Psyllid ID: psy9445
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 243 | ||||||
| 307206939 | 520 | Bipolar kinesin KRP-130 [Harpegnathos sa | 0.670 | 0.313 | 0.625 | 6e-57 | |
| 332020097 | 992 | Bipolar kinesin KRP-130 [Acromyrmex echi | 0.670 | 0.164 | 0.625 | 9e-57 | |
| 350419280 | 988 | PREDICTED: bipolar kinesin KRP-130-like | 0.670 | 0.164 | 0.589 | 5e-55 | |
| 345490722 | 1103 | PREDICTED: kinesin-like protein KIF11 [N | 0.650 | 0.143 | 0.610 | 7e-55 | |
| 322788647 | 882 | hypothetical protein SINV_02777 [Solenop | 0.683 | 0.188 | 0.590 | 7e-54 | |
| 383864893 | 991 | PREDICTED: bipolar kinesin KRP-130-like | 0.670 | 0.164 | 0.591 | 1e-53 | |
| 328791698 | 987 | PREDICTED: bipolar kinesin KRP-130 [Apis | 0.670 | 0.165 | 0.577 | 7e-53 | |
| 380028716 | 681 | PREDICTED: bipolar kinesin KRP-130-like | 0.670 | 0.239 | 0.571 | 1e-52 | |
| 321465396 | 859 | hypothetical protein DAPPUDRAFT_55076 [D | 0.641 | 0.181 | 0.596 | 5e-50 | |
| 383859700 | 1057 | PREDICTED: kinesin-like protein KIF11-li | 0.650 | 0.149 | 0.566 | 2e-49 |
| >gi|307206939|gb|EFN84783.1| Bipolar kinesin KRP-130 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 226 bits (576), Expect = 6e-57, Method: Compositional matrix adjust.
Identities = 105/168 (62%), Positives = 132/168 (78%), Gaps = 5/168 (2%)
Query: 77 EKTPHIPY----RPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQES 132
EK HI RP+N+ E+ KS S+++ S++E+ ++ER DK S+ F FD+VF S
Sbjct: 10 EKNQHIQVFARVRPINNSEKVGKSVSVLELPSNKEVVVRERPLDKHSRKFTFDKVFGPTS 69
Query: 133 KQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIV 192
KQ+DVY VVNPL++EVL+GYNCTVFAYGQTGTGKTFTMEG SNDP++ WQ D +GI+
Sbjct: 70 KQIDVYNAVVNPLLEEVLAGYNCTVFAYGQTGTGKTFTMEG-VSNDPTLHWQSDTSAGII 128
Query: 193 PRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRL 240
PRA++HLFDELRLL EFTVRVSFLE+YNEEL DLLSP+DD +K+RL
Sbjct: 129 PRALSHLFDELRLLEVQEFTVRVSFLELYNEELFDLLSPSDDASKIRL 176
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332020097|gb|EGI60543.1| Bipolar kinesin KRP-130 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|350419280|ref|XP_003492129.1| PREDICTED: bipolar kinesin KRP-130-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|345490722|ref|XP_001600745.2| PREDICTED: kinesin-like protein KIF11 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|322788647|gb|EFZ14248.1| hypothetical protein SINV_02777 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383864893|ref|XP_003707912.1| PREDICTED: bipolar kinesin KRP-130-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328791698|ref|XP_623508.3| PREDICTED: bipolar kinesin KRP-130 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380028716|ref|XP_003698036.1| PREDICTED: bipolar kinesin KRP-130-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|321465396|gb|EFX76397.1| hypothetical protein DAPPUDRAFT_55076 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|383859700|ref|XP_003705330.1| PREDICTED: kinesin-like protein KIF11-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 243 | ||||||
| FB|FBgn0004378 | 1066 | Klp61F "Kinesin-like protein a | 0.650 | 0.148 | 0.568 | 1.3e-44 | |
| UNIPROTKB|Q91783 | 1067 | kif11-a "Kinesin-like protein | 0.617 | 0.140 | 0.564 | 1.2e-43 | |
| UNIPROTKB|P28025 | 1067 | kif11-b "Kinesin-like protein | 0.617 | 0.140 | 0.558 | 1.4e-42 | |
| UNIPROTKB|B2GU58 | 1067 | kif11 "Kinesin-like protein KI | 0.617 | 0.140 | 0.558 | 3.7e-42 | |
| UNIPROTKB|F1NXA1 | 1067 | KIF11 "Uncharacterized protein | 0.617 | 0.140 | 0.551 | 9.9e-42 | |
| MGI|MGI:1098231 | 1052 | Kif11 "kinesin family member 1 | 0.637 | 0.147 | 0.537 | 4.2e-41 | |
| UNIPROTKB|F1MAB8 | 1056 | Kif11 "Protein Kif11" [Rattus | 0.637 | 0.146 | 0.537 | 4.3e-41 | |
| UNIPROTKB|P52732 | 1056 | KIF11 "Kinesin-like protein KI | 0.637 | 0.146 | 0.537 | 2.4e-40 | |
| ZFIN|ZDB-GENE-020426-1 | 1062 | kif11 "kinesin family member 1 | 0.637 | 0.145 | 0.525 | 2.4e-40 | |
| UNIPROTKB|E2QXT6 | 1052 | KIF11 "Uncharacterized protein | 0.637 | 0.147 | 0.531 | 3e-40 |
| FB|FBgn0004378 Klp61F "Kinesin-like protein at 61F" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 480 (174.0 bits), Expect = 1.3e-44, P = 1.3e-44
Identities = 91/160 (56%), Positives = 121/160 (75%)
Query: 81 HIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKY 140
++ RPLNS ER +S +VD RE+ + ++ K++K F FDR F ESKQ DVY
Sbjct: 23 YVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSV 82
Query: 141 VVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLF 200
VV+PLI+EVL+GYNCTVFAYGQTGTGKT TM G ++ + SW+DD GI+PRA++HLF
Sbjct: 83 VVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLF 142
Query: 201 DELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRL 240
DELR++ + E+T+R+S+LE+YNEEL DLLS TDD TK+R+
Sbjct: 143 DELRMM-EVEYTMRISYLELYNEELCDLLS-TDDTTKIRI 180
|
|
| UNIPROTKB|Q91783 kif11-a "Kinesin-like protein KIF11-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P28025 kif11-b "Kinesin-like protein KIF11-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B2GU58 kif11 "Kinesin-like protein KIF11" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NXA1 KIF11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1098231 Kif11 "kinesin family member 11" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MAB8 Kif11 "Protein Kif11" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P52732 KIF11 "Kinesin-like protein KIF11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-020426-1 kif11 "kinesin family member 11" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QXT6 KIF11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 243 | |||
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 3e-68 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 2e-56 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 6e-53 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 1e-52 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 2e-47 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 4e-45 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 4e-42 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 2e-41 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 3e-40 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 8e-37 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 1e-36 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 1e-36 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 2e-35 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 2e-33 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 2e-32 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 3e-32 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 5e-32 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 1e-30 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 1e-30 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 9e-30 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 2e-29 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 4e-29 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 2e-26 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 2e-25 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 4e-25 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 2e-24 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 2e-23 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 6e-23 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 2e-22 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 2e-22 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 4e-22 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 5e-21 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 5e-20 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 5e-18 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 7e-18 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 8e-18 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 9e-18 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 4e-13 |
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
Score = 213 bits (545), Expect = 3e-68
Identities = 81/157 (51%), Positives = 113/157 (71%), Gaps = 3/157 (1%)
Query: 85 RPLNSVERAAKSCSIVDCS-SSREITIKERVNDKIS-KTFGFDRVFSQESKQVDVYKYVV 142
RP NS ER KS +V+ S SS+EI + DK S KT+ FD+VF E+ Q++VY VV
Sbjct: 11 RPRNSRERKEKSSVVVEVSGSSKEIIVSTGGADKQSTKTYTFDKVFGPEADQIEVYSQVV 70
Query: 143 NPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDE 202
+P++DEVL GYNCT+FAYGQTGTGKT+TMEG+++++ +W+ P +GI+PRA+ LF++
Sbjct: 71 SPILDEVLMGYNCTIFAYGQTGTGKTYTMEGDRTDNKGSTWELSPHAGIIPRALYQLFEK 130
Query: 203 LRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLR 239
L E++V+VS+LE+YNEEL DLLS D+ K
Sbjct: 131 LESQN-TEYSVKVSYLELYNEELFDLLSSESDLNKPL 166
|
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 352 |
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 243 | |||
| KOG0243|consensus | 1041 | 100.0 | ||
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| KOG0245|consensus | 1221 | 100.0 | ||
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| KOG4280|consensus | 574 | 100.0 | ||
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| KOG0242|consensus | 675 | 100.0 | ||
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| KOG0241|consensus | 1714 | 100.0 | ||
| KOG0240|consensus | 607 | 100.0 | ||
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| KOG0239|consensus | 670 | 100.0 | ||
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| KOG0246|consensus | 676 | 99.96 | ||
| KOG0243|consensus | 1041 | 99.94 | ||
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 99.93 | |
| KOG0247|consensus | 809 | 99.92 | ||
| KOG0244|consensus | 913 | 99.92 | ||
| KOG4280|consensus | 574 | 99.91 | ||
| KOG0240|consensus | 607 | 99.89 | ||
| KOG0245|consensus | 1221 | 99.86 | ||
| KOG0247|consensus | 809 | 99.85 | ||
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 99.84 | |
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 99.84 | |
| KOG0239|consensus | 670 | 99.83 | ||
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 99.83 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 99.82 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 99.82 | |
| KOG0242|consensus | 675 | 99.82 | ||
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 99.8 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 99.79 | |
| KOG0246|consensus | 676 | 99.78 | ||
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 99.78 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 99.77 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 99.77 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 99.76 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 99.76 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 99.75 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 99.75 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 99.73 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 99.73 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 99.7 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 99.66 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 99.66 | |
| KOG0241|consensus | 1714 | 99.65 | ||
| KOG0244|consensus | 913 | 99.65 | ||
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 99.55 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 95.54 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 94.34 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 93.56 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 92.39 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 91.69 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 89.77 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 88.83 | |
| PRK06526 | 254 | transposase; Provisional | 88.67 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 88.3 | |
| PRK12377 | 248 | putative replication protein; Provisional | 88.21 | |
| PRK09087 | 226 | hypothetical protein; Validated | 88.1 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 87.92 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 87.63 | |
| PRK08116 | 268 | hypothetical protein; Validated | 87.56 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 87.54 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 87.06 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 86.94 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 86.93 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 86.75 | |
| COG5008 | 375 | PilU Tfp pilus assembly protein, ATPase PilU [Cell | 86.66 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 86.58 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 86.44 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 86.43 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 86.17 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 86.1 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 86.07 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 85.54 | |
| PRK08181 | 269 | transposase; Validated | 85.32 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 85.22 | |
| PRK06620 | 214 | hypothetical protein; Validated | 85.07 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 84.85 | |
| KOG0989|consensus | 346 | 84.8 | ||
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 84.8 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 84.77 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 84.69 | |
| PRK08727 | 233 | hypothetical protein; Validated | 84.45 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 84.41 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 84.11 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 83.79 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 83.29 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 83.28 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 82.84 | |
| PF13479 | 213 | AAA_24: AAA domain | 82.61 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 82.29 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 82.23 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 82.21 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 81.99 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 81.62 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 81.5 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 81.32 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 81.24 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 81.22 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 81.1 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 80.01 |
| >KOG0243|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-40 Score=317.50 Aligned_cols=160 Identities=49% Similarity=0.867 Sum_probs=140.6
Q ss_pred CCcccCCCcchhhcccceeeeecCC-ceEEEEecCCCC-CcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEE
Q psy9445 80 PHIPYRPLNSVERAAKSCSIVDCSS-SREITIKERVND-KISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTV 157 (243)
Q Consensus 80 ~~~~~~~~~~~E~~~~s~~iv~~~~-~~ti~v~~~~~~-~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i 157 (243)
+.||+||++.+|...++..+|.+++ ++.|.+...... ...|+|+||+||+|.+.|.++|+.++.|+|+.++.||||||
T Consensus 53 VivRcRp~n~~E~~~~s~~VVs~~~~~kEV~v~~~~~sk~~~k~ftFDkVFGpes~Q~d~Y~~~v~p~i~eVl~GyNCTI 132 (1041)
T KOG0243|consen 53 VIVRCRPRNDRERKSKSSVVVSCDGIRKEVAVRQTIASKQIDKTFTFDKVFGPESQQEDLYDQAVSPIIKEVLEGYNCTI 132 (1041)
T ss_pred EEEEeCCCCchhhhcCCCeEEecCCCcceEEEecccccccccceeecceeeCcchhHHHHHHHHHHHHHHHHhccCCceE
Confidence 5689999999999889999999998 566888766332 36889999999999999999999999999999999999999
Q ss_pred EEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCCCC-c
Q psy9445 158 FAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDI-T 236 (243)
Q Consensus 158 ~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~~~-~ 236 (243)
|||||||+||||||.|..... .|..++.+|||||++.+||..++... ..|.|+|||+|+|||.++|||+|+... .
T Consensus 133 FAYGQTGTGKTyTMeG~~~~~---~g~l~~~aGIIPRal~~IFd~Le~~~-~EYsvKVSfLELYNEEl~DLLa~~~~~~~ 208 (1041)
T KOG0243|consen 133 FAYGQTGTGKTYTMEGGERKK---NGELPSEAGIIPRALRQIFDTLEAQG-AEYSVKVSFLELYNEELTDLLASEDTSDK 208 (1041)
T ss_pred EEecCCCCCceeeeecCcccc---cCCCCccCCcchHHHHHHHHHHHhcC-CeEEEEEEehhhhhHHHHHhcCCcccccc
Confidence 999999999999999975422 36677889999999999999999744 789999999999999999999998765 6
Q ss_pred cceecCC
Q psy9445 237 KLRLKKN 243 (243)
Q Consensus 237 ~l~i~e~ 243 (243)
.+++++|
T Consensus 209 ~~~~k~~ 215 (1041)
T KOG0243|consen 209 KLRIKDD 215 (1041)
T ss_pred ccccccC
Confidence 7777654
|
|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 243 | ||||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 7e-50 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 8e-45 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 9e-45 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 9e-45 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 9e-45 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 1e-44 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 1e-44 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 2e-44 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 9e-44 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 1e-42 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 7e-29 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 4e-27 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 3e-26 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-24 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 2e-21 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 2e-21 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 2e-21 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 2e-21 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 4e-21 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 1e-20 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 7e-20 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-19 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 1e-18 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 1e-18 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 1e-18 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 1e-18 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 3e-18 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 3e-18 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 3e-18 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 3e-18 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 3e-18 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 3e-18 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 3e-18 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 8e-18 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 1e-17 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 3e-17 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 3e-17 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 4e-17 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 9e-17 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 7e-17 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 9e-17 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 3e-16 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 3e-16 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 3e-16 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 4e-16 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 4e-16 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 1e-15 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 1e-15 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 5e-15 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-14 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 1e-13 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 3e-13 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 2e-12 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 2e-12 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 4e-12 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 1e-11 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 2e-11 |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
|
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 243 | |||
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 4e-71 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 4e-51 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 7e-67 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 5e-54 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 3e-63 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 9e-46 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 4e-62 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 4e-49 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 3e-60 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 1e-44 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 1e-59 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 7e-45 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 1e-59 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 7e-46 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 1e-59 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 1e-42 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 3e-58 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 6e-40 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 2e-57 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 2e-39 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 3e-57 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 6e-44 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 6e-57 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 9e-39 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 7e-57 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 2e-40 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 7e-57 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 7e-43 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 1e-56 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 8e-48 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 1e-56 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 1e-43 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 6e-55 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 5e-37 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 1e-54 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 3e-41 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 6e-54 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 6e-41 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 2e-51 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 5e-42 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 2e-51 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 3e-36 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 2e-50 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 7e-37 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 5e-50 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 8e-37 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 5e-50 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 4e-37 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 2e-49 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 2e-34 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 2e-46 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 4e-34 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 3e-09 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 |
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
Score = 220 bits (564), Expect = 4e-71
Identities = 90/157 (57%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
Query: 85 RPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNP 144
RPLNS ER +S +VD RE+ + ++ K++K F FDR F ESKQ DVY VV+P
Sbjct: 32 RPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSP 91
Query: 145 LIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELR 204
LI+EVL+GYNCTVFAYGQTGTGKT TM G ++ + SW+DD GI+PRA++HLFDELR
Sbjct: 92 LIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLFDELR 151
Query: 205 LLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLK 241
++ + E+T+R+S+LE+YNEEL DLLS DD TK+R+
Sbjct: 152 MM-EVEYTMRISYLELYNEELCDLLST-DDTTKIRIF 186
|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 243 | |||
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 99.98 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 99.91 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 99.9 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 99.9 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 99.9 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 99.9 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 99.9 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 99.9 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 99.9 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 99.9 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 99.9 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 99.89 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 99.89 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 99.89 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 99.89 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 99.89 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 99.89 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 99.89 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 99.89 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 99.89 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 99.88 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 99.88 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 99.88 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 99.88 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 99.88 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 99.87 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 99.86 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 99.86 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 99.85 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 99.85 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 98.13 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 97.24 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 93.27 | |
| 4etp_B | 333 | Spindle POLE BODY-associated protein VIK1; kinesin | 93.08 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 90.82 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 89.91 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 88.89 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 87.29 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 87.21 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 86.8 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 86.75 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 82.57 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 82.01 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 82.01 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 81.98 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 81.84 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 81.12 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 80.96 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 80.76 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 80.74 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 80.32 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 80.19 |
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
Probab=100.00 E-value=8.4e-41 Score=300.21 Aligned_cols=163 Identities=55% Similarity=0.916 Sum_probs=138.1
Q ss_pred CCCcccCCCcchhhcccceeeeecCCceEEEEecCCCCCcceEEecceeecCCCcchhhhccccchhHHHHhcCCceEEE
Q psy9445 79 TPHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVF 158 (243)
Q Consensus 79 ~~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~~~~~~f~fD~vF~~~a~q~ev~~~~~~~~v~~~~~G~n~~i~ 158 (243)
+..+|+||++..|...+...++.+.++.++.+.++......+.|+||+||++.++|++||+.++.|+|+.+++|||+|||
T Consensus 26 ~V~vRvRP~~~~E~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~F~FD~vf~~~~~Q~~Vy~~~~~plv~~~l~G~n~tif 105 (373)
T 2wbe_C 26 QVYVRVRPLNSRERCIRSAEVVDVVGPREVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVF 105 (373)
T ss_dssp EEEEEECCCCHHHHHHTCCBCEEEETTTEEEESSSSSSTTCEEEECSEEECTTCCHHHHHHHHHHHHHHHHHHTCCEEEE
T ss_pred EEEEEcCCCChhhhccCCCceEEEcCCCeEEEecCCCCCCceEEeccEEeccccchhHHHHHHHHHHHHHHhCCceEEEE
Confidence 36789999999998777777777777777777766555567899999999999999999999999999999999999999
Q ss_pred EeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhcCCceEEEEEEEEEEECCeEEeCCCCCCCCccc
Q psy9445 159 AYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKL 238 (243)
Q Consensus 159 ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~~~~~~~v~~S~~eiyne~v~DLL~~~~~~~~l 238 (243)
|||||||||||||+|....+....+.....+|||||++++||+.++. .+..|.|++||+|||||+|+|||++.. ..++
T Consensus 106 AYGqTGSGKTyTm~G~~~~~~~~~~~~~~~~Giipr~~~~lF~~i~~-~~~~~~v~vS~~EIYnE~i~DLL~~~~-~~~l 183 (373)
T 2wbe_C 106 AYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLFDELRM-MEVEYTMRISYLELYNEELCDLLSTDD-TTKI 183 (373)
T ss_dssp EECSTTSSHHHHHTBSCSCCSSSCSSCTTTBCHHHHHHHHHHHHHHH-CCSCEEEEEEEEEEETTEEEESSCTTS-CSCC
T ss_pred eecCCCCCcceecccCccccccccccccCCCcChHHHHHHHHHHHHh-cCceEEEEEEEEEEeCCeEEECCCCCC-CCCc
Confidence 99999999999999986544333444556789999999999999986 456899999999999999999999753 3556
Q ss_pred eecCC
Q psy9445 239 RLKKN 243 (243)
Q Consensus 239 ~i~e~ 243 (243)
+++||
T Consensus 184 ~i~~~ 188 (373)
T 2wbe_C 184 RIFDD 188 (373)
T ss_dssp CEEEC
T ss_pred eeEec
Confidence 66654
|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >4etp_B Spindle POLE BODY-associated protein VIK1; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 243 | ||||
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 2e-33 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 1e-18 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 4e-29 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 3e-17 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 2e-27 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 2e-12 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 2e-27 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 3e-16 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 1e-24 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 7e-14 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 4e-24 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 4e-15 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 1e-20 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 1e-10 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 9e-20 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 1e-15 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 5e-19 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 5e-15 |
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]
Score = 121 bits (304), Expect = 2e-33
Identities = 80/156 (51%), Positives = 112/156 (71%), Gaps = 4/156 (2%)
Query: 85 RPLNSVERAAKSCSIVDCSSSR-EITIK--ERVNDKISKTFGFDRVFSQESKQVDVYKYV 141
RP N ER A + SIV+C R E++++ + KT+ FD VF +KQ+DVY+ V
Sbjct: 9 RPFNLAERKASAHSIVECDPVRKEVSVRTGGLADKSSRKTYTFDMVFGASTKQIDVYRSV 68
Query: 142 VNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFD 201
V P++DEV+ GYNCT+FAYGQTGTGKTFTMEGE+S + +W++DPL+GI+PR ++ +F
Sbjct: 69 VCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEEYTWEEDPLAGIIPRTLHQIF- 127
Query: 202 ELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITK 237
E EF+V+VS LEIYNEEL DLL+P+ D+++
Sbjct: 128 EKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE 163
|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 243 | |||
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 99.8 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 99.8 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 99.78 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 99.75 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 99.75 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 99.74 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 99.74 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 99.7 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 93.59 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 92.37 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 90.34 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 89.77 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 89.41 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 88.68 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 85.94 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 85.58 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 85.08 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 83.98 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 83.81 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 81.98 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 81.81 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 81.67 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 81.55 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 80.49 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 80.33 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 80.08 |
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Mouse (Mus musculus), kif1a [TaxId: 10090]
Probab=100.00 E-value=2.3e-37 Score=274.57 Aligned_cols=153 Identities=32% Similarity=0.612 Sum_probs=128.7
Q ss_pred CCcccCCCcchhhcccceeeeecCCceEEEEecCCCCCcceEEecceeecCC--------CcchhhhccccchhHHHHhc
Q psy9445 80 PHIPYRPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQE--------SKQVDVYKYVVNPLIDEVLS 151 (243)
Q Consensus 80 ~~~~~~~~~~~E~~~~s~~iv~~~~~~ti~v~~~~~~~~~~~f~fD~vF~~~--------a~q~ev~~~~~~~~v~~~~~ 151 (243)
+.+|+||+...|...+..+++.+.+...+.+.+......+++|.||+||++. ++|++||+.++.|+|+.+++
T Consensus 5 V~vRvRP~~~~E~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~f~FD~vf~~~~~~~~~~~~sQ~~vy~~~~~plv~~~l~ 84 (349)
T d2zfia1 5 VAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFE 84 (349)
T ss_dssp EEEEECCCCHHHHHTTCCBCEEEETTEEEECCTTCTTSCCEEEECSEEEECSSCTTSSSCCCHHHHHHHTHHHHHHHHHT
T ss_pred EEEEeCCCChhHhcCCCcEEEEECCCcEEEECCCCCCcCCeeEEeceEeCCCCCccccccccHHHHHHHhhHHHHHHHHh
Confidence 5689999999998777777887777776666655555677899999999886 57999999999999999999
Q ss_pred CCceEEEEeccCCCCcceEeecCCCCCCCCCCCCCCCCCchhHHHHHHHHHHHhc--CCceEEEEEEEEEEECCeEEeCC
Q psy9445 152 GYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLL--GDAEFTVRVSFLEIYNEELIDLL 229 (243)
Q Consensus 152 G~n~~i~ayG~tgsGKt~Tm~G~~~~~~~~~~~~~~~~Gii~r~~~~lf~~~~~~--~~~~~~v~~S~~eiyne~v~DLL 229 (243)
|+|+||||||||||||||||+|++.. ..+|||||++++||+.++.. ....+.|.+||+|||||+|+|||
T Consensus 85 G~n~ti~aYGqTgSGKT~Tm~G~~~~---------~~~Glipr~l~~lf~~~~~~~~~~~~~~v~~S~~Eiyne~i~DLL 155 (349)
T d2zfia1 85 GYNVCIFAYGQTGAGKSYTMMGKQEK---------DQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLL 155 (349)
T ss_dssp TCCEEEEEECSTTSSHHHHHTBCSGG---------GCBCHHHHHHHHHHHHHHTCCCTTEEEEEEEEEEEEETTEEEETT
T ss_pred ccCceeeeeccCCCCCceeeccCccc---------cccCchHHHHhhhhhhccccccCCcceEEEEEeeeeeCCEEEecc
Confidence 99999999999999999999997431 23599999999999999863 45679999999999999999999
Q ss_pred CCCCCCccceecC
Q psy9445 230 SPTDDITKLRLKK 242 (243)
Q Consensus 230 ~~~~~~~~l~i~e 242 (243)
+|... ..++++|
T Consensus 156 ~~~~~-~~~~i~~ 167 (349)
T d2zfia1 156 NPKNK-GNLRVRE 167 (349)
T ss_dssp CTTTC-SCBCEEE
T ss_pred ccccc-CCceEEe
Confidence 98543 4455554
|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|