Psyllid ID: psy9445

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLKKN
ccccccccEEEEEEEEEEEEcccccccEEEEEEEEEEEccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHccccEEEEEccccEEEEEcccccccccEEEccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEEEEEEEEccccccccccccccccEEEcc
ccccHHHcEEEEEEEEEEEEcccccccEEEEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHcccHHHHHccccEEEEEcccEEEEEcccccccccEEEEccEEEcccccHHHHHHHHcHHHHHHHcccccEEEEEEccccccHHHHHcEcccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccEEEEccccccccccEEEEcc
mnahssrshtIFTITIHikdnsldgeeLLRTGKlnlvdlagsenigrsgaqdkRAREAGNINQSLLTLGRCITALvektphipyrplnsveraakscsivdcsssreiTIKERVNDkisktfgfdrvfsqeskqvdVYKYVVNPLIDEvlsgynctvfaygqtgtgktftmegeksndpsiswqddplsgivpRAMNHLFDELRLLGDAEFTVRVSFLEIYNEElidllsptdditklrlkkn
mnahssrshtiftitihikdnslDGEELLRTGKLnlvdlagsenigrsgaqdkrareaGNINQSLLTLGRCITALVEKtphipyrplnsveraakscsivdcsssreitikervndkisktfgfdrvfsqeskqvdvYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYneelidllsptdditklrlkkn
MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLKKN
*********TIFTITIHIKDNSLDGEELLRTGKLNLVDLA********************INQSLLTLGRCITALVEKTPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTF*****************PLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPT***********
****SSRSHTIFTITIHIKDNS*****LLRTGKLNLVDLAG****************AGNINQSLLTLGRCITALVEK*******************SIVDCSSSR***************FGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDP**SWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKL**K**
*********TIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGR*********EAGNINQSLLTLGRCITALVEKTPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFT***********SWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLKKN
******RSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAG******************NINQSLLTLGRCITALVEKTPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLKKN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
P46863 1066 Bipolar kinesin KRP-130 O yes N/A 0.650 0.148 0.568 1e-49
Q91783 1067 Kinesin-like protein KIF1 N/A N/A 0.617 0.140 0.564 4e-48
P46874 378 Kinesin-like protein KLP2 N/A N/A 0.633 0.407 0.557 2e-47
P28025 1067 Kinesin-like protein KIF1 N/A N/A 0.617 0.140 0.558 6e-47
B2GU58 1067 Kinesin-like protein KIF1 yes N/A 0.617 0.140 0.558 1e-46
Q6P9P6 1052 Kinesin-like protein KIF1 yes N/A 0.625 0.144 0.538 4e-45
P52732 1056 Kinesin-like protein KIF1 yes N/A 0.625 0.143 0.538 6e-44
P82266 1009 Probable 125 kDa kinesin- no N/A 0.609 0.146 0.434 3e-31
O23826 1006 125 kDa kinesin-related p N/A N/A 0.609 0.147 0.434 5e-31
Q5R4H3 702 Kinesin-like protein KIF3 no N/A 0.613 0.212 0.472 9e-29
>sp|P46863|KL61_DROME Bipolar kinesin KRP-130 OS=Drosophila melanogaster GN=Klp61F PE=1 SV=2 Back     alignment and function desciption
 Score =  196 bits (497), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/160 (56%), Positives = 121/160 (75%), Gaps = 2/160 (1%)

Query: 81  HIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKY 140
           ++  RPLNS ER  +S  +VD    RE+  +  ++ K++K F FDR F  ESKQ DVY  
Sbjct: 23  YVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSV 82

Query: 141 VVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLF 200
           VV+PLI+EVL+GYNCTVFAYGQTGTGKT TM G ++ +   SW+DD   GI+PRA++HLF
Sbjct: 83  VVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLF 142

Query: 201 DELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRL 240
           DELR++ + E+T+R+S+LE+YNEEL DLLS TDD TK+R+
Sbjct: 143 DELRMM-EVEYTMRISYLELYNEELCDLLS-TDDTTKIRI 180
Important role in mitotic dividing cells. Microtubule motor required for spindle body separation. Slow plus-end directed microtubule motor capable of cross-linking and sliding apart antiparallel microtubules, thereby pushing apart the associated spindle poles during spindle assembly and function.
Drosophila melanogaster (taxid: 7227)
>sp|Q91783|KI11A_XENLA Kinesin-like protein KIF11-A OS=Xenopus laevis GN=kif11-a PE=1 SV=1 Back     alignment and function description
>sp|P46874|KLP2_BOMMO Kinesin-like protein KLP2 (Fragment) OS=Bombyx mori PE=2 SV=1 Back     alignment and function description
>sp|P28025|KI11B_XENLA Kinesin-like protein KIF11-B OS=Xenopus laevis GN=kif11-b PE=1 SV=2 Back     alignment and function description
>sp|B2GU58|KIF11_XENTR Kinesin-like protein KIF11 OS=Xenopus tropicalis GN=kif11 PE=2 SV=1 Back     alignment and function description
>sp|Q6P9P6|KIF11_MOUSE Kinesin-like protein KIF11 OS=Mus musculus GN=Kif11 PE=2 SV=1 Back     alignment and function description
>sp|P52732|KIF11_HUMAN Kinesin-like protein KIF11 OS=Homo sapiens GN=KIF11 PE=1 SV=2 Back     alignment and function description
>sp|P82266|K125_ARATH Probable 125 kDa kinesin-related protein OS=Arabidopsis thaliana GN=At2g36200 PE=2 SV=2 Back     alignment and function description
>sp|O23826|K125_TOBAC 125 kDa kinesin-related protein OS=Nicotiana tabacum GN=TKRP125 PE=1 SV=1 Back     alignment and function description
>sp|Q5R4H3|KIF3A_PONAB Kinesin-like protein KIF3A OS=Pongo abelii GN=KIF3A PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
307206939 520 Bipolar kinesin KRP-130 [Harpegnathos sa 0.670 0.313 0.625 6e-57
332020097 992 Bipolar kinesin KRP-130 [Acromyrmex echi 0.670 0.164 0.625 9e-57
350419280 988 PREDICTED: bipolar kinesin KRP-130-like 0.670 0.164 0.589 5e-55
345490722 1103 PREDICTED: kinesin-like protein KIF11 [N 0.650 0.143 0.610 7e-55
322788647 882 hypothetical protein SINV_02777 [Solenop 0.683 0.188 0.590 7e-54
383864893 991 PREDICTED: bipolar kinesin KRP-130-like 0.670 0.164 0.591 1e-53
328791698 987 PREDICTED: bipolar kinesin KRP-130 [Apis 0.670 0.165 0.577 7e-53
380028716 681 PREDICTED: bipolar kinesin KRP-130-like 0.670 0.239 0.571 1e-52
321465396 859 hypothetical protein DAPPUDRAFT_55076 [D 0.641 0.181 0.596 5e-50
383859700 1057 PREDICTED: kinesin-like protein KIF11-li 0.650 0.149 0.566 2e-49
>gi|307206939|gb|EFN84783.1| Bipolar kinesin KRP-130 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  226 bits (576), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 105/168 (62%), Positives = 132/168 (78%), Gaps = 5/168 (2%)

Query: 77  EKTPHIPY----RPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQES 132
           EK  HI      RP+N+ E+  KS S+++  S++E+ ++ER  DK S+ F FD+VF   S
Sbjct: 10  EKNQHIQVFARVRPINNSEKVGKSVSVLELPSNKEVVVRERPLDKHSRKFTFDKVFGPTS 69

Query: 133 KQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIV 192
           KQ+DVY  VVNPL++EVL+GYNCTVFAYGQTGTGKTFTMEG  SNDP++ WQ D  +GI+
Sbjct: 70  KQIDVYNAVVNPLLEEVLAGYNCTVFAYGQTGTGKTFTMEG-VSNDPTLHWQSDTSAGII 128

Query: 193 PRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRL 240
           PRA++HLFDELRLL   EFTVRVSFLE+YNEEL DLLSP+DD +K+RL
Sbjct: 129 PRALSHLFDELRLLEVQEFTVRVSFLELYNEELFDLLSPSDDASKIRL 176

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332020097|gb|EGI60543.1| Bipolar kinesin KRP-130 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350419280|ref|XP_003492129.1| PREDICTED: bipolar kinesin KRP-130-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|345490722|ref|XP_001600745.2| PREDICTED: kinesin-like protein KIF11 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322788647|gb|EFZ14248.1| hypothetical protein SINV_02777 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383864893|ref|XP_003707912.1| PREDICTED: bipolar kinesin KRP-130-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328791698|ref|XP_623508.3| PREDICTED: bipolar kinesin KRP-130 [Apis mellifera] Back     alignment and taxonomy information
>gi|380028716|ref|XP_003698036.1| PREDICTED: bipolar kinesin KRP-130-like [Apis florea] Back     alignment and taxonomy information
>gi|321465396|gb|EFX76397.1| hypothetical protein DAPPUDRAFT_55076 [Daphnia pulex] Back     alignment and taxonomy information
>gi|383859700|ref|XP_003705330.1| PREDICTED: kinesin-like protein KIF11-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
FB|FBgn0004378 1066 Klp61F "Kinesin-like protein a 0.650 0.148 0.568 1.3e-44
UNIPROTKB|Q91783 1067 kif11-a "Kinesin-like protein 0.617 0.140 0.564 1.2e-43
UNIPROTKB|P28025 1067 kif11-b "Kinesin-like protein 0.617 0.140 0.558 1.4e-42
UNIPROTKB|B2GU58 1067 kif11 "Kinesin-like protein KI 0.617 0.140 0.558 3.7e-42
UNIPROTKB|F1NXA1 1067 KIF11 "Uncharacterized protein 0.617 0.140 0.551 9.9e-42
MGI|MGI:1098231 1052 Kif11 "kinesin family member 1 0.637 0.147 0.537 4.2e-41
UNIPROTKB|F1MAB8 1056 Kif11 "Protein Kif11" [Rattus 0.637 0.146 0.537 4.3e-41
UNIPROTKB|P52732 1056 KIF11 "Kinesin-like protein KI 0.637 0.146 0.537 2.4e-40
ZFIN|ZDB-GENE-020426-1 1062 kif11 "kinesin family member 1 0.637 0.145 0.525 2.4e-40
UNIPROTKB|E2QXT6 1052 KIF11 "Uncharacterized protein 0.637 0.147 0.531 3e-40
FB|FBgn0004378 Klp61F "Kinesin-like protein at 61F" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 480 (174.0 bits), Expect = 1.3e-44, P = 1.3e-44
 Identities = 91/160 (56%), Positives = 121/160 (75%)

Query:    81 HIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKY 140
             ++  RPLNS ER  +S  +VD    RE+  +  ++ K++K F FDR F  ESKQ DVY  
Sbjct:    23 YVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSV 82

Query:   141 VVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLF 200
             VV+PLI+EVL+GYNCTVFAYGQTGTGKT TM G ++ +   SW+DD   GI+PRA++HLF
Sbjct:    83 VVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLF 142

Query:   201 DELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRL 240
             DELR++ + E+T+R+S+LE+YNEEL DLLS TDD TK+R+
Sbjct:   143 DELRMM-EVEYTMRISYLELYNEELCDLLS-TDDTTKIRI 180
GO:0005871 "kinesin complex" evidence=ISS;IDA
GO:0003774 "motor activity" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0005873 "plus-end kinesin complex" evidence=ISS;NAS
GO:0003777 "microtubule motor activity" evidence=ISS
GO:0007018 "microtubule-based movement" evidence=ISS
GO:0008574 "plus-end-directed microtubule motor activity" evidence=ISS;NAS
GO:0007100 "mitotic centrosome separation" evidence=IGI;IMP
GO:0007052 "mitotic spindle organization" evidence=IMP;NAS
GO:0005819 "spindle" evidence=IDA;NAS
GO:0007049 "cell cycle" evidence=IMP
GO:0051299 "centrosome separation" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0008017 "microtubule binding" evidence=IEA
GO:0045169 "fusome" evidence=IDA
GO:0009306 "protein secretion" evidence=IMP
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0007030 "Golgi organization" evidence=IMP
GO:0031535 "plus-end directed microtubule sliding" evidence=IDA
GO:0051289 "protein homotetramerization" evidence=IDA
GO:0001578 "microtubule bundle formation" evidence=IDA
GO:0005874 "microtubule" evidence=IDA
GO:0005813 "centrosome" evidence=IDA
GO:0007067 "mitosis" evidence=IMP
GO:0043148 "mitotic spindle stabilization" evidence=IMP
GO:0051298 "centrosome duplication" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q91783 kif11-a "Kinesin-like protein KIF11-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|P28025 kif11-b "Kinesin-like protein KIF11-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|B2GU58 kif11 "Kinesin-like protein KIF11" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXA1 KIF11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1098231 Kif11 "kinesin family member 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAB8 Kif11 "Protein Kif11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P52732 KIF11 "Kinesin-like protein KIF11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020426-1 kif11 "kinesin family member 11" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXT6 KIF11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6P9P6KIF11_MOUSENo assigned EC number0.53840.62550.1444yesN/A
B2GU58KIF11_XENTRNo assigned EC number0.55840.61720.1405yesN/A
P46863KL61_DROMENo assigned EC number0.56870.65020.1482yesN/A
P52732KIF11_HUMANNo assigned EC number0.53840.62550.1439yesN/A
P17120BIMC_EMENINo assigned EC number0.58920.43200.0886yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
cd01364 352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 3e-68
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 2e-56
pfam00225 326 pfam00225, Kinesin, Kinesin motor domain 6e-53
smart00129 335 smart00129, KISc, Kinesin motor, catalytic domain 1e-52
cd00106 328 cd00106, KISc, Kinesin motor domain 2e-47
cd01371 333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 4e-45
cd01369 325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 4e-42
cd01366 329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 2e-41
cd01372 341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 3e-40
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 8e-37
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 1e-36
cd01374 321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 1e-36
cd01370 338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 2e-35
cd00106328 cd00106, KISc, Kinesin motor domain 2e-33
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 2e-32
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 3e-32
cd01375 334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 5e-32
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 1e-30
cd01367 322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 1e-30
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 9e-30
cd01365 356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 2e-29
cd01373 337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 4e-29
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 2e-26
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 2e-25
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 4e-25
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 2e-24
cd01376 319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 2e-23
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 6e-23
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 2e-22
cd01368 345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 2e-22
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 4e-22
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 5e-21
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 5e-20
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 5e-18
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 7e-18
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 8e-18
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 9e-18
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 4e-13
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information 
 Score =  213 bits (545), Expect = 3e-68
 Identities = 81/157 (51%), Positives = 113/157 (71%), Gaps = 3/157 (1%)

Query: 85  RPLNSVERAAKSCSIVDCS-SSREITIKERVNDKIS-KTFGFDRVFSQESKQVDVYKYVV 142
           RP NS ER  KS  +V+ S SS+EI +     DK S KT+ FD+VF  E+ Q++VY  VV
Sbjct: 11  RPRNSRERKEKSSVVVEVSGSSKEIIVSTGGADKQSTKTYTFDKVFGPEADQIEVYSQVV 70

Query: 143 NPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDE 202
           +P++DEVL GYNCT+FAYGQTGTGKT+TMEG+++++   +W+  P +GI+PRA+  LF++
Sbjct: 71  SPILDEVLMGYNCTIFAYGQTGTGKTYTMEGDRTDNKGSTWELSPHAGIIPRALYQLFEK 130

Query: 203 LRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLR 239
           L      E++V+VS+LE+YNEEL DLLS   D+ K  
Sbjct: 131 LESQN-TEYSVKVSYLELYNEELFDLLSSESDLNKPL 166

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 352
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
KOG0243|consensus 1041 100.0
cd01370 338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
cd01368 345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
KOG0245|consensus 1221 100.0
cd01373 337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
KOG4280|consensus 574 100.0
cd01365 356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
KOG0242|consensus 675 100.0
cd01367 322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
cd01364 352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
cd01374 321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01376 319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01371 333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
cd01369 325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
KOG0241|consensus 1714 100.0
KOG0240|consensus 607 100.0
cd01375 334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd01372 341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
KOG0239|consensus 670 100.0
PF00225 335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
cd00106 328 KISc Kinesin motor domain. This catalytic (head) d 100.0
cd01366 329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
smart00129 335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
KOG0246|consensus 676 99.96
KOG0243|consensus 1041 99.94
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 99.93
KOG0247|consensus 809 99.92
KOG0244|consensus 913 99.92
KOG4280|consensus 574 99.91
KOG0240|consensus 607 99.89
KOG0245|consensus 1221 99.86
KOG0247|consensus 809 99.85
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 99.84
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 99.84
KOG0239|consensus670 99.83
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 99.83
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 99.82
PLN03188 1320 kinesin-12 family protein; Provisional 99.82
KOG0242|consensus 675 99.82
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 99.8
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 99.79
KOG0246|consensus676 99.78
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 99.78
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 99.77
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 99.77
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 99.76
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 99.76
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 99.75
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 99.75
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 99.73
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 99.73
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 99.7
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 99.66
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 99.66
KOG0241|consensus 1714 99.65
KOG0244|consensus 913 99.65
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 99.55
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 95.54
COG2805 353 PilT Tfp pilus assembly protein, pilus retraction 94.34
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 93.56
PRK06893 229 DNA replication initiation factor; Validated 92.39
COG2804 500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 91.69
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 89.77
PRK00411 394 cdc6 cell division control protein 6; Reviewed 88.83
PRK06526254 transposase; Provisional 88.67
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 88.3
PRK12377248 putative replication protein; Provisional 88.21
PRK09087226 hypothetical protein; Validated 88.1
PRK14086 617 dnaA chromosomal replication initiation protein; P 87.92
PRK05642234 DNA replication initiation factor; Validated 87.63
PRK08116268 hypothetical protein; Validated 87.56
PF1324576 AAA_19: Part of AAA domain 87.54
PF01935 229 DUF87: Domain of unknown function DUF87; InterPro: 87.06
PRK00149 450 dnaA chromosomal replication initiation protein; R 86.94
PRK14088 440 dnaA chromosomal replication initiation protein; P 86.93
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 86.75
COG5008 375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 86.66
PRK08084 235 DNA replication initiation factor; Provisional 86.58
PRK10436 462 hypothetical protein; Provisional 86.44
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 86.43
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 86.17
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 86.1
PF04851184 ResIII: Type III restriction enzyme, res subunit; 86.07
TIGR02538 564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 85.54
PRK08181269 transposase; Validated 85.32
TIGR02533 486 type_II_gspE general secretory pathway protein E. 85.22
PRK06620214 hypothetical protein; Validated 85.07
PRK07952244 DNA replication protein DnaC; Validated 84.85
KOG0989|consensus 346 84.8
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 84.8
smart00382148 AAA ATPases associated with a variety of cellular 84.77
PF12846 304 AAA_10: AAA-like domain 84.69
PRK08727 233 hypothetical protein; Validated 84.45
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 84.41
TIGR02524 358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 84.11
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 83.79
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 83.29
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 83.28
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 82.84
PF13479 213 AAA_24: AAA domain 82.61
PRK09183259 transposase/IS protein; Provisional 82.29
COG1484254 DnaC DNA replication protein [DNA replication, rec 82.23
TIGR02525 372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 82.21
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 81.99
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 81.62
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 81.5
PRK08939306 primosomal protein DnaI; Reviewed 81.32
PF00448 196 SRP54: SRP54-type protein, GTPase domain; InterPro 81.24
PRK06835329 DNA replication protein DnaC; Validated 81.22
PF00004132 AAA: ATPase family associated with various cellula 81.1
PF05970 364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 80.01
>KOG0243|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.7e-40  Score=317.50  Aligned_cols=160  Identities=49%  Similarity=0.867  Sum_probs=140.6

Q ss_pred             CCcccCCCcchhhcccceeeeecCC-ceEEEEecCCCC-CcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEE
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSS-SREITIKERVND-KISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTV  157 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~-~~ti~v~~~~~~-~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i  157 (243)
                      +.||+||++.+|...++..+|.+++ ++.|.+...... ...|+|+||+||+|.+.|.++|+.++.|+|+.++.||||||
T Consensus        53 VivRcRp~n~~E~~~~s~~VVs~~~~~kEV~v~~~~~sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~p~i~eVl~GyNCTI  132 (1041)
T KOG0243|consen   53 VIVRCRPRNDRERKSKSSVVVSCDGIRKEVAVRQTIASKQIDKTFTFDKVFGPESQQEDLYDQAVSPIIKEVLEGYNCTI  132 (1041)
T ss_pred             EEEEeCCCCchhhhcCCCeEEecCCCcceEEEecccccccccceeecceeeCcchhHHHHHHHHHHHHHHHHhccCCceE
Confidence            5689999999999889999999998 566888766332 36889999999999999999999999999999999999999


Q ss_pred             EEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCCCC-c
Q psy9445         158 FAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDI-T  236 (243)
Q Consensus       158 ~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~~~-~  236 (243)
                      |||||||+||||||.|.....   .|..++.+|||||++.+||..++... ..|.|+|||+|+|||.++|||+|+... .
T Consensus       133 FAYGQTGTGKTyTMeG~~~~~---~g~l~~~aGIIPRal~~IFd~Le~~~-~EYsvKVSfLELYNEEl~DLLa~~~~~~~  208 (1041)
T KOG0243|consen  133 FAYGQTGTGKTYTMEGGERKK---NGELPSEAGIIPRALRQIFDTLEAQG-AEYSVKVSFLELYNEELTDLLASEDTSDK  208 (1041)
T ss_pred             EEecCCCCCceeeeecCcccc---cCCCCccCCcchHHHHHHHHHHHhcC-CeEEEEEEehhhhhHHHHHhcCCcccccc
Confidence            999999999999999975422   36677889999999999999999744 789999999999999999999998765 6


Q ss_pred             cceecCC
Q psy9445         237 KLRLKKN  243 (243)
Q Consensus       237 ~l~i~e~  243 (243)
                      .+++++|
T Consensus       209 ~~~~k~~  215 (1041)
T KOG0243|consen  209 KLRIKDD  215 (1041)
T ss_pred             ccccccC
Confidence            7777654

>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>KOG4280|consensus Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>KOG4280|consensus Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2wbe_C 373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 7e-50
3hqd_A 369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 8e-45
4ap0_A 370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 9e-45
1ii6_A 368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 9e-45
1q0b_A 367 Crystal Structure Of The Motor Protein Ksp In Compl 9e-45
1x88_A 359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 1e-44
3zcw_A 348 Eg5 - New Allosteric Binding Site Length = 348 1e-44
4a28_A 368 Eg5-2 Length = 368 2e-44
4a1z_A 368 Eg5-1 Length = 368 9e-44
4aqv_C 373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 1e-42
3b6v_A 395 Crystal Structure Of The Motor Domain Of Human Kine 7e-29
3b6u_A 372 Crystal Structure Of The Motor Domain Of Human Kine 4e-27
1goj_A 355 Structure Of A Fast Kinesin: Implications For Atpas 3e-26
1t5c_A 349 Crystal Structure Of The Motor Domain Of Human Kine 2e-24
2ncd_A 420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 2e-21
3u06_A 412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 2e-21
1n6m_A 409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 2e-21
1cz7_A 406 The Crystal Structure Of A Minus-End Directed Micro 2e-21
3l1c_A 383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 4e-21
2vvg_A 350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 1e-20
2y5w_A 365 Crystal Structure Of Drosophila Melanogaster Kinesi 7e-20
2rep_A 376 Crystal Structure Of The Motor Domain Of Human Kine 2e-19
4etp_A 403 C-Terminal Motor And Motor Homology Domain Of Kar3v 1e-18
4a14_A 344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 1e-18
2xt3_A 344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 1e-18
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 1e-18
1f9v_A 347 Crystal Structures Of Mutants Reveal A Signalling P 3e-18
1f9w_A 347 Crystal Structures Of Mutants Reveal A Signalling P 3e-18
1mkj_A 349 Human Kinesin Motor Domain With Docked Neck Linker 3e-18
1f9u_A 347 Crystal Structures Of Mutants Reveal A Signalling P 3e-18
3kar_A 346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 3e-18
1bg2_A 325 Human Ubiquitous Kinesin Motor Domain Length = 325 3e-18
1f9t_A 358 Crystal Structures Of Kinesin Mutants Reveal A Sign 3e-18
3h4s_A 386 Structure Of The Complex Of A Mitotic Kinesin With 8e-18
4atx_C 340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 1e-17
1sdm_A 369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 3e-17
4gkr_A 371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 3e-17
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 4e-17
2h58_A 330 Crystal Structure Of The Kifc3 Motor Domain In Comp 9e-17
4h1g_A 715 Structure Of Candida Albicans Kar3 Motor Domain Fus 7e-17
3nwn_A 359 Crystal Structure Of The Human Kif9 Motor Domain In 9e-17
1vfv_A 366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-16
1i6i_A 366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-16
1ia0_K 394 Kif1a Head-Microtubule Complex Structure In Atp-For 3e-16
3lre_A 355 Crystal Structure Analysis Of Human Kinesin-8 Motor 4e-16
1i5s_A 367 Crystal Structure Of The Kif1a Motor Domain Complex 4e-16
3dc4_A 344 Crystal Structure Of The Drosophila Kinesin Family 1e-15
3pxn_A 344 Crystal Structure Of The Drosophila Kinesin Family 1e-15
3gbj_A 354 Crystal Structure Of The Motor Domain Of Kinesin Ki 5e-15
3bfn_A 388 Crystal Structure Of The Motor Domain Of Human Kine 1e-14
2owm_A 443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 1e-13
2heh_A 387 Crystal Structure Of The Kif2c Motor Domain (Casp T 3e-13
3edl_D 331 Kinesin13-Microtubule Ring Complex Length = 331 2e-12
1v8j_A 410 The Crystal Structure Of The Minimal Functional Dom 2e-12
2gry_A 420 Crystal Structure Of The Human Kif2 Motor Domain In 4e-12
3t0q_A 349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 1e-11
1ry6_A 360 Crystal Structure Of Internal Kinesin Motor Domain 2e-11
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure 
Iteration: 1

 Score =  193 bits (491), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 91/160 (56%), Positives = 121/160 (75%), Gaps = 2/160 (1%)
Query: 81  HIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKY 140
           ++  RPLNS ER  +S  +VD    RE+  +  ++ K++K F FDR F  ESKQ DVY  
Sbjct: 28  YVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSV 87
Query: 141 VVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLF 200
           VV+PLI+EVL+GYNCTVFAYGQTGTGKT TM G ++ +   SW+DD   GI+PRA++HLF
Sbjct: 88  VVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLF 147
Query: 201 DELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRL 240
           DELR++ + E+T+R+S+LE+YNEEL DLLS TDD TK+R+
Sbjct: 148 DELRMM-EVEYTMRISYLELYNEELCDLLS-TDDTTKIRI 185
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
2wbe_C 373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 4e-71
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 4e-51
1x88_A 359 Kinesin-like protein KIF11; switch II, motor domai 7e-67
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 5e-54
4a14_A 344 Kinesin, kinesin-like protein KIF7; motor protein, 3e-63
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 9e-46
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 4e-62
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 4e-49
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 3e-60
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 1e-44
1bg2_A 325 Kinesin; motor protein, ATPase, microtubule associ 1e-59
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 7e-45
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 1e-59
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 7e-46
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 1e-59
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 1e-42
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 3e-58
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 6e-40
2heh_A 387 KIF2C protein; kinesin, motor domain, ADP, structu 2e-57
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 2e-39
3dc4_A 344 Kinesin-like protein NOD; catalytic domain, ATPase 3e-57
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 6e-44
1v8k_A 410 Kinesin-like protein KIF2C; microtubule destabiliz 6e-57
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 9e-39
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 7e-57
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 2e-40
2h58_A 330 Kinesin-like protein KIFC3 variant; motor domain, 7e-57
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 7e-43
2vvg_A 350 Kinesin-2; motor protein, nucleotide-binding, micr 1e-56
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 8e-48
2nr8_A 358 Kinesin-like protein KIF9; motor domain, ADP, stru 1e-56
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 1e-43
3u06_A 412 Protein claret segregational; motor domain, stalk 6e-55
3u06_A412 Protein claret segregational; motor domain, stalk 5e-37
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 1e-54
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 3e-41
2rep_A 376 Kinesin-like protein KIFC1; structural genomics co 6e-54
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 6e-41
3lre_A 355 Kinesin-like protein KIF18A; motor protein, nucleo 2e-51
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 5e-42
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 2e-51
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 3e-36
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 2e-50
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 7e-37
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 5e-50
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 8e-37
3gbj_A 354 KIF13B protein; kinesin, motor domain, ADP, struct 5e-50
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 4e-37
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 2e-49
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 2e-34
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 2e-46
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 4e-34
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 3e-09
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
 Score =  220 bits (564), Expect = 4e-71
 Identities = 90/157 (57%), Positives = 118/157 (75%), Gaps = 2/157 (1%)

Query: 85  RPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNP 144
           RPLNS ER  +S  +VD    RE+  +  ++ K++K F FDR F  ESKQ DVY  VV+P
Sbjct: 32  RPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSP 91

Query: 145 LIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELR 204
           LI+EVL+GYNCTVFAYGQTGTGKT TM G ++ +   SW+DD   GI+PRA++HLFDELR
Sbjct: 92  LIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLFDELR 151

Query: 205 LLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLK 241
           ++ + E+T+R+S+LE+YNEEL DLLS  DD TK+R+ 
Sbjct: 152 MM-EVEYTMRISYLELYNEELCDLLST-DDTTKIRIF 186
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
2wbe_C 373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 100.0
1x88_A 359 Kinesin-like protein KIF11; switch II, motor domai 100.0
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 100.0
1bg2_A 325 Kinesin; motor protein, ATPase, microtubule associ 100.0
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
3lre_A 355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
2vvg_A 350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
4a14_A 344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
3gbj_A 354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
2heh_A 387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 100.0
1v8k_A 410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
2h58_A 330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
3u06_A 412 Protein claret segregational; motor domain, stalk 100.0
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
3nwn_A 359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 100.0
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 100.0
2rep_A 376 Kinesin-like protein KIFC1; structural genomics co 100.0
3dc4_A 344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
2nr8_A 358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
4h1g_A 715 Maltose binding protein-cakar3 motor domain fusio; 99.98
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 99.91
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 99.9
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 99.9
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 99.9
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 99.9
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 99.9
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 99.9
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 99.9
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 99.9
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 99.9
2o0a_A 298 S.cerevisiae chromosome XVI reading frame ORF YPL2 99.89
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 99.89
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 99.89
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 99.89
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 99.89
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 99.89
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 99.89
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 99.89
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 99.89
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 99.88
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 99.88
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 99.88
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 99.88
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 99.88
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 99.87
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 99.86
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 99.86
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 99.85
3u06_A412 Protein claret segregational; motor domain, stalk 99.85
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 98.13
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 97.24
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.27
4etp_B 333 Spindle POLE BODY-associated protein VIK1; kinesin 93.08
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 90.82
2qgz_A308 Helicase loader, putative primosome component; str 89.91
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 88.89
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 87.29
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 87.21
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 86.8
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 86.75
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 82.57
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 82.01
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 82.01
3bos_A 242 Putative DNA replication factor; P-loop containing 81.98
2kjq_A149 DNAA-related protein; solution structure, NESG, st 81.84
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 81.12
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 80.96
2chg_A226 Replication factor C small subunit; DNA-binding pr 80.76
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 80.74
1p9r_A 418 General secretion pathway protein E; bacterial typ 80.32
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 80.19
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=8.4e-41  Score=300.21  Aligned_cols=163  Identities=55%  Similarity=0.916  Sum_probs=138.1

Q ss_pred             CCCcccCCCcchhhcccceeeeecCCceEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEE
Q psy9445          79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVF  158 (243)
Q Consensus        79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~  158 (243)
                      +..+|+||++..|...+...++.+.++.++.+.++......+.|+||+||++.++|++||+.++.|+|+.+++|||+|||
T Consensus        26 ~V~vRvRP~~~~E~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~F~FD~vf~~~~~Q~~Vy~~~~~plv~~~l~G~n~tif  105 (373)
T 2wbe_C           26 QVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVF  105 (373)
T ss_dssp             EEEEEECCCCHHHHHHTCCBCEEEETTTEEEESSSSSSTTCEEEECSEEECTTCCHHHHHHHHHHHHHHHHHHTCCEEEE
T ss_pred             EEEEEcCCCChhhhccCCCceEEEcCCCeEEEecCCCCCCceEEeccEEeccccchhHHHHHHHHHHHHHHhCCceEEEE
Confidence            36789999999998777777777777777777766555567899999999999999999999999999999999999999


Q ss_pred             EeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCCCCccc
Q psy9445         159 AYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKL  238 (243)
Q Consensus       159 ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~~~~~l  238 (243)
                      |||||||||||||+|....+....+.....+|||||++++||+.++. .+..|.|++||+|||||+|+|||++.. ..++
T Consensus       106 AYGqTGSGKTyTm~G~~~~~~~~~~~~~~~~Giipr~~~~lF~~i~~-~~~~~~v~vS~~EIYnE~i~DLL~~~~-~~~l  183 (373)
T 2wbe_C          106 AYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLFDELRM-MEVEYTMRISYLELYNEELCDLLSTDD-TTKI  183 (373)
T ss_dssp             EECSTTSSHHHHHTBSCSCCSSSCSSCTTTBCHHHHHHHHHHHHHHH-CCSCEEEEEEEEEEETTEEEESSCTTS-CSCC
T ss_pred             eecCCCCCcceecccCccccccccccccCCCcChHHHHHHHHHHHHh-cCceEEEEEEEEEEeCCeEEECCCCCC-CCCc
Confidence            99999999999999986544333444556789999999999999986 456899999999999999999999753 3556


Q ss_pred             eecCC
Q psy9445         239 RLKKN  243 (243)
Q Consensus       239 ~i~e~  243 (243)
                      +++||
T Consensus       184 ~i~~~  188 (373)
T 2wbe_C          184 RIFDD  188 (373)
T ss_dssp             CEEEC
T ss_pred             eeEec
Confidence            66654
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d1x88a1 345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 2e-33
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 1e-18
d1bg2a_ 323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 4e-29
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 3e-17
d1goja_ 354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 2e-27
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 2e-12
d1ry6a_ 330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 2e-27
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 3e-16
d2zfia1 349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 1e-24
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 7e-14
d1v8ka_ 362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 4e-24
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 4e-15
d1sdma_ 364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 1e-20
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 1e-10
d2ncda_ 368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 9e-20
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 1e-15
d1f9va_ 342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 5e-19
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 5e-15
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]

 Score =  121 bits (304), Expect = 2e-33
 Identities = 80/156 (51%), Positives = 112/156 (71%), Gaps = 4/156 (2%)

Query: 85  RPLNSVERAAKSCSIVDCSSSR-EITIK--ERVNDKISKTFGFDRVFSQESKQVDVYKYV 141
           RP N  ER A + SIV+C   R E++++     +    KT+ FD VF   +KQ+DVY+ V
Sbjct: 9   RPFNLAERKASAHSIVECDPVRKEVSVRTGGLADKSSRKTYTFDMVFGASTKQIDVYRSV 68

Query: 142 VNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFD 201
           V P++DEV+ GYNCT+FAYGQTGTGKTFTMEGE+S +   +W++DPL+GI+PR ++ +F 
Sbjct: 69  VCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEEYTWEEDPLAGIIPRTLHQIF- 127

Query: 202 ELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITK 237
           E       EF+V+VS LEIYNEEL DLL+P+ D+++
Sbjct: 128 EKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE 163
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d2zfia1 349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1sdma_ 364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1v8ka_ 362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1ry6a_ 330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d1x88a1 345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d2ncda_ 368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1f9va_ 342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 99.8
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 99.8
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 99.78
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 99.75
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 99.75
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 99.74
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 99.74
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 99.73
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 99.7
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 93.59
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 92.37
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.34
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 89.77
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 89.41
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 88.68
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 85.94
d1okkd2 207 GTPase domain of the signal recognition particle r 85.58
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 85.08
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.98
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 83.81
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 81.98
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 81.81
d1j8yf2 211 GTPase domain of the signal sequence recognition p 81.67
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 81.55
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 80.49
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 80.33
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 80.08
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif1a [TaxId: 10090]

Probab=100.00  E-value=2.3e-37  Score=274.57  Aligned_cols=153  Identities=32%  Similarity=0.612  Sum_probs=128.7

Q ss_pred             CCcccCCCcchhhcccceeeeecCCceEEEEecCCCCCcceEEecceeecCC--------CcchhhhccccchhHHHHhc
Q psy9445          80 PHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQE--------SKQVDVYKYVVNPLIDEVLS  151 (243)
Q Consensus        80 ~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~~~~~~f~fD~vF~~~--------a~q~ev~~~~~~~~v~~~~~  151 (243)
                      +.+|+||+...|...+..+++.+.+...+.+.+......+++|.||+||++.        ++|++||+.++.|+|+.+++
T Consensus         5 V~vRvRP~~~~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~f~FD~vf~~~~~~~~~~~~sQ~~vy~~~~~plv~~~l~   84 (349)
T d2zfia1           5 VAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFE   84 (349)
T ss_dssp             EEEEECCCCHHHHHTTCCBCEEEETTEEEECCTTCTTSCCEEEECSEEEECSSCTTSSSCCCHHHHHHHTHHHHHHHHHT
T ss_pred             EEEEeCCCChhHhcCCCcEEEEECCCcEEEECCCCCCcCCeeEEeceEeCCCCCccccccccHHHHHHHhhHHHHHHHHh
Confidence            5689999999998777777887777776666655555677899999999886        57999999999999999999


Q ss_pred             CCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhc--CCceEEEEEEEEEEECCeEEeCC
Q psy9445         152 GYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLL--GDAEFTVRVSFLEIYNEELIDLL  229 (243)
Q Consensus       152 G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~--~~~~~~v~~S~~eiyne~v~DLL  229 (243)
                      |+|+||||||||||||||||+|++..         ..+|||||++++||+.++..  ....+.|.+||+|||||+|+|||
T Consensus        85 G~n~ti~aYGqTgSGKT~Tm~G~~~~---------~~~Glipr~l~~lf~~~~~~~~~~~~~~v~~S~~Eiyne~i~DLL  155 (349)
T d2zfia1          85 GYNVCIFAYGQTGAGKSYTMMGKQEK---------DQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLL  155 (349)
T ss_dssp             TCCEEEEEECSTTSSHHHHHTBCSGG---------GCBCHHHHHHHHHHHHHHTCCCTTEEEEEEEEEEEEETTEEEETT
T ss_pred             ccCceeeeeccCCCCCceeeccCccc---------cccCchHHHHhhhhhhccccccCCcceEEEEEeeeeeCCEEEecc
Confidence            99999999999999999999997431         23599999999999999863  45679999999999999999999


Q ss_pred             CCCCCCccceecC
Q psy9445         230 SPTDDITKLRLKK  242 (243)
Q Consensus       230 ~~~~~~~~l~i~e  242 (243)
                      +|... ..++++|
T Consensus       156 ~~~~~-~~~~i~~  167 (349)
T d2zfia1         156 NPKNK-GNLRVRE  167 (349)
T ss_dssp             CTTTC-SCBCEEE
T ss_pred             ccccc-CCceEEe
Confidence            98543 4455554
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure