCLLKAIEIYTDMGRFTMAAKHHQTIAEVYETEAADLERAVQHYEQAADYFK 151

Query: 146 GEESNSSANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCH 205
           GEESNSSANKC+LKVA +AA L+NY+KAI+IYE+V  +SL++SLLKYSAKEYFFRAALCH
Sbjct: 152 GEESNSSANKCMLKVAQYAAQLENYDKAIKIYEQVASSSLENSLLKYSAKEYFFRAALCH 211

Query: 206 LCIDVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIEEQNVDGFTEAVKDYDSISRLD 265
           LC+DV+NA +A++RY  +YPAFQDSREYKLL++LIEH+EEQNVD FTEAVKDYDSISRLD
Sbjct: 212 LCVDVLNAQHAMERYCQLYPAFQDSREYKLLKVLIEHMEEQNVDAFTEAVKDYDSISRLD 271

Query: 266 QWYTTVLLRIKKQV 279
           QWYTT+LLRIKKQV
Sbjct: 272 QWYTTILLRIKKQV 285

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|322785539\|gb\|EFZ12201.1\| hypothetical protein SINV_07924 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|307188146\|gb\|EFN72978.1\| Soluble NSF attachment protein [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|383849884\|ref\|XP_003700564.1\| PREDICTED: soluble NSF attachment protein-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|66519254\|ref\|XP_625208.1\| PREDICTED: soluble NSF attachment protein [Apis mellifera]	Back alignment and taxonomy information

>gi\|380015858\|ref\|XP_003691911.1\| PREDICTED: soluble NSF attachment protein-like [Apis florea]	Back alignment and taxonomy information

>gi\|91082745\|ref\|XP_973149.1\| PREDICTED: similar to AGAP003192-PA [Tribolium castaneum] gi\|270014950\|gb\|EFA11398.1\| hypothetical protein TcasGA2_TC013571 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|340721388\|ref\|XP_003399103.1\| PREDICTED: soluble NSF attachment protein-like [Bombus terrestris] gi\|350406637\|ref\|XP_003487834.1\| PREDICTED: soluble NSF attachment protein-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|157130506\|ref\|XP_001661903.1\| soluble nsf attachment protein (snap) [Aedes aegypti] gi\|108871887\|gb\|EAT36112.1\| AAEL011776-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|58383926\|ref\|XP_312889.2\| AGAP003192-PA [Anopheles gambiae str. PEST] gi\|55241566\|gb\|EAA08389.2\| AGAP003192-PA [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		320
FB\|FBgn0250791		292	Snap "Soluble NSF attachment p	0.787	0.863	0.678	6.8e-95
UNIPROTKB\|F1RLB6		295	NAPA "Uncharacterized protein"	0.793	0.861	0.669	1.2e-90
UNIPROTKB\|P54920		295	NAPA "Alpha-soluble NSF attach	0.793	0.861	0.665	5.1e-90
MGI\|MGI:104563		295	Napa "N-ethylmaleimide sensiti	0.793	0.861	0.665	6.5e-90
UNIPROTKB\|A5D7S0		295	NAPA "Alpha-soluble NSF attach	0.793	0.861	0.665	1.1e-89
RGD\|620855		295	Napa "N-ethylmaleimide-sensiti	0.793	0.861	0.661	1.4e-89
UNIPROTKB\|P81125		295	NAPA "Alpha-soluble NSF attach	0.793	0.861	0.657	7.5e-89
UNIPROTKB\|E2RE59		298	NAPB "Uncharacterized protein"	0.834	0.895	0.631	3.2e-88
UNIPROTKB\|E2RQE7		295	NAPA "Uncharacterized protein"	0.793	0.861	0.649	4.1e-88
UNIPROTKB\|Q9H115		298	NAPB "Beta-soluble NSF attachm	0.834	0.895	0.627	6.7e-88

FB\|FBgn0250791 Snap "Soluble NSF attachment protein" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 944 (337.4 bits), Expect = 6.8e-95, P = 6.8e-95
 Identities = 171/252 (67%), Positives = 216/252 (85%)

Query:    26 GGNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACNLLDAANCFK 85
             G NK+++AIECY RA NMFKM+K W  AG+ F EAA LH ++G++HDA    +DA+NC+K
Sbjct:    32 GSNKVEDAIECYQRAGNMFKMSKNWTKAGECFCEAATLHARAGSRHDAGTCYVDASNCYK 91

Query:    86 KTDNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFK 145
             K D E+A++CL K+I IYTDMGRFTMAAKHHQ+IAE+YE+D  +  K+++HYEQAA YFK
Sbjct:    92 KVDVESAVNCLMKSIDIYTDMGRFTMAAKHHQSIAEMYESDPNNLAKSIQHYEQAADYFK 151

Query:   146 GEESNSSANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCH 205
             GEES SSANKC+LKVA +AA L++Y KAI IYE+V  +SL+SSLLKYSAKEYFFRAALCH
Sbjct:   152 GEESVSSANKCMLKVAQYAAQLEDYEKAISIYEQVAASSLESSLLKYSAKEYFFRAALCH 211

Query:   206 LCIDVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIEEQNVDGFTEAVKDYDSISRLD 265
             L +D++NA +AI++Y   YPAFQDSRE+KL+++L E++EEQN++GFTEAVKDYDSISRLD
Sbjct:   212 LSVDLLNAQHAIEKYAQQYPAFQDSREFKLIKVLCENLEEQNIEGFTEAVKDYDSISRLD 271

Query:   266 QWYTTVLLRIKK 277
             QWYTT+LLRIKK
Sbjct:   272 QWYTTILLRIKK 283

GO:0005483 "soluble NSF attachment protein activity" evidence=NAS

GO:0007269 "neurotransmitter secretion" evidence=NAS

GO:0016082 "synaptic vesicle priming" evidence=NAS

GO:0019898 "extrinsic to membrane" evidence=NAS

GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=NAS

GO:0043679 "axon terminus" evidence=IDA

GO:0007268 "synaptic transmission" evidence=IMP

GO:0048526 "imaginal disc-derived wing expansion" evidence=IMP

GO:0001745 "compound eye morphogenesis" evidence=IMP

GO:0000910 "cytokinesis" evidence=IMP

GO:0006911 "phagocytosis, engulfment" evidence=IMP

GO:0006886 "intracellular protein transport" evidence=IMP

GO:0031410 "cytoplasmic vesicle" evidence=IDA

GO:0016020 "membrane" evidence=IDA

GO:0006891 "intra-Golgi vesicle-mediated transport" evidence=IMP

GO:0048812 "neuron projection morphogenesis" evidence=IMP

GO:0031201 "SNARE complex" evidence=IDA

UNIPROTKB\|F1RLB6 NAPA "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|P54920 NAPA "Alpha-soluble NSF attachment protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:104563 Napa "N-ethylmaleimide sensitive fusion protein attachment protein alpha" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|A5D7S0 NAPA "Alpha-soluble NSF attachment protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

RGD\|620855 Napa "N-ethylmaleimide-sensitive factor attachment protein, alpha" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P81125 NAPA "Alpha-soluble NSF attachment protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RE59 NAPB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RQE7 NAPA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9H115 NAPB "Beta-soluble NSF attachment protein" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P93798	SNAA_VITVI	No assigned EC number	0.4393	0.8187	0.9065	yes	N/A
P54920	SNAA_HUMAN	No assigned EC number	0.6653	0.7281	0.7898	yes	N/A
P54921	SNAA_RAT	No assigned EC number	0.6614	0.7281	0.7898	yes	N/A
Q9H115	SNAB_HUMAN	No assigned EC number	0.6161	0.8625	0.9261	no	N/A
Q75D68	SEC17_ASHGO	No assigned EC number	0.3071	0.8593	0.9450	yes	N/A
Q9SPE6	SNAA2_ARATH	No assigned EC number	0.4323	0.825	0.9134	yes	N/A
P32602	SEC17_YEAST	No assigned EC number	0.3281	0.8031	0.8801	yes	N/A
P85969	SNAB_RAT	No assigned EC number	0.6126	0.8593	0.9259	no	N/A
Q54NP6	SNAA_DICDI	No assigned EC number	0.4594	0.8031	0.8831	yes	N/A
Q9P4D0	SEC17_PICPG	No assigned EC number	0.3435	0.8093	0.8720	yes	N/A
Q9P4X4	SEC17_SCHPO	No assigned EC number	0.3607	0.7937	0.8788	yes	N/A
Q23983	SNAP_DROME	No assigned EC number	0.6785	0.7875	0.8630	yes	N/A
P28663	SNAB_MOUSE	No assigned EC number	0.6161	0.8625	0.9261	no	N/A
Q9DB05	SNAA_MOUSE	No assigned EC number	0.6653	0.7281	0.7898	yes	N/A
P81126	SNAB_BOVIN	No assigned EC number	0.6091	0.8625	0.9261	no	N/A
P81125	SNAA_BOVIN	No assigned EC number	0.6574	0.7281	0.7898	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		320
KOG1586\|consensus		288		100.0
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	100.0
KOG1586\|consensus		288		99.97
KOG1585\|consensus		308		99.94
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	99.91
KOG4626\|consensus		966		99.78
KOG4626\|consensus		966		99.75
KOG2003\|consensus		840		99.64
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.62
KOG1840\|consensus		508		99.6
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.6
KOG1126\|consensus		638		99.52
KOG1130\|consensus		639		99.52
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.52
KOG0547\|consensus		606		99.45
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.42
KOG1130\|consensus		639		99.42
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.42
KOG1155\|consensus		559		99.42
KOG1126\|consensus		638		99.41
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	99.41
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.4
KOG1840\|consensus		508		99.39
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.38
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.38
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.36
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	99.35
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.35
PRK11189		296	lipoprotein NlpI; Provisional	99.32
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.32
KOG1155\|consensus		559		99.32
KOG2003\|consensus		840		99.28
PRK12370		553	invasion protein regulator; Provisional	99.27
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.27
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	99.25
KOG0547\|consensus		606		99.21
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.21
PRK11189		296	lipoprotein NlpI; Provisional	99.21
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	99.17
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	99.14
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	99.13
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	99.11
KOG1585\|consensus		308		99.09
KOG0548\|consensus		539		99.08
PRK12370		553	invasion protein regulator; Provisional	99.04
PRK15359		144	type III secretion system chaperone protein SscB;	99.04
KOG2002\|consensus		1018		99.03
KOG1173\|consensus		611		99.03
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.02
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	99.01
KOG1173\|consensus		611		99.01
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	99.01
KOG2002\|consensus		1018		98.96
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	98.92
PRK15359		144	type III secretion system chaperone protein SscB;	98.91
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	98.9
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	98.89
KOG1125\|consensus		579		98.86
PRK10370		198	formate-dependent nitrite reductase complex subuni	98.85
KOG2076\|consensus		895		98.83
PRK14574		822	hmsH outer membrane protein; Provisional	98.82
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	98.8
TIGR02552		135	LcrH_SycD type III secretion low calcium response	98.78
KOG1129\|consensus		478		98.76
PRK14574		822	hmsH outer membrane protein; Provisional	98.76
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.73
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	98.72
PLN02789		320	farnesyltranstransferase	98.71
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	98.69
PRK14720		906	transcript cleavage factor/unknown domain fusion p	98.69
KOG0553\|consensus		304		98.68
KOG1174\|consensus		564		98.68
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	98.68
PRK04841		903	transcriptional regulator MalT; Provisional	98.67
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	98.67
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	98.65
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	98.63
PRK10370		198	formate-dependent nitrite reductase complex subuni	98.63
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	98.61
PLN02789		320	farnesyltranstransferase	98.61
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	98.6
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	98.59
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	98.59
KOG2076\|consensus		895		98.59
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	98.59
KOG0553\|consensus		304		98.58
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	98.58
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	98.57
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	98.57
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	98.55
KOG0548\|consensus		539		98.53
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	98.53
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	98.52
KOG0624\|consensus		504		98.52
KOG1941\|consensus		518		98.52
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	98.51
PRK10803		263	tol-pal system protein YbgF; Provisional	98.5
KOG1125\|consensus		579		98.5
TIGR02552		135	LcrH_SycD type III secretion low calcium response	98.5
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	98.49
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	98.46
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	98.45
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	98.44
KOG1129\|consensus		478		98.43
PRK04841		903	transcriptional regulator MalT; Provisional	98.42
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	98.42
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	98.41
KOG1941\|consensus		518		98.4
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	98.4
PRK10803		263	tol-pal system protein YbgF; Provisional	98.39
PF12688		120	TPR_5: Tetratrico peptide repeat	98.37
KOG3060\|consensus		289		98.35
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	98.35
PLN03077		857	Protein ECB2; Provisional	98.32
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	98.32
KOG4234\|consensus		271		98.31
KOG0624\|consensus		504		98.29
KOG0550\|consensus		486		98.28
PF12688		120	TPR_5: Tetratrico peptide repeat	98.27
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	98.27
KOG0543\|consensus		397		98.26
KOG1156\|consensus		700		98.26
PLN03218		1060	maturation of RBCL 1; Provisional	98.26
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	98.25
PLN03218		1060	maturation of RBCL 1; Provisional	98.24
PF04190		260	DUF410: Protein of unknown function (DUF410) ; Int	98.23
KOG1127\|consensus		1238		98.22
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.18
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	98.13
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	98.08
PRK14720		906	transcript cleavage factor/unknown domain fusion p	98.08
KOG4162\|consensus		799		98.08
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	98.06
KOG0550\|consensus		486		98.03
PF13512		142	TPR_18: Tetratricopeptide repeat	98.01
KOG1127\|consensus		1238		97.98
KOG1128\|consensus		777		97.96
KOG3616\|consensus		1636		97.96
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	97.96
PLN03077		857	Protein ECB2; Provisional	97.95
KOG1156\|consensus		700		97.94
KOG3060\|consensus		289		97.94
KOG4555\|consensus		175		97.93
KOG1128\|consensus		777		97.93
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	97.92
KOG4555\|consensus		175		97.92
KOG3617\|consensus		1416		97.9
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	97.89
KOG0495\|consensus		913		97.85
PRK15331		165	chaperone protein SicA; Provisional	97.84
KOG1174\|consensus		564		97.83
PRK15331		165	chaperone protein SicA; Provisional	97.81
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	97.81
KOG0543\|consensus		397		97.8
PF13371		73	TPR_9: Tetratricopeptide repeat	97.78
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	97.76
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	97.76
COG4105		254	ComL DNA uptake lipoprotein [General function pred	97.73
KOG4162\|consensus		799		97.73
KOG3617\|consensus		1416		97.71
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	97.66
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	97.6
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	97.56
COG4783		484	Putative Zn-dependent protease, contains TPR repea	97.51
PF13512		142	TPR_18: Tetratricopeptide repeat	97.41
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	97.38
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	97.38
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	97.34
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	97.34
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	97.33
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	97.3
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	97.29
PF13371		73	TPR_9: Tetratricopeptide repeat	97.26
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	97.26
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	97.24
KOG4642\|consensus		284		97.2
KOG2376\|consensus		652		97.18
KOG4234\|consensus		271		97.18
PRK11906		458	transcriptional regulator; Provisional	97.16
PF04184		539	ST7: ST7 protein; InterPro: IPR007311 The ST7 (for	97.15
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	97.08
KOG4340\|consensus		459		97.07
KOG2300\|consensus		629		97.05
PF11817		247	Foie-gras_1: Foie gras liver health family 1; Inte	97.05
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	97.05
COG4783		484	Putative Zn-dependent protease, contains TPR repea	97.02
COG0457		291	NrfG FOG: TPR repeat [General function prediction	97.01
KOG3785\|consensus		557		96.98
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	96.95
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	96.94
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	96.93
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	96.9
COG4700		251	Uncharacterized protein conserved in bacteria cont	96.86
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	96.86
COG0457		291	NrfG FOG: TPR repeat [General function prediction	96.86
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	96.84
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	96.84
COG4105		254	ComL DNA uptake lipoprotein [General function pred	96.84
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	96.82
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	96.82
KOG0495\|consensus		913		96.81
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	96.78
PF13428		44	TPR_14: Tetratricopeptide repeat	96.71
PF13431		34	TPR_17: Tetratricopeptide repeat	96.71
PF13431		34	TPR_17: Tetratricopeptide repeat	96.67
KOG3024\|consensus		312		96.62
KOG1463\|consensus		411		96.57
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	96.53
KOG2047\|consensus		835		96.52
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	96.51
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	96.4
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	96.39
KOG2376\|consensus		652		96.37
KOG3785\|consensus		557		96.35
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	96.32
COG4700		251	Uncharacterized protein conserved in bacteria cont	96.32
KOG3081\|consensus		299		96.29
KOG0551\|consensus		390		96.23
KOG1538\|consensus		1081		96.21
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	96.21
KOG3616\|consensus		1636		96.17
KOG1070\|consensus		1710		96.16
KOG1550\|consensus		552		96.12
KOG2796\|consensus		366		96.11
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	96.11
KOG4340\|consensus		459		96.1
KOG0545\|consensus		329		96.03
PF03704		146	BTAD: Bacterial transcriptional activator domain;	96.02
KOG4648\|consensus		536		96.0
PF03704		146	BTAD: Bacterial transcriptional activator domain;	95.97
PF13428		44	TPR_14: Tetratricopeptide repeat	95.9
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	95.88
KOG1915\|consensus		677		95.85
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	95.82
KOG2300\|consensus		629		95.77
PF12968		144	DUF3856: Domain of Unknown Function (DUF3856); Int	95.77
KOG1070\|consensus		1710		95.72
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	95.66
COG5159		421	RPN6 26S proteasome regulatory complex component [	95.59
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	95.5
KOG4648\|consensus		536		95.48
COG0790		292	FOG: TPR repeat, SEL1 subfamily [General function	95.39
PF11817		247	Foie-gras_1: Foie gras liver health family 1; Inte	95.37
PF12968		144	DUF3856: Domain of Unknown Function (DUF3856); Int	95.31
PRK11906		458	transcriptional regulator; Provisional	95.26
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	95.19
KOG2047\|consensus		835		95.18
KOG4642\|consensus		284		95.17
COG0790		292	FOG: TPR repeat, SEL1 subfamily [General function	95.11
KOG1915\|consensus		677		94.97
KOG1464\|consensus		440		94.95
PF11207		203	DUF2989: Protein of unknown function (DUF2989); In	94.83
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	94.7
PF04184		539	ST7: ST7 protein; InterPro: IPR007311 The ST7 (for	94.68
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	94.56
KOG2796\|consensus		366		94.51
KOG0551\|consensus		390		94.47
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	94.44
KOG1550\|consensus		552		94.37
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	94.28
smart00028		34	TPR Tetratricopeptide repeats. Repeats present in	94.27
KOG2610\|consensus		491		94.26
COG4785		297	NlpI Lipoprotein NlpI, contains TPR repeats [Gener	94.2
KOG4814\|consensus		872		94.07
PF05843		280	Suf: Suppressor of forked protein (Suf); InterPro:	93.71
KOG3081\|consensus		299		93.54
KOG2041\|consensus		1189		93.54
KOG0545\|consensus		329		93.52
COG4785		297	NlpI Lipoprotein NlpI, contains TPR repeats [Gener	93.41
KOG1308\|consensus		377		93.34
KOG2581\|consensus		493		93.26
KOG2053\|consensus		932		93.25
PF13281		374	DUF4071: Domain of unknown function (DUF4071)	92.87
PF13281		374	DUF4071: Domain of unknown function (DUF4071)	92.82
PF05843		280	Suf: Suppressor of forked protein (Suf); InterPro:	92.73
PF08626		1185	TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC	92.66
smart00028		34	TPR Tetratricopeptide repeats. Repeats present in	92.24
PF12739		414	TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex	92.22
PF10516		38	SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat	92.2
PF04190		260	DUF410: Protein of unknown function (DUF410) ; Int	91.98
KOG1464\|consensus		440		91.68
KOG2041\|consensus		1189		91.55
KOG4507\|consensus		886		91.41
cd02681		76	MIT_calpain7_1 MIT: domain contained within Microt	91.29
COG4976		287	Predicted methyltransferase (contains TPR repeat)	91.21
KOG4322\|consensus		482		91.21
KOG0686\|consensus		466		90.82
PF02259		352	FAT: FAT domain; InterPro: IPR003151 The FAT domai	90.56
KOG0376\|consensus		476		90.48
PF12739		414	TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex	89.31
PF14853		53	Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe	89.2
PF10516		38	SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat	88.89
KOG1538\|consensus		1081		88.44
KOG4507\|consensus		886		88.37
KOG2053\|consensus		932		88.18
KOG2471\|consensus		696		88.05
KOG0376\|consensus		476		87.87
KOG2471\|consensus		696		87.72
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	87.57
PF02259		352	FAT: FAT domain; InterPro: IPR003151 The FAT domai	87.32
PF10373		278	EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP	86.65
PF04212		69	MIT: MIT (microtubule interacting and transport) d	86.36
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	86.3
PF07721		26	TPR_4: Tetratricopeptide repeat; InterPro: IPR0117	85.88
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	85.77
KOG0687\|consensus		393		85.73
PF10579		80	Rapsyn_N: Rapsyn N-terminal myristoylation and lin	85.64
KOG2581\|consensus		493		85.16
cd02680		75	MIT_calpain7_2 MIT: domain contained within Microt	84.73
KOG1308\|consensus		377		84.49
PRK10941		269	hypothetical protein; Provisional	84.35
KOG3824\|consensus		472		84.25
cd02680		75	MIT_calpain7_2 MIT: domain contained within Microt	84.01
cd02683		77	MIT_1 MIT: domain contained within Microtubule Int	83.9
KOG2114\|consensus		933		83.8
KOG4814\|consensus		872		83.74
cd02682		75	MIT_AAA_Arch MIT: domain contained within Microtub	82.56
PF07721		26	TPR_4: Tetratricopeptide repeat; InterPro: IPR0117	82.52
PF11207		203	DUF2989: Protein of unknown function (DUF2989); In	82.31
cd02684		75	MIT_2 MIT: domain contained within Microtubule Int	81.72
smart00745		77	MIT Microtubule Interacting and Trafficking molecu	81.56
KOG1839\|consensus		1236		81.26
KOG3364\|consensus		149		80.01

>KOG1586\|consensus	Back alignment and domain information

Probab=100.00  E-value=7.5e-51  Score=337.28  Aligned_cols=279  Identities=60%  Similarity=0.952  Sum_probs=266.3

Q ss_pred             chHHHHhHHHHHHHhhhh--hhcccc-CCCCHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHcCChHHHHHHHH
Q psy9376           2 TDEKLVCEKQLAAALLRV--VFITKV-GGNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACNLL   78 (320)
Q Consensus         2 ~~~~l~~~~~~~~k~~~~--~~~~~~-~~~~~~~A~~~y~~ag~~~~~~g~~~~A~~~y~kA~~~~~~~~~~~~aa~~~~   78 (320)
                      .+.+|+.+   |||.++.  +|. +| |++++++|+++|.+||+.|+..++|+.|..+|.++++++.+.++.+.++..|.
T Consensus         3 ~a~~l~k~---AEkK~~~s~gF~-lfgg~~k~eeAadl~~~Aan~yklaK~w~~AG~aflkaA~~h~k~~skhDaat~Yv   78 (288)
T KOG1586|consen    3 DAVQLMKK---AEKKLNGSGGFL-LFGGSNKYEEAAELYERAANMYKLAKNWSAAGDAFLKAADLHLKAGSKHDAATTYV   78 (288)
T ss_pred             cHHHHHHH---HHHhcccCCccc-ccCCCcchHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHhcCCchhHHHHHH
Confidence            35678888   8888763  444 44 47899999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCHHHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHhHhhccCCchHHHHHHH
Q psy9376          79 DAANCFKKTDNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFKGEESNSSANKCLL  158 (320)
Q Consensus        79 ~aa~~y~~~~~~eA~~~~~kA~~l~~~~~~~~~aa~~~~~la~~y~~~l~~~~~Ai~~y~kA~~~~~~~~~~~~a~~~~~  158 (320)
                      .+++||++.+|++|++|+++|++|+.+.|++..+|+.+..+|++|+..|.++++||.+|++|.+.|..+.....+..|+.
T Consensus        79 eA~~cykk~~~~eAv~cL~~aieIyt~~Grf~~aAk~~~~iaEiyEsdl~d~ekaI~~YE~Aae~yk~ees~ssANKC~l  158 (288)
T KOG1586|consen   79 EAANCYKKVDPEEAVNCLEKAIEIYTDMGRFTMAAKHHIEIAEIYESDLQDFEKAIAHYEQAAEYYKGEESVSSANKCLL  158 (288)
T ss_pred             HHHHHhhccChHHHHHHHHHHHHHHHhhhHHHHHHhhhhhHHHHHhhhHHHHHHHHHHHHHHHHHHcchhhhhhHHHHHH
Confidence            99999999999999999999999999999999999999999999999889999999999999999999999999999999


Q ss_pred             HHHHHHHHccCHHHHHHHHHHHHHhhhhhhhhhcchhHhHHHHHHHHHh-hhhHHHHHHHHHHHHhCCCccCcHHHHHHH
Q psy9376         159 KVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCHLC-IDVINAHNAIDRYKTIYPAFQDSREYKLLR  237 (320)
Q Consensus       159 ~la~~~~~~g~y~~Ai~~y~~~~~~~~~~~~~~~~~~~~~~~a~~~~l~-~d~~~~~~A~~~y~~~~~~f~~s~e~~~l~  237 (320)
                      ++++.-..+|+|.+||..|+++++..+++++++|+++++|+.+++|+++ .|...+..|+++|++++|.|.+|+||+++.
T Consensus       159 KvA~yaa~leqY~~Ai~iyeqva~~s~~n~LLKys~KdyflkAgLChl~~~D~v~a~~ALeky~~~dP~F~dsREckflk  238 (288)
T KOG1586|consen  159 KVAQYAAQLEQYSKAIDIYEQVARSSLDNNLLKYSAKDYFLKAGLCHLCKADEVNAQRALEKYQELDPAFTDSRECKFLK  238 (288)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhccchHHHhHHHHHHHHHHHHhHhcccHHHHHHHHHHHHhcCCcccccHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999 599999999999999999999999999999


Q ss_pred             HHHHHHHhcCHhHHHHHHHHHhhhcchhhhHHHHHHHHHHhhcCCCC
Q psy9376         238 ILIEHIEEQNVDGFTEAVKDYDSISRLDQWYTTVLLRIKKQVGRTSL  284 (320)
Q Consensus       238 ~l~~a~~~~d~~~~~~Ai~~ye~~~~ld~~~~~~l~~i~~~~~~~~~  284 (320)
                      +|+++++.+|.+.|.+.++.|+++.+||.|.++||++||+.|+...+
T Consensus       239 ~L~~aieE~d~e~fte~vkefDsisrLD~W~ttiLlkiK~siq~~ed  285 (288)
T KOG1586|consen  239 DLLDAIEEQDIEKFTEVVKEFDSISRLDQWKTTILLKIKKSIQGDED  285 (288)
T ss_pred             HHHHHHhhhhHHHHHHHHHhhhccchHHHHHHHHHHHHHHHHhcccc
Confidence            99999999999999999999999999999999999999999997654

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG1586\|consensus	Back alignment and domain information

>KOG1585\|consensus	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG4626\|consensus	Back alignment and domain information

>KOG4626\|consensus	Back alignment and domain information

>KOG2003\|consensus	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG1840\|consensus	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG1126\|consensus	Back alignment and domain information

>KOG1130\|consensus	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>KOG0547\|consensus	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG1130\|consensus	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>KOG1155\|consensus	Back alignment and domain information

>KOG1126\|consensus	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>KOG1840\|consensus	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG1155\|consensus	Back alignment and domain information

>KOG2003\|consensus	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0547\|consensus	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG1585\|consensus	Back alignment and domain information

>KOG0548\|consensus	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>KOG2002\|consensus	Back alignment and domain information

>KOG1173\|consensus	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG1173\|consensus	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>KOG2002\|consensus	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG1125\|consensus	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>KOG2076\|consensus	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>KOG1129\|consensus	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>KOG0553\|consensus	Back alignment and domain information

>KOG1174\|consensus	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>KOG2076\|consensus	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>KOG0553\|consensus	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>KOG0548\|consensus	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>KOG0624\|consensus	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>KOG1125\|consensus	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>KOG1129\|consensus	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>KOG3060\|consensus	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG4234\|consensus	Back alignment and domain information

>KOG0624\|consensus	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

Back alignment and domain information

>KOG0543\|consensus	Back alignment and domain information

>KOG1156\|consensus	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function	Back alignment and domain information

>KOG1127\|consensus	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>KOG4162\|consensus	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>KOG1127\|consensus	Back alignment and domain information

>KOG1128\|consensus	Back alignment and domain information

>KOG3616\|consensus	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>KOG1156\|consensus	Back alignment and domain information

>KOG3060\|consensus	Back alignment and domain information

>KOG4555\|consensus	Back alignment and domain information

>KOG1128\|consensus	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>KOG4555\|consensus	Back alignment and domain information

>KOG3617\|consensus	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0495\|consensus	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>KOG1174\|consensus	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0543\|consensus	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>KOG4162\|consensus	Back alignment and domain information

>KOG3617\|consensus	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG4642\|consensus	Back alignment and domain information

>KOG2376\|consensus	Back alignment and domain information

>KOG4234\|consensus	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG4340\|consensus	Back alignment and domain information

>KOG2300\|consensus	Back alignment and domain information

>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease []	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>COG0457 NrfG FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>KOG3785\|consensus	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0457 NrfG FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG0495\|consensus	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>KOG3024\|consensus	Back alignment and domain information

>KOG1463\|consensus	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG2047\|consensus	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG2376\|consensus	Back alignment and domain information

>KOG3785\|consensus	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>KOG3081\|consensus	Back alignment and domain information

>KOG0551\|consensus	Back alignment and domain information

>KOG1538\|consensus	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>KOG3616\|consensus	Back alignment and domain information

>KOG1070\|consensus	Back alignment and domain information

>KOG1550\|consensus	Back alignment and domain information

>KOG2796\|consensus	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>KOG4340\|consensus	Back alignment and domain information

>KOG0545\|consensus	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>KOG4648\|consensus	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>KOG1915\|consensus	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>KOG2300\|consensus	Back alignment and domain information

>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT	Back alignment and domain information

>KOG1070\|consensus	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>KOG4648\|consensus	Back alignment and domain information

>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only]	Back alignment and domain information

>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease []	Back alignment and domain information

>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2047\|consensus	Back alignment and domain information

>KOG4642\|consensus	Back alignment and domain information

>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only]	Back alignment and domain information

>KOG1915\|consensus	Back alignment and domain information

>KOG1464\|consensus	Back alignment and domain information

>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>KOG2796\|consensus	Back alignment and domain information

>KOG0551\|consensus	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>KOG1550\|consensus	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>smart00028 TPR Tetratricopeptide repeats	Back alignment and domain information

>KOG2610\|consensus	Back alignment and domain information

>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG4814\|consensus	Back alignment and domain information

>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins	Back alignment and domain information

>KOG3081\|consensus	Back alignment and domain information

>KOG2041\|consensus	Back alignment and domain information

>KOG0545\|consensus	Back alignment and domain information

>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG1308\|consensus	Back alignment and domain information

>KOG2581\|consensus	Back alignment and domain information

>KOG2053\|consensus	Back alignment and domain information

>PF13281 DUF4071: Domain of unknown function (DUF4071)	Back alignment and domain information

>PF13281 DUF4071: Domain of unknown function (DUF4071)	Back alignment and domain information

>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins	Back alignment and domain information

>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway	Back alignment and domain information

>smart00028 TPR Tetratricopeptide repeats	Back alignment and domain information

>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex []	Back alignment and domain information

>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function	Back alignment and domain information

>KOG1464\|consensus	Back alignment and domain information

>KOG2041\|consensus	Back alignment and domain information

>KOG4507\|consensus	Back alignment and domain information

>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only]	Back alignment and domain information

>KOG4322\|consensus	Back alignment and domain information

>KOG0686\|consensus	Back alignment and domain information

>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases	Back alignment and domain information

>KOG0376\|consensus	Back alignment and domain information

>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex []	Back alignment and domain information

>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A	Back alignment and domain information

>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG1538\|consensus	Back alignment and domain information

>KOG4507\|consensus	Back alignment and domain information

>KOG2053\|consensus	Back alignment and domain information

>KOG2471\|consensus	Back alignment and domain information

>KOG0376\|consensus	Back alignment and domain information

>KOG2471\|consensus	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases	Back alignment and domain information

>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ]	Back alignment and domain information

>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>KOG0687\|consensus	Back alignment and domain information

>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane	Back alignment and domain information

>KOG2581\|consensus	Back alignment and domain information

>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>KOG1308\|consensus	Back alignment and domain information

>PRK10941 hypothetical protein; Provisional	Back alignment and domain information

>KOG3824\|consensus	Back alignment and domain information

>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>KOG2114\|consensus	Back alignment and domain information

>KOG4814\|consensus	Back alignment and domain information

>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models	Back alignment and domain information

>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed	Back alignment and domain information

>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules	Back alignment and domain information

>smart00745 MIT Microtubule Interacting and Trafficking molecule domain	Back alignment and domain information

>KOG1839\|consensus	Back alignment and domain information

>KOG3364\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		320
1qqe_A		292	Crystal Structure Of The Vesicular Transport Protei		3e-34
2ifu_A		307	Crystal Structure Of A Gamma-Snap From Danio Rerio		6e-04

>pdb|1QQE|A Chain A, Crystal Structure Of The Vesicular Transport Protein Sec17 Length = 292

Back alignment and structure

Iteration: 1

Score = 142 bits (357), Expect = 3e-34, Method: Compositional matrix adjust. Identities = 85/259 (32%), Positives = 145/259 (55%), Gaps = 2/259 (0%) Query: 29 KIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACNLLDAANCFKKTD 88 K +EA + +AA ++++ K+ N AG +F++AA+ K+G + +A ++A CFK Sbjct: 32 KFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNTYVEAYKCFKSGG 91 Query: 89 NEA-AIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFKGE 147 N A+D L AI I+T G+F A + EI E D D KA++ YE A ++ + Sbjct: 92 NSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQD 151 Query: 148 ESNSSANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCHL- 206 +S + +NKC +K A AL Y +A IY ++ ++S+ + L ++S K+YF + LC L Sbjct: 152 QSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLA 211 Query: 207 CIDVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIEEQNVDGFTEAVKDYDSISRLDQ 266 D + A + ++ P F DSRE L+ LI+ + E + + +E K++D+ RLD+ Sbjct: 212 ATDAVAAARTLQEGQSEDPNFADSRESNFLKSLIDAVNEGDSEQLSEHCKEFDNFMRLDK 271 Query: 267 WYTTVLLRIKKQVGRTSLD 285 W T+L +IK+ + + D Sbjct: 272 WKITILNKIKESIQQQEDD 290

PyMOL of 1qqe

>pdb|2IFU|A Chain A, Crystal Structure Of A Gamma-Snap From Danio Rerio Length = 307

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		320
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	3e-82
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	6e-09
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	7e-66
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	6e-06
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	6e-05
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	2e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-05
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	3e-04
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	7e-04
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	7e-04
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	8e-04

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292	Back alignment and structure

 Score =  249 bits (638), Expect = 3e-82
 Identities = 86/273 (31%), Positives = 149/273 (54%), Gaps = 2/273 (0%)

Query: 9   EKQLAAALLRVVFITKVGGNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSG 68
           EK+   +   +   +     K +EA +   +AA ++++ K+ N AG +F++AA+   K+G
Sbjct: 12  EKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAG 71

Query: 69  TKHDAACNLLDAANCFKKTDN-EAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDC 127
            + +A    ++A  CFK   N   A+D L  AI I+T  G+F   A     + EI E D 
Sbjct: 72  NEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDL 131

Query: 128 VDQEKAVEHYEQAATYFKGEESNSSANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDS 187
            D  KA++ YE A  ++  ++S + +NKC +K A   AL   Y +A  IY ++ ++S+ +
Sbjct: 132 HDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGN 191

Query: 188 SLLKYSAKEYFFRAALCHLCI-DVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIEEQ 246
            L ++S K+YF +  LC L   D + A   +   ++  P F DSRE   L+ LI+ + E 
Sbjct: 192 RLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADSRESNFLKSLIDAVNEG 251

Query: 247 NVDGFTEAVKDYDSISRLDQWYTTVLLRIKKQV 279
           + +  +E  K++D+  RLD+W  T+L +IK+ +
Sbjct: 252 DSEQLSEHCKEFDNFMRLDKWKITILNKIKESI 284

PyMOL of 1qqe

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		320
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	100.0
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	100.0
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.84
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.81
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.8
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.79
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.79
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.79
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.78
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.77
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.77
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.77
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.76
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.76
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.74
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	99.74
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.73
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.73
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.73
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.71
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.7
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.69
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	99.69
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.69
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.68
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	99.67
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.67
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.66
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.64
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.64
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.63
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.63
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.63
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	99.62
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	99.62
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.62
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.62
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	99.62
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.61
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.61
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.61
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.61
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.6
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.6
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	99.6
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.6
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.6
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	99.59
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.59
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.59
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.59
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.58
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.58
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.56
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.56
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.56
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.56
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	99.56
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	99.54
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.54
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.54
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.53
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	99.53
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	99.53
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.52
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.52
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.51
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	99.51
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.51
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	99.51
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	99.5
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	99.49
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	99.49
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	99.49
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.48
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.48
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.48
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.47
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	99.47
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	99.47
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.46
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.46
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.45
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.45
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	99.43
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	99.42
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	99.42
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	99.41
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	99.4
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	99.4
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	99.39
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	99.39
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	99.39
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	99.39
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	99.39
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	99.35
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	99.32
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	99.29
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	99.28
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.27
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	99.27
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	99.26
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	99.26
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	99.26
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	99.26
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	99.26
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	99.25
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.25
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	99.24
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	99.22
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	99.22
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	99.22
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	99.21
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	99.21
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	99.19
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	99.19
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	99.19
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	99.18
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	99.18
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	99.17
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	99.17
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	99.16
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	99.16
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	99.16
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	99.14
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	99.13
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	99.12
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	99.11
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	99.11
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	99.1
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	99.1
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	99.08
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	99.07
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	99.07
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	99.06
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	99.06
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	99.05
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	99.05
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	99.05
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	99.04
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	99.04
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	99.03
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	99.02
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	99.0
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	98.99
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	98.99
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	98.99
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.99
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	98.98
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	98.98
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	98.96
3k9i_A		117	BH0479 protein; putative protein binding protein,	98.95
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	98.95
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	98.95
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	98.93
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	98.93
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	98.93
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	98.9
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	98.89
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	98.89
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	98.88
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	98.88
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	98.88
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	98.87
2l6j_A		111	TPR repeat-containing protein associated with HSP;	98.86
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	98.86
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	98.85
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	98.85
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.81
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	98.81
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	98.8
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	98.79
3k9i_A		117	BH0479 protein; putative protein binding protein,	98.78
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	98.78
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	98.74
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	98.74
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	98.74
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	98.74
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	98.73
1klx_A		138	Cysteine rich protein B; structural genomics, heli	98.73
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	98.72
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	98.72
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	98.7
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	98.69
2kat_A		115	Uncharacterized protein; NESG, structure, structur	98.6
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	98.58
2l6j_A		111	TPR repeat-containing protein associated with HSP;	98.57
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	98.55
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	98.54
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	98.53
2kat_A		115	Uncharacterized protein; NESG, structure, structur	98.5
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	98.48
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	98.47
1klx_A		138	Cysteine rich protein B; structural genomics, heli	98.46
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	98.42
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	98.41
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	98.39
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	98.31
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.22
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	98.21
3lpz_A		336	GET4 (YOR164C homolog); protein targeting, tail-an	98.2
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.2
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	98.2
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	98.18
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	98.17
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	98.07
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	98.04
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	98.0
2wpv_A		312	GET4, UPF0363 protein YOR164C; golgi-ER traffickin	98.0
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	97.95
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	97.91
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	97.62
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	97.55
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	97.33
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	97.3
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	97.29
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	97.16
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	97.01
3u64_A		301	Protein TP_0956; tetratrico peptide repeat, protei	97.0
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	96.99
1pc2_A		152	Mitochondria fission protein; unknown function; NM	96.96
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	96.92
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	96.45
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	96.37
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	96.2
3u64_A		301	Protein TP_0956; tetratrico peptide repeat, protei	96.1
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	96.06
2wpv_A		312	GET4, UPF0363 protein YOR164C; golgi-ER traffickin	96.02
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	95.85
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	95.84
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	95.82
1nzn_A		126	CGI-135 protein, fission protein FIS1P; TPR, unkno	95.29
1pc2_A		152	Mitochondria fission protein; unknown function; NM	95.19
4b4t_S		523	RPN3, 26S proteasome regulatory subunit RPN3; hydr	95.09
3lpz_A		336	GET4 (YOR164C homolog); protein targeting, tail-an	95.03
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	93.85
4h7y_A		161	Dual specificity protein kinase TTK; mitotic check	92.67
4gns_B		754	Protein CSD3, chitin biosynthesis protein CHS6; FN	92.35
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	92.35
3o48_A		134	Mitochondria fission 1 protein; tetratricopeptide	91.19
1y8m_A		144	FIS1; mitochondria, unknown function; NMR {Sacchar	90.81
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	90.7
1ya0_A		497	SMG-7 transcript variant 2; alpha-helical repeat,	90.5
4h7y_A		161	Dual specificity protein kinase TTK; mitotic check	88.86
2yin_A		436	DOCK2, dedicator of cytokinesis protein 2; apoptos	88.69
1ya0_A		497	SMG-7 transcript variant 2; alpha-helical repeat,	88.38
2yin_A		436	DOCK2, dedicator of cytokinesis protein 2; apoptos	87.44
2wm9_A		428	Dedicator of cytokinesis protein 9; polymorphism,	87.13
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	84.85
2r17_C		298	Vacuolar protein sorting-associated protein 35; pr	84.32
1nzn_A		126	CGI-135 protein, fission protein FIS1P; TPR, unkno	83.6
2crb_A		97	Nuclear receptor binding factor 2; NRBF-2, MIT dom	83.26
4b4t_O		393	26S proteasome regulatory subunit RPN9; hydrolase,	82.9
3mkq_B		177	Coatomer subunit alpha; beta-propeller, alpha-sole	82.23
2ff4_A		388	Probable regulatory protein EMBR; winged-helix, te	82.12
2w2u_A		83	Hypothetical P60 katanin; hydrolase transport comp	81.62
4a5x_A		86	MITD1, MIT domain-containing protein 1; protein tr	80.86
2ff4_A		388	Probable regulatory protein EMBR; winged-helix, te	80.75

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

Probab=100.00  E-value=1.3e-37  Score=279.28  Aligned_cols=278  Identities=31%  Similarity=0.543  Sum_probs=239.3

Q ss_pred             chHHHHhHHHHHHHhhhh--hhccccCC--CC-HHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHcCChHHHHHH
Q psy9376           2 TDEKLVCEKQLAAALLRV--VFITKVGG--NK-IDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACN   76 (320)
Q Consensus         2 ~~~~l~~~~~~~~k~~~~--~~~~~~~~--~~-~~~A~~~y~~ag~~~~~~g~~~~A~~~y~kA~~~~~~~~~~~~aa~~   76 (320)
                      .|++|+.+   |+|++++  +|++||++  |+ +++|+++|.++|.+|...|++++|+++|.+|++++++++++...+.+
T Consensus         3 ~a~~~~~~---a~k~~~~~~~~~~~~~~~~~~~~~~A~~~~~~a~~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~a~~   79 (292)
T 1qqe_A            3 DPVELLKR---AEKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNT   79 (292)
T ss_dssp             CHHHHHHH---HHHHSSCCCTHHHHHSCCSHHHHHHHHHHHHHHHHHHHHTTCTHHHHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             cHHHHHHH---HHHHhCcCCCcchhcCCCCCccHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCHHHHHHH
Confidence            37889999   9999985  34466763  54 99999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcC-CHHHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHhHhhccCCchHHHH
Q psy9376          77 LLDAANCFKKT-DNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFKGEESNSSANK  155 (320)
Q Consensus        77 ~~~aa~~y~~~-~~~eA~~~~~kA~~l~~~~~~~~~aa~~~~~la~~y~~~l~~~~~Ai~~y~kA~~~~~~~~~~~~a~~  155 (320)
                      |.++|.+|... ++++|+.+|++|+.++++.|++..++.++.++|.+|...+|++++|+.+|++|+++++..+.......
T Consensus        80 ~~~lg~~~~~~g~~~~A~~~~~~Al~l~~~~g~~~~~a~~~~~lg~~~~~~lg~~~~A~~~~~~Al~~~~~~~~~~~~~~  159 (292)
T 1qqe_A           80 YVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNK  159 (292)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCHHHHHH
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhhcCHHHHHHHHHHHHHHHHhCCChHHHHH
Confidence            99999999998 99999999999999999999999999999999999998229999999999999999999888777789


Q ss_pred             HHHHHHHHHHHccCHHHHHHHHHHHHHhhhhhhhhhcchhHhHHHHHHHHHhh-hhHHHHHHHHHHHHhCCCccCcHHHH
Q psy9376         156 CLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCHLCI-DVINAHNAIDRYKTIYPAFQDSREYK  234 (320)
Q Consensus       156 ~~~~la~~~~~~g~y~~Ai~~y~~~~~~~~~~~~~~~~~~~~~~~a~~~~l~~-d~~~~~~A~~~y~~~~~~f~~s~e~~  234 (320)
                      ++.++|.++..+|+|++|+.+|+++....++.+...+.....+++.+.|++.. +...+..+++.+.++.|.|+.+.++.
T Consensus       160 ~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~l~p~~~~~~~~~  239 (292)
T 1qqe_A          160 CFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADSRESN  239 (292)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHTTSSCTTTGGGHHHHHHHHHHHHHHTTCHHHHHHHHHGGGCC---------HH
T ss_pred             HHHHHHHHHHHhCCHHHHHHHHHHHHHHHhcCCcccHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCCCcHHHH
Confidence            99999999999999999999999999988777665566666778888887754 45555555555556678888888888


Q ss_pred             HHHHHHHHHHhcCHhHHHHHHHHHhhhcchhhhHHHHHHHHHHhhcCC
Q psy9376         235 LLRILIEHIEEQNVDGFTEAVKDYDSISRLDQWYTTVLLRIKKQVGRT  282 (320)
Q Consensus       235 ~l~~l~~a~~~~d~~~~~~Ai~~ye~~~~ld~~~~~~l~~i~~~~~~~  282 (320)
                      .+..++.++..++.+++++|+..|+++.++|||++.++.+|++.+++.
T Consensus       240 ~l~~l~~~~~~~~~~~~~~A~~~~~~~~~l~~~~~~~~~~~k~~~~~~  287 (292)
T 1qqe_A          240 FLKSLIDAVNEGDSEQLSEHCKEFDNFMRLDKWKITILNKIKESIQQQ  287 (292)
T ss_dssp             HHHHHHHHHHTTCTTTHHHHHHHHTTSSCCCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHcCCHHHHHHHHHHhccCCccHHHHHHHHHHHHHHhhcc
Confidence            888888888878999999999999999999999999999999999753

PyMOL of 1qqe

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...

Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A*	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A*	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A	Back alignment and structure

>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum}	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A	Back alignment and structure

>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae}	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A	Back alignment and structure

>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A	Back alignment and structure

>2yin_A DOCK2, dedicator of cytokinesis protein 2; apoptosis, DOCK, DOCK guanine nucleotide exchange factors; 2.70A {Homo sapiens} PDB: 3b13_A	Back alignment and structure

>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2yin_A DOCK2, dedicator of cytokinesis protein 2; apoptosis, DOCK, DOCK guanine nucleotide exchange factors; 2.70A {Homo sapiens} PDB: 3b13_A	Back alignment and structure

>2wm9_A Dedicator of cytokinesis protein 9; polymorphism, cell membrane, phosphoprotein, nucleotide-binding, alternative splicing; 2.20A {Homo sapiens} PDB: 2wmn_A* 2wmo_A*	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>2r17_C Vacuolar protein sorting-associated protein 35; protein transport, membrane, phosphorylation; 2.80A {Homo sapiens}	Back alignment and structure

>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A	Back alignment and structure

>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1	Back alignment and structure

>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae}	Back alignment and structure

>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A*	Back alignment and structure

>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius}	Back alignment and structure

>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens}	Back alignment and structure

>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		320
d1qqea_		290	a.118.8.1 (A:) Vesicular transport protein sec17 {	8e-51

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290	Back information, alignment and structure


class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Vesicular transport protein sec17
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  168 bits (425), Expect = 8e-51
 Identities = 86/273 (31%), Positives = 149/273 (54%), Gaps = 2/273 (0%)

Query: 9   EKQLAAALLRVVFITKVGGNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSG 68
           EK+   +   +   +     K +EA +   +AA ++++ K+ N AG +F++AA+   K+G
Sbjct: 12  EKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAG 71

Query: 69  TKHDAACNLLDAANCFKKTDN-EAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDC 127
            + +A    ++A  CFK   N   A+D L  AI I+T  G+F   A     + EI E D 
Sbjct: 72  NEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDL 131

Query: 128 VDQEKAVEHYEQAATYFKGEESNSSANKCLLKVAHHAALLQNYNKAIQIYEEVGRTSLDS 187
            D  KA++ YE A  ++  ++S + +NKC +K A   AL   Y +A  IY ++ ++S+ +
Sbjct: 132 HDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGN 191

Query: 188 SLLKYSAKEYFFRAALCHLCI-DVINAHNAIDRYKTIYPAFQDSREYKLLRILIEHIEEQ 246
            L ++S K+YF +  LC L   D + A   +   ++  P F DSRE   L+ LI+ + E 
Sbjct: 192 RLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADSRESNFLKSLIDAVNEG 251

Query: 247 NVDGFTEAVKDYDSISRLDQWYTTVLLRIKKQV 279
           + +  +E  K++D+  RLD+W  T+L +IK+ +
Sbjct: 252 DSEQLSEHCKEFDNFMRLDKWKITILNKIKESI 284

PyMOL of d1qqea_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		320
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	100.0
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	99.82
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.67
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.65
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.61
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	99.53
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.53
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	99.51
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	99.51
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.5
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	99.46
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.38
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	99.37
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	99.36
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	99.29
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	99.29
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	99.27
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	99.26
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	99.26
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	99.25
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	99.24
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	99.24
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	99.23
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	99.22
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	99.22
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	99.2
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	99.19
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	99.17
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.14
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	99.12
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	99.11
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	99.1
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	99.04
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	99.01
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.0
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	98.97
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	98.83
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	98.79
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	98.79
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	98.78
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	98.77
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	98.66
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	98.65
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	98.53
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	98.44
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	98.3
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	98.18
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	98.17
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	97.97
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	97.93
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	97.88
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	97.83
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	97.65
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	97.51
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	96.91
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	96.0
d1b89a_		336	Clathrin heavy chain proximal leg segment {Cow (Bo	91.52
d2crba1		83	Nuclear receptor binding factor 2, NRBF2, N-termin	90.48
d1wfda_		93	Hypothetical protein 1500032H18Rik {Mouse (Mus mus	87.53
d2crba1		83	Nuclear receptor binding factor 2, NRBF2, N-termin	86.37
d1wfda_		93	Hypothetical protein 1500032H18Rik {Mouse (Mus mus	84.63

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Vesicular transport protein sec17
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=1.6e-39  Score=289.53  Aligned_cols=280  Identities=31%  Similarity=0.539  Sum_probs=249.9

Q ss_pred             chHHHHhHHHHHHHhhhh--hhcccc-C--CCCHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHcCChHHHHHH
Q psy9376           2 TDEKLVCEKQLAAALLRV--VFITKV-G--GNKIDEAIECYTRAANMFKMAKKWNNAGKAFVEAANLHMKSGTKHDAACN   76 (320)
Q Consensus         2 ~~~~l~~~~~~~~k~~~~--~~~~~~-~--~~~~~~A~~~y~~ag~~~~~~g~~~~A~~~y~kA~~~~~~~~~~~~aa~~   76 (320)
                      .+++|+.+   |+|.++.  +|++.| +  +++|++|+++|.+||++|+..|+|++|+++|.+|++++.+.+++...+.+
T Consensus         3 ~~~~~l~~---aek~~~~~~~~~~~~~~~~~~~~~~Aa~~y~~aa~~y~~~~~~~~A~~~y~kA~~~~~~~~~~~~~a~~   79 (290)
T d1qqea_           3 DPVELLKR---AEKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSFLKAADYQKKAGNEDEAGNT   79 (290)
T ss_dssp             CHHHHHHH---HHHHSSCCCTHHHHHSCCSHHHHHHHHHHHHHHHHHHHHTTCTHHHHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             CHHHHHHH---HHHhcCcchhHHHHhcCCccccHHHHHHHHHHHHHHHHHCcCHHHHHHHHHHHHHHHHHcCCCHHHHHH
Confidence            36899999   8899973  443333 3  45789999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcC-CHHHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHhHhhccCCchHHHH
Q psy9376          77 LLDAANCFKKT-DNEAAIDCLSKAIVIYTDMGRFTMAAKHHQTIAEIYETDCVDQEKAVEHYEQAATYFKGEESNSSANK  155 (320)
Q Consensus        77 ~~~aa~~y~~~-~~~eA~~~~~kA~~l~~~~~~~~~aa~~~~~la~~y~~~l~~~~~Ai~~y~kA~~~~~~~~~~~~a~~  155 (320)
                      |.++|.+|... ++++|+++|++++.+++..|++..++.++.++|.+|...+|++++|+++|++|+++++..+++.....
T Consensus        80 ~~~~g~~y~~~~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~A~~~~~~A~~l~~~~~~~~~~~~  159 (290)
T d1qqea_          80 YVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNK  159 (290)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCHHHHHH
T ss_pred             HHHHHHHHHHhCCcHHHHHHHHHhhHHhhhcccchhHHHHHHHHHHhHhhHHHHHHHHHHHHHHHHHHHHhcCchhhhhh
Confidence            99999999998 99999999999999999999999999999999999866449999999999999999999999999999


Q ss_pred             HHHHHHHHHHHccCHHHHHHHHHHHHHhhhhhhhhhcchhHhHHHHHHHHHhh-hhHHHHHHHHHHHHhCCCccCcHHHH
Q psy9376         156 CLLKVAHHAALLQNYNKAIQIYEEVGRTSLDSSLLKYSAKEYFFRAALCHLCI-DVINAHNAIDRYKTIYPAFQDSREYK  234 (320)
Q Consensus       156 ~~~~la~~~~~~g~y~~Ai~~y~~~~~~~~~~~~~~~~~~~~~~~a~~~~l~~-d~~~~~~A~~~y~~~~~~f~~s~e~~  234 (320)
                      ++.++|.++..+|+|++|+++|++++...+..+...+.++.+++++++|++.. +...+.++++.+.+.++.|+.++++.
T Consensus       160 ~~~~la~~~~~~g~y~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~d~~~A~~~~~~~~~~~~~~~~sre~~  239 (290)
T d1qqea_         160 CFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADSRESN  239 (290)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHTTSSCTTTGGGHHHHHHHHHHHHHHTTCHHHHHHHHHGGGCC---------HH
T ss_pred             HHHHHHHHHHHcChHHHHHHHHHHHHHhCccchhhhhhHHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCccchHHHH
Confidence            99999999999999999999999999988888888888888999999998876 78888999999999999999999999


Q ss_pred             HHHHHHHHHHhcCHhHHHHHHHHHhhhcchhhhHHHHHHHHHHhhcCCCC
Q psy9376         235 LLRILIEHIEEQNVDGFTEAVKDYDSISRLDQWYTTVLLRIKKQVGRTSL  284 (320)
Q Consensus       235 ~l~~l~~a~~~~d~~~~~~Ai~~ye~~~~ld~~~~~~l~~i~~~~~~~~~  284 (320)
                      ++.+++.++..+|.+.+++||..|+++.++|||++.+|.+||+.++.+.+
T Consensus       240 ~l~~l~~a~~~~d~e~~~eai~~y~~~~~lD~~~~~~L~~~k~~le~~e~  289 (290)
T d1qqea_         240 FLKSLIDAVNEGDSEQLSEHCKEFDNFMRLDKWKITILNKIKESIQQQED  289 (290)
T ss_dssp             HHHHHHHHHHTTCTTTHHHHHHHHTTSSCCCHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHhcCHHHHHHHHHHHHHHhhcCHHHHHHHHHHHHhhcccCC
Confidence            99999999999999999999999999999999999999999999886544

PyMOL of d1qqea_

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure