Psyllid ID: psy9483

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
MGGILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGSEVNAAYIKQGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQGDLVAGHRDI
cHHHHHHHcccEEEEEccccHHHHHHHHcccEEEEcccccccccHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHHHHccccccEEEEccccHHHHccccccccccccEEccccHHHHHHHccccHHHHHHHHHHccccEEEEcccccEEEcccEEEEEcccccccccccccccccccccc
cccEEEEccccEEEEEccccHHHHHHccccccEEcccccccHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHHcccHHHccccccEEEcccHHHHHHHHccccHHHHHHHHHHcccEEEEccccEEEEcccEEEEEccccccccccccccEccccccc
MGGILQCATVTLSIYVCsegavpilknyspelivlphyldrndsvDHIMYWMNRMHSvligpglgteplvqSNVISIIHKLKAanlnvplvidadglklvaehpgliqdyrgpvyltpnkreyENLLSGSEVNAAYikqghpnlTVIVKGHEDVIKNNQISltckegnswrrcggqgdlvaghrdi
MGGILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGSEVNAAYIKQGHPNLTVIVKGHEDVIKNNQISltckegnswrrcggqgdlvaghrdi
MGGILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGSEVNAAYIKQGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQGDLVAGHRDI
***ILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGSEVNAAYIKQGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQ**********
MGGILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGSEVNAAYIKQGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQGDLVAGH***
MGGILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGSEVNAAYIKQGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQGDLVAGHRDI
*GGILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGSEVNAAYIKQGHPNLTVIVKGHEDVIKNNQISLTCKEG*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGSEVNAAYIKQGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQGDLVAGHRDI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query186 2.2.26 [Sep-21-2011]
Q9CZ42343 ATP-dependent (S)-NAD(P)H yes N/A 0.897 0.486 0.414 3e-32
D4AAT7343 ATP-dependent (S)-NAD(P)H yes N/A 0.897 0.486 0.414 4e-32
E1BNQ4329 ATP-dependent (S)-NAD(P)H yes N/A 0.897 0.507 0.430 6e-32
Q5R824329 ATP-dependent (S)-NAD(P)H yes N/A 0.897 0.507 0.425 1e-31
E2QUI9347 ATP-dependent (S)-NAD(P)H yes N/A 0.897 0.481 0.425 2e-31
F1Q575330 ATP-dependent (S)-NAD(P)H yes N/A 0.897 0.506 0.419 3e-31
Q8IW45347 ATP-dependent (S)-NAD(P)H yes N/A 0.897 0.481 0.430 7e-31
E0VSF4300 ATP-dependent (S)-NAD(P)H N/A N/A 0.876 0.543 0.405 7e-30
E3XDZ8295 ATP-dependent (S)-NAD(P)H N/A N/A 0.876 0.552 0.423 5e-27
A7RRZ8358 ATP-dependent (S)-NAD(P)H N/A N/A 0.903 0.469 0.372 3e-26
>sp|Q9CZ42|NNRD_MOUSE ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Mus musculus GN=Carkd PE=1 SV=1 Back     alignment and function desciption
 Score =  137 bits (346), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 114/181 (62%), Gaps = 14/181 (7%)

Query: 12  LSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQ 71
           L+   C+  A P++K+YSPELIV P  LD +++V+ +  W+ R+H++++GPGLG + L+ 
Sbjct: 99  LTHVFCAREAAPVIKSYSPELIVHP-VLDSSNAVEEVEKWLPRLHALVVGPGLGRDDLLL 157

Query: 72  SNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENL----- 126
           +NV  I+   KA +  +P+VIDADGL LVA+ P LI  Y   + LTPN  E+  L     
Sbjct: 158 NNVRGILESTKARD--IPVVIDADGLWLVAQQPALIHSYHKAI-LTPNHVEFSRLWEAVL 214

Query: 127 ---LSGSEVNAAYIK--QGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQGDLVA 181
              +  +++  + +K  Q   N+TV+ KG +D+I N Q  L C +  S RRCGGQGDL++
Sbjct: 215 SSPMDSNDLKGSTLKLSQALGNITVVQKGEQDLISNGQQVLVCNQEGSSRRCGGQGDLLS 274

Query: 182 G 182
           G
Sbjct: 275 G 275
Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S-and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.
Mus musculus (taxid: 10090)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 9EC: 3
>sp|D4AAT7|NNRD_RAT ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Rattus norvegicus GN=Carkd PE=2 SV=1 Back     alignment and function description
>sp|E1BNQ4|NNRD_BOVIN ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Bos taurus GN=CARKD PE=3 SV=1 Back     alignment and function description
>sp|Q5R824|NNRD_PONAB ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Pongo abelii GN=CARKD PE=2 SV=1 Back     alignment and function description
>sp|E2QUI9|NNRD_CANFA ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Canis familiaris GN=CARKD PE=3 SV=1 Back     alignment and function description
>sp|F1Q575|NNRD_DANRE ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Danio rerio GN=zgc:171429 PE=2 SV=1 Back     alignment and function description
>sp|Q8IW45|NNRD_HUMAN ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Homo sapiens GN=CARKD PE=1 SV=1 Back     alignment and function description
>sp|E0VSF4|NNRD_PEDHC ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Pediculus humanus subsp. corporis GN=PHUM417680 PE=3 SV=1 Back     alignment and function description
>sp|E3XDZ8|NNRD_ANODA ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Anopheles darlingi GN=AND_21715 PE=3 SV=1 Back     alignment and function description
>sp|A7RRZ8|NNRD_NEMVE ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Nematostella vectensis GN=v1g162096 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
281346767266 hypothetical protein PANDA_014036 [Ailur 0.897 0.627 0.453 1e-31
301778485 343 PREDICTED: carbohydrate kinase domain-co 0.897 0.486 0.453 3e-31
298676452 327 ATP-dependent (S)-NAD(P)H-hydrate dehydr 0.897 0.510 0.414 2e-30
12843937 327 unnamed protein product [Mus musculus] 0.897 0.510 0.414 2e-30
81904495 343 RecName: Full=ATP-dependent (S)-NAD(P)H- 0.897 0.486 0.414 2e-30
12833461 298 unnamed protein product [Mus musculus] 0.897 0.560 0.414 2e-30
12849211 298 unnamed protein product [Mus musculus] g 0.897 0.560 0.414 2e-30
380876999 343 RecName: Full=ATP-dependent (S)-NAD(P)H- 0.897 0.486 0.414 2e-30
149057580 365 similar to RIKEN cDNA 0710008K08 (predic 0.897 0.457 0.414 2e-30
298676450 365 ATP-dependent (S)-NAD(P)H-hydrate dehydr 0.897 0.457 0.414 2e-30
>gi|281346767|gb|EFB22351.1| hypothetical protein PANDA_014036 [Ailuropoda melanoleuca] Back     alignment and taxonomy information
 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 112/181 (61%), Gaps = 14/181 (7%)

Query: 12  LSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQ 71
           LS   C+  A P++K+YSPELIV P  LDR  +V ++  W+ R+H++++GPGLG +  + 
Sbjct: 71  LSHVFCTREAAPVIKSYSPELIVHP-VLDRPSAVSNVEEWLPRLHALVVGPGLGRDDTLL 129

Query: 72  SNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENL----- 126
            NV  I+   KA ++  P+VIDADGL LVA+HP LIQ YR  V LTPN  E+  L     
Sbjct: 130 ENVKGILEASKARDM--PIVIDADGLWLVAQHPALIQGYRKAV-LTPNHVEFSRLSEAVL 186

Query: 127 ---LSGSEVNAA--YIKQGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQGDLVA 181
              + GS+   A   + Q   N+TVI KG  DVI + +  L C +  S RRCGGQGDL++
Sbjct: 187 RDPVDGSDHREAVRRLSQALGNVTVIQKGERDVISDGEQVLECAQEGSSRRCGGQGDLLS 246

Query: 182 G 182
           G
Sbjct: 247 G 247

Source: Ailuropoda melanoleuca

Species: Ailuropoda melanoleuca

Genus: Ailuropoda

Family: Ursidae

Order: Carnivora

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|301778485|ref|XP_002924662.1| PREDICTED: carbohydrate kinase domain-containing protein-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|298676452|ref|NP_001177286.1| ATP-dependent (S)-NAD(P)H-hydrate dehydratase isoform 2 [Mus musculus] gi|148690115|gb|EDL22062.1| RIKEN cDNA 0710008K08, isoform CRA_a [Mus musculus] Back     alignment and taxonomy information
>gi|12843937|dbj|BAB26172.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|81904495|sp|Q9CZ42.1|NNRD_MOUSE RecName: Full=ATP-dependent (S)-NAD(P)H-hydrate dehydratase; AltName: Full=ATP-dependent NAD(P)HX dehydratase; AltName: Full=Carbohydrate kinase domain-containing protein; Flags: Precursor gi|12850139|dbj|BAB28607.1| unnamed protein product [Mus musculus] gi|18043481|gb|AAH19538.1| Carbohydrate kinase domain containing [Mus musculus] gi|74152242|dbj|BAE32403.1| unnamed protein product [Mus musculus] gi|74222655|dbj|BAE42200.1| unnamed protein product [Mus musculus] gi|148690117|gb|EDL22064.1| RIKEN cDNA 0710008K08, isoform CRA_c [Mus musculus] Back     alignment and taxonomy information
>gi|12833461|dbj|BAB22531.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|12849211|dbj|BAB28251.1| unnamed protein product [Mus musculus] gi|12850205|dbj|BAB28632.1| unnamed protein product [Mus musculus] gi|12850770|dbj|BAB28847.1| unnamed protein product [Mus musculus] gi|18314682|gb|AAH21955.1| Carkd protein [Mus musculus] Back     alignment and taxonomy information
>gi|380876999|sp|D4AAT7.1|NNRD_RAT RecName: Full=ATP-dependent (S)-NAD(P)H-hydrate dehydratase; AltName: Full=ATP-dependent NAD(P)HX dehydratase; AltName: Full=Carbohydrate kinase domain-containing protein; Flags: Precursor Back     alignment and taxonomy information
>gi|149057580|gb|EDM08823.1| similar to RIKEN cDNA 0710008K08 (predicted), isoform CRA_a [Rattus norvegicus] Back     alignment and taxonomy information
>gi|298676450|ref|NP_081271.2| ATP-dependent (S)-NAD(P)H-hydrate dehydratase isoform 1 [Mus musculus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
RGD|1562691343 Carkd "carbohydrate kinase dom 0.870 0.472 0.431 4.7e-32
UNIPROTKB|D4AAT7343 Carkd "ATP-dependent (S)-NAD(P 0.870 0.472 0.431 4.7e-32
MGI|MGI:1913353343 Carkd "carbohydrate kinase dom 0.870 0.472 0.420 6e-32
UNIPROTKB|E2QUI9347 CARKD "ATP-dependent (S)-NAD(P 0.897 0.481 0.436 2.6e-31
UNIPROTKB|E1BNQ4329 CARKD "ATP-dependent (S)-NAD(P 0.897 0.507 0.430 3.3e-31
UNIPROTKB|Q8IW45347 CARKD "ATP-dependent (S)-NAD(P 0.897 0.481 0.430 1.1e-30
ZFIN|ZDB-GENE-080204-1625 zgc:171429 "zgc:171429" [Danio 0.887 0.264 0.431 2.6e-30
UNIPROTKB|I3LS60347 CARKD "ATP-dependent (S)-NAD(P 0.897 0.481 0.425 3e-30
UNIPROTKB|F1P2P4322 CARKD "Uncharacterized protein 0.897 0.518 0.419 1.6e-29
UNIPROTKB|E2QUG8329 CARKD "ATP-dependent (S)-NAD(P 0.913 0.516 0.380 4.6e-25
RGD|1562691 Carkd "carbohydrate kinase domain containing" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 4.7e-32, P = 4.7e-32
 Identities = 76/176 (43%), Positives = 113/176 (64%)

Query:    17 CSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVIS 76
             C+  A P++K+YSPELIV P  LD +D+V+ +  W+ R+H++++GPGLG + L+ +NV  
Sbjct:   104 CAREAAPVIKSYSPELIVHP-VLDSSDAVEEVEKWLPRLHALVVGPGLGRDDLLLNNVRG 162

Query:    77 IIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENL----LSG--- 129
             I+   KA +  +P+VIDADGL L+A+ P L+  Y+  V LTPN  E+  L    LS    
Sbjct:   163 ILESTKARD--IPVVIDADGLWLIAQRPALVHGYQKAV-LTPNHVEFSRLWDAVLSSPMD 219

Query:   130 -SEVNAAYIK--QGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQGDLVAG 182
              S  + + +K  Q   N+T++ KG +D+I N Q  L C +  S RRCGGQGDL++G
Sbjct:   220 TSNHSGSVLKLSQALGNITIVQKGEQDLISNGQQVLVCNQEGSSRRCGGQGDLLSG 275
GO:0003674 "molecular_function" evidence=ND
GO:0005524 "ATP binding" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0005739 "mitochondrion" evidence=IEA;ISO
GO:0008150 "biological_process" evidence=ND
GO:0046496 "nicotinamide nucleotide metabolic process" evidence=IEA
GO:0047453 "ATP-dependent NAD(P)H-hydrate dehydratase activity" evidence=IEA
UNIPROTKB|D4AAT7 Carkd "ATP-dependent (S)-NAD(P)H-hydrate dehydratase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1913353 Carkd "carbohydrate kinase domain containing" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUI9 CARKD "ATP-dependent (S)-NAD(P)H-hydrate dehydratase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNQ4 CARKD "ATP-dependent (S)-NAD(P)H-hydrate dehydratase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IW45 CARKD "ATP-dependent (S)-NAD(P)H-hydrate dehydratase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080204-1 zgc:171429 "zgc:171429" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LS60 CARKD "ATP-dependent (S)-NAD(P)H-hydrate dehydratase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P2P4 CARKD "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUG8 CARKD "ATP-dependent (S)-NAD(P)H-hydrate dehydratase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
cd01171254 cd01171, YXKO-related, B 4e-37
COG0063284 COG0063, COG0063, Predicted sugar kinase [Carbohyd 2e-27
pfam01256242 pfam01256, Carb_kinase, Carbohydrate kinase 6e-27
TIGR00196271 TIGR00196, yjeF_cterm, yjeF C-terminal region, hyd 5e-22
PRK10565508 PRK10565, PRK10565, putative carbohydrate kinase; 0.004
>gnl|CDD|238576 cd01171, YXKO-related, B Back     alignment and domain information 
 Score =  128 bits (324), Expect = 4e-37
 Identities = 56/176 (31%), Positives = 84/176 (47%), Gaps = 18/176 (10%)

Query: 15  YVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNV 74
                 A  ++K+YSPEL+V P  L+    ++ ++  + R  +V+IGPGLG +       
Sbjct: 41  VATPPEAAAVIKSYSPELMVHP-LLE--TDIEELLELLERADAVVIGPGLGRDEEAAE-- 95

Query: 75  ISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGSEVNA 134
             I+ K  A +   PLV+DAD L L+A+ P LI+ Y  PV LTP+  E+  LL       
Sbjct: 96  --ILEKALAKD--KPLVLDADALNLLADEPSLIKRYG-PVVLTPHPGEFARLLGALVEEI 150

Query: 135 AYIKQGH-------PNLTVIVKGHEDVIKNNQISLT-CKEGNSWRRCGGQGDLVAG 182
              +             TV++KG   VI +    +     GN     GG GD++AG
Sbjct: 151 QADRLAAAREAAAKLGATVVLKGAVTVIADPDGRVYVNPTGNPGLATGGSGDVLAG 206

subtilis YXKO protein of unknown function and related proteins. Based on the conservation of the ATP binding site, the substrate binding site and the Mg2+binding site and structural homology this group is a member of the ribokinase-like superfamily. Length = 254
>gnl|CDD|223141 COG0063, COG0063, Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|189911 pfam01256, Carb_kinase, Carbohydrate kinase Back     alignment and domain information
>gnl|CDD|232868 TIGR00196, yjeF_cterm, yjeF C-terminal region, hydroxyethylthiazole kinase-related Back     alignment and domain information
>gnl|CDD|182554 PRK10565, PRK10565, putative carbohydrate kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
PF01256242 Carb_kinase: Carbohydrate kinase; InterPro: IPR000 100.0
COG0063284 Predicted sugar kinase [Carbohydrate transport and 100.0
PRK10565508 putative carbohydrate kinase; Provisional 100.0
KOG3974|consensus306 100.0
cd01171254 YXKO-related B.subtilis YXKO protein of unknown fu 99.97
TIGR00196272 yjeF_cterm yjeF C-terminal region, hydroxyethylthi 99.96
TIGR00694249 thiM hydroxyethylthiazole kinase. This model repre 99.93
PRK09355263 hydroxyethylthiazole kinase; Validated 99.91
COG2145265 ThiM Hydroxyethylthiazole kinase, sugar kinase fam 99.89
PF02110246 HK: Hydroxyethylthiazole kinase family; InterPro: 99.88
cd01170242 THZ_kinase 4-methyl-5-beta-hydroxyethylthiazole (T 99.84
COG0351263 ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidi 99.58
PTZ00493321 phosphomethylpyrimidine kinase; Provisional 99.4
PRK06427266 bifunctional hydroxy-methylpyrimidine kinase/ hydr 99.33
TIGR00097254 HMP-P_kinase phosphomethylpyrimidine kinase. This 99.32
PF08543246 Phos_pyr_kin: Phosphomethylpyrimidine kinase; Inte 99.27
cd01169242 HMPP_kinase 4-amino-5-hydroxymethyl-2-methyl-pyrim 99.23
PRK12616270 pyridoxal kinase; Reviewed 99.16
PLN02898 502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 99.13
PRK14713 530 multifunctional hydroxymethylpyrimidine phosphokin 99.13
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 99.13
PRK12412268 pyridoxal kinase; Reviewed 99.03
cd01173254 pyridoxal_pyridoxamine_kinase Pyridoxal kinase pla 99.01
PRK08176281 pdxK pyridoxal-pyridoxamine kinase/hydroxymethylpy 99.0
PTZ00347504 phosphomethylpyrimidine kinase; Provisional 98.96
PRK07105284 pyridoxamine kinase; Validated 98.89
PRK08573 448 phosphomethylpyrimidine kinase; Provisional 98.78
KOG2598|consensus 523 98.76
PRK05756286 pyridoxamine kinase; Validated 98.74
PRK12413253 phosphomethylpyrimidine kinase; Provisional 98.72
PLN02978308 pyridoxal kinase 98.7
cd00287196 ribokinase_pfkB_like ribokinase/pfkB superfamily: 98.64
COG2240281 PdxK Pyridoxal/pyridoxine/pyridoxamine kinase [Coe 98.61
TIGR00687286 pyridox_kin pyridoxal kinase. ThiD and related pro 98.54
PTZ00344296 pyridoxal kinase; Provisional 98.5
COG1105310 FruK Fructose-1-phosphate kinase and related fruct 98.13
TIGR02198315 rfaE_dom_I rfaE bifunctional protein, domain I. Rf 98.04
PRK11316 473 bifunctional heptose 7-phosphate kinase/heptose 1- 97.95
cd01164289 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 97.89
cd01172304 RfaE_like RfaE encodes a bifunctional ADP-heptose 97.87
KOG2599|consensus308 97.81
cd01174292 ribokinase Ribokinase catalyses the phosphorylatio 97.76
TIGR03168303 1-PFK hexose kinase, 1-phosphofructokinase family. 97.7
COG2870 467 RfaE ADP-heptose synthase, bifunctional sugar kina 97.63
cd01166294 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phospho 97.6
cd01167295 bac_FRK Fructokinases (FRKs) mainly from bacteria 97.58
PRK13508309 tagatose-6-phosphate kinase; Provisional 97.48
PRK09513312 fruK 1-phosphofructokinase; Provisional 97.47
cd01946277 ribokinase_group_C Ribokinase-like subgroup C. Fou 97.44
PRK11142306 ribokinase; Provisional 97.43
TIGR03828304 pfkB 1-phosphofructokinase. This enzyme acts in co 97.42
cd01168312 adenosine_kinase Adenosine kinase (AK) catalyzes t 97.37
PRK10294309 6-phosphofructokinase 2; Provisional 97.35
TIGR02152293 D_ribokin_bact ribokinase. This model describes ri 97.3
TIGR01231309 lacC tagatose-6-phosphate kinase. This enzyme is p 97.28
PLN02341 470 pfkB-type carbohydrate kinase family protein 97.23
PLN02379367 pfkB-type carbohydrate kinase family protein 97.15
cd01941288 YeiC_kinase_like YeiC-like sugar kinase. Found in 97.04
cd01944289 YegV_kinase_like YegV-like sugar kinase. Found onl 97.01
cd01945284 ribokinase_group_B Ribokinase-like subgroup B. Fou 96.98
PRK09434304 aminoimidazole riboside kinase; Provisional 96.95
PRK09850313 pseudouridine kinase; Provisional 96.9
PLN02813426 pfkB-type carbohydrate kinase family protein 96.87
PTZ00292326 ribokinase; Provisional 96.86
PLN02323330 probable fructokinase 96.6
cd01942279 ribokinase_group_A Ribokinase-like subgroup A. Fou 96.39
PRK09954362 putative kinase; Provisional 96.26
PTZ00247345 adenosine kinase; Provisional 96.18
PF00294301 PfkB: pfkB family carbohydrate kinase; InterPro: I 95.41
COG0524311 RbsK Sugar kinases, ribokinase family [Carbohydrat 95.38
PRK15074 434 inosine/guanosine kinase; Provisional 95.31
cd01937254 ribokinase_group_D Ribokinase-like subgroup D. Fou 95.22
cd01940264 Fructoselysine_kinase_like Fructoselysine kinase-l 93.67
PLN02548332 adenosine kinase 93.12
cd01947265 Guanosine_kinase_like Guanosine kinase-like sugar 93.01
PLN02543496 pfkB-type carbohydrate kinase family protein 89.95
PLN02967 581 kinase 89.3
cd01943328 MAK32 MAK32 kinase. MAK32 is a protein found prima 89.12
PRK00366 360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 82.19
PRK09813260 fructoselysine 6-kinase; Provisional 81.4
PLN02630335 pfkB-type carbohydrate kinase family protein 80.35
>PF01256 Carb_kinase: Carbohydrate kinase; InterPro: IPR000631 This family is related to Hydroxyethylthiazole kinase IPR000417 from INTERPRO and PfkB carbohydrate kinase IPR011611 from INTERPRO implying that it also a carbohydrate kinase Back     alignment and domain information 
Probab=100.00  E-value=3.2e-46  Score=311.11  Aligned_cols=171  Identities=30%  Similarity=0.502  Sum_probs=141.3

Q ss_pred             ccchhhcccceeEEEecCCchhhhhhcCCceEEecccCCCcchHHHHHHhcccCcEEEEccCCCCCHHHHHHHHHHHHHH
Q psy9483           2 GGILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISIIHKL   81 (186)
Q Consensus         2 ~~~~~r~GaGlv~v~~~~~~~~~~~~~~Pe~~v~~~~~~~~~~~~~~~~~~~~~~aivIGpGlg~~~~~~~~~~~~l~~~   81 (186)
                      +++|+|+|||+|++++|+++...+++++||+|+++++  +.+.. ++.+..+++|+++||||||+++++.+++..+++. 
T Consensus        18 a~aAlr~GaGlV~~~~~~~~~~~~~~~~Pe~m~~~~~--~~~~~-~~~~~~~~~~av~iGPGlg~~~~~~~~~~~~~~~-   93 (242)
T PF01256_consen   18 ARAALRSGAGLVTLATPESIAPVIASYSPEAMVSPLP--SDEDV-EILELLEKADAVVIGPGLGRDEETEELLEELLES-   93 (242)
T ss_dssp             HHHHHHTT-SEEEEEECGCCHHHHHHHTTTSEEEETT--HCCHH-HHHHHHCH-SEEEE-TT-SSSHHHHHHHHHHHHH-
T ss_pred             HHHHHHHCCCcEEEEEcHHHHHHHHhCCceeEEeccc--chhhh-hhHhhhccCCEEEeecCCCCchhhHHHHHHHHhh-
Confidence            3689999999999999999999999999999999983  11223 5677789999999999999999988888777653 


Q ss_pred             HhcCCCCCEEEecccccccccCcccccccCCCeEecCCHHHHhhhcCC-C-----hHHHHH-HHHhCCCEEEEEeCCeeE
Q psy9483          82 KAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSG-S-----EVNAAY-IKQGHPNLTVIVKGHEDV  154 (186)
Q Consensus        82 ~~~~~~~p~VlDadal~~l~~~~~l~~~~~~~~iiTPh~~E~~rL~~~-~-----~~~~a~-~a~~~~~~~vvlKG~~~~  154 (186)
                           +.|+|||||||++++.+.   .....++|||||++||+||++. .     ..+.++ +++++ +++|||||++|+
T Consensus        94 -----~~p~VlDADaL~~l~~~~---~~~~~~~IlTPH~gE~~rL~~~~~~~~~~~~~~a~~~a~~~-~~~vvLKG~~t~  164 (242)
T PF01256_consen   94 -----DKPLVLDADALNLLAENP---KKRNAPVILTPHPGEFARLLGKSVEIQEDRIEAAREFAKEY-GAVVVLKGAVTI  164 (242)
T ss_dssp             -----CSTEEEECHHHHCHHHCC---CCSSSCEEEE-BHHHHHHHHTTTCHHCCSHHHHHHHHHHHH-TSEEEEESTSSE
T ss_pred             -----cceEEEehHHHHHHHhcc---ccCCCCEEECCCHHHHHHHhCCcccchhhHHHHHHHHHhhc-CcEEEEeCCCcE
Confidence                 789999999999999875   3345679999999999999998 2     245788 99999 599999999999


Q ss_pred             EEc-CCeEEEEcCCCCCCCCCChhHHHHhhhc
Q psy9483         155 IKN-NQISLTCKEGNSWRRCGGQGDLVAGHRD  185 (186)
Q Consensus       155 I~~-~~~~~~~~~g~~~la~~GsGDvLaGiia  185 (186)
                      |++ +++.|+|.+|||+|+++||||||||+|+
T Consensus       165 I~~p~~~~~~n~~gn~~la~gGsGDvLaGii~  196 (242)
T PF01256_consen  165 IASPGGRVYVNPTGNPGLATGGSGDVLAGIIA  196 (242)
T ss_dssp             EEEETSEEEEE----GGGSSTTHHHHHHHHHH
T ss_pred             EEecCcceeEeCCCCCCCCCCCcccHHHHHHH
Confidence            998 7789999999999999999999999996

Several uncharacterised proteins have been shown to share regions of similarities, including yeast chromosome XI hypothetical protein YKL151c; Caenorhabditis elegans hypothetical protein R107.2; Escherichia coli hypothetical protein yjeF; Bacillus subtilis hypothetical protein yxkO; Helicobacter pylori hypothetical protein HP1363; Mycobacterium tuberculosis hypothetical protein MtCY77.05c; Mycobacterium leprae hypothetical protein B229_C2_201; Synechocystis sp. (strain PCC 6803) hypothetical protein sll1433; and Methanocaldococcus jannaschii (Methanococcus jannaschii) hypothetical protein MJ1586. These are proteins of about 30 to 40 kDa whose central region is well conserved.; PDB: 3RSG_A 3RT9_A 3RRF_A 3RTB_A 3RRE_A 3RS9_A 3RSS_A 3RRB_A 3RTA_A 3RTD_A ....
>COG0063 Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10565 putative carbohydrate kinase; Provisional Back     alignment and domain information
>KOG3974|consensus Back     alignment and domain information
>cd01171 YXKO-related B Back     alignment and domain information
>TIGR00196 yjeF_cterm yjeF C-terminal region, hydroxyethylthiazole kinase-related Back     alignment and domain information
>TIGR00694 thiM hydroxyethylthiazole kinase Back     alignment and domain information
>PRK09355 hydroxyethylthiazole kinase; Validated Back     alignment and domain information
>COG2145 ThiM Hydroxyethylthiazole kinase, sugar kinase family [Coenzyme metabolism] Back     alignment and domain information
>PF02110 HK: Hydroxyethylthiazole kinase family; InterPro: IPR000417 Thiamine pyrophosphate (TPP), a required cofactor for many enzymes in the cell, is synthesised de novo in Salmonella typhimurium [] Back     alignment and domain information
>cd01170 THZ_kinase 4-methyl-5-beta-hydroxyethylthiazole (Thz) kinase catalyzes the phosphorylation of the hydroxylgroup of Thz Back     alignment and domain information
>COG0351 ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00493 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK06427 bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase; Reviewed Back     alignment and domain information
>TIGR00097 HMP-P_kinase phosphomethylpyrimidine kinase Back     alignment and domain information
>PF08543 Phos_pyr_kin: Phosphomethylpyrimidine kinase; InterPro: IPR013749 This enzyme 2 Back     alignment and domain information
>cd01169 HMPP_kinase 4-amino-5-hydroxymethyl-2-methyl-pyrimidine phosphate kinase (HMPP-kinase) catalyzes two consecutive phosphorylation steps in the thiamine phosphate biosynthesis pathway, leading to the synthesis of vitamin B1 Back     alignment and domain information
>PRK12616 pyridoxal kinase; Reviewed Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PRK14713 multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK12412 pyridoxal kinase; Reviewed Back     alignment and domain information
>cd01173 pyridoxal_pyridoxamine_kinase Pyridoxal kinase plays a key role in the synthesis of the active coenzyme pyridoxal-5'-phosphate (PLP), by catalyzing the phosphorylation of the precursor vitamin B6 in the presence of Zn2+ and ATP Back     alignment and domain information
>PRK08176 pdxK pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine kinase; Reviewed Back     alignment and domain information
>PTZ00347 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK07105 pyridoxamine kinase; Validated Back     alignment and domain information
>PRK08573 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>KOG2598|consensus Back     alignment and domain information
>PRK05756 pyridoxamine kinase; Validated Back     alignment and domain information
>PRK12413 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PLN02978 pyridoxal kinase Back     alignment and domain information
>cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information
>COG2240 PdxK Pyridoxal/pyridoxine/pyridoxamine kinase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00687 pyridox_kin pyridoxal kinase Back     alignment and domain information
>PTZ00344 pyridoxal kinase; Provisional Back     alignment and domain information
>COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>cd01164 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases Back     alignment and domain information
>cd01172 RfaE_like RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose Back     alignment and domain information
>KOG2599|consensus Back     alignment and domain information
>cd01174 ribokinase Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP Back     alignment and domain information
>TIGR03168 1-PFK hexose kinase, 1-phosphofructokinase family Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd01166 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) Back     alignment and domain information
>cd01167 bac_FRK Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate Back     alignment and domain information
>PRK13508 tagatose-6-phosphate kinase; Provisional Back     alignment and domain information
>PRK09513 fruK 1-phosphofructokinase; Provisional Back     alignment and domain information
>cd01946 ribokinase_group_C Ribokinase-like subgroup C Back     alignment and domain information
>PRK11142 ribokinase; Provisional Back     alignment and domain information
>TIGR03828 pfkB 1-phosphofructokinase Back     alignment and domain information
>cd01168 adenosine_kinase Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor Back     alignment and domain information
>PRK10294 6-phosphofructokinase 2; Provisional Back     alignment and domain information
>TIGR02152 D_ribokin_bact ribokinase Back     alignment and domain information
>TIGR01231 lacC tagatose-6-phosphate kinase Back     alignment and domain information
>PLN02341 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PLN02379 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>cd01941 YeiC_kinase_like YeiC-like sugar kinase Back     alignment and domain information
>cd01944 YegV_kinase_like YegV-like sugar kinase Back     alignment and domain information
>cd01945 ribokinase_group_B Ribokinase-like subgroup B Back     alignment and domain information
>PRK09434 aminoimidazole riboside kinase; Provisional Back     alignment and domain information
>PRK09850 pseudouridine kinase; Provisional Back     alignment and domain information
>PLN02813 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PTZ00292 ribokinase; Provisional Back     alignment and domain information
>PLN02323 probable fructokinase Back     alignment and domain information
>cd01942 ribokinase_group_A Ribokinase-like subgroup A Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PTZ00247 adenosine kinase; Provisional Back     alignment and domain information
>PF00294 PfkB: pfkB family carbohydrate kinase; InterPro: IPR011611 This entry includes a variety of carbohydrate and pyrimidine kinases Back     alignment and domain information
>COG0524 RbsK Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15074 inosine/guanosine kinase; Provisional Back     alignment and domain information
>cd01937 ribokinase_group_D Ribokinase-like subgroup D Back     alignment and domain information
>cd01940 Fructoselysine_kinase_like Fructoselysine kinase-like Back     alignment and domain information
>PLN02548 adenosine kinase Back     alignment and domain information
>cd01947 Guanosine_kinase_like Guanosine kinase-like sugar kinases Back     alignment and domain information
>PLN02543 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PLN02967 kinase Back     alignment and domain information
>cd01943 MAK32 MAK32 kinase Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>PRK09813 fructoselysine 6-kinase; Provisional Back     alignment and domain information
>PLN02630 pfkB-type carbohydrate kinase family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3rs8_A502 Crystal Structure Of Tm0922, A Fusion Of A Domain O 7e-05
2ax3_A502 Crystal Structure Of A Putative Carbohydrate Kinase 7e-05
3rph_A279 Crystal Structure Of AdpATP-Dependent Nad(P)h-Hydra 2e-04
3bgk_A311 The Crystal Structure Of Hypothetic Protein Smu.573 3e-04
>pdb|3RS8|A Chain A, Crystal Structure Of Tm0922, A Fusion Of A Domain Of Unknown Function And AdpATP-Dependent Nad(P)h-Hydrate Dehydratase From Thermotoga Maritima In Complex With Adp-Ribose Length = 502 Back     alignment and structure 
Iteration: 1

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 79/179 (44%), Gaps = 26/179 (14%)
Query: 21  AVPILKNY-----SPELIVLPHYLDRN----DSVDHIMYWMNRMHSVLIGPGLGTEPLVQ 71
           AVP  +N       PELI +P   ++      ++   +     +  V IGPGLG    V+
Sbjct: 278 AVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVR 337
Query: 72  SNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGS- 130
             V   +  L+      P VIDAD + ++     ++++ + P  LTP+  E   L+  + 
Sbjct: 338 EFVNEFLKTLEK-----PAVIDADAINVL--DTSVLKERKSPAVLTPHPGEMARLVKKTV 390
Query: 131 -------EVNAAYIKQGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQGDLVAG 182
                  E+   + K+   +  +++K    ++ + + +L    GN+    GG GD++ G
Sbjct: 391 GDVKYNYELAEEFAKEN--DCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTG 447
>pdb|2AX3|A Chain A, Crystal Structure Of A Putative Carbohydrate Kinase (Tm0922) From Thermotoga Maritima Msb8 At 2.25 A Resolution Length = 502 Back     alignment and structure
>pdb|3RPH|A Chain A, Crystal Structure Of AdpATP-Dependent Nad(P)h-Hydrate Dehydratase From Bacillus Subtilis Co-Crystallized With AtpMG2+. Length = 279 Back     alignment and structure
>pdb|3BGK|A Chain A, The Crystal Structure Of Hypothetic Protein Smu.573 From Streptococcus Mutans Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3rss_A502 Putative uncharacterized protein; unknown function 9e-22
3bgk_A311 SMU.573, putative uncharacterized protein; alpha/b 1e-20
2r3b_A310 YJEF-related protein; putative kinase in the ribok 8e-19
3rpz_A279 ADP/ATP-dependent NAD(P)H-hydrate dehydratase; str 1e-14
3k5w_A475 Carbohydrate kinase; 11206B,helicobacter pylori,PS 3e-12
1v8a_A265 Hydroxyethylthiazole kinase; alpha-beta, ATP bindi 1e-06
1ekq_A272 Hydroxyethylthiazole kinase; alpha-beta, transfera 4e-04
>3rss_A Putative uncharacterized protein; unknown function, ADP/ATP-dependent NAD(P)H-hydrate dehydrat lyase; HET: NAP; 1.95A {Thermotoga maritima} PDB: 3rrb_A* 2ax3_A* 3rre_A* 3rrj_A* 3rs8_A* 3rs9_A* 3rsf_A* 3rsg_A* 3rrf_A* 3rsq_A* 3rt7_A* 3rt9_A* 3rta_A* 3rtb_A* 3rtc_A* 3rtd_A* 3rte_A* 3rtg_A* 3ru2_A* 3ru3_A* Length = 502 Back     alignment and structure
 Score = 90.3 bits (225), Expect = 9e-22
 Identities = 41/183 (22%), Positives = 73/183 (39%), Gaps = 20/183 (10%)

Query: 10  VTLSIYVCSEGAVPILKNYSPELIVLP----HYLDRNDSVDHIMYWMNRMHSVLIGPGLG 65
           V L           I  +  PELI +P           ++   +     +  V IGPGLG
Sbjct: 275 VKL---AVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLG 331

Query: 66  TEPLVQSNVISIIHKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYEN 125
               V+  V   +       L  P VIDAD + ++     ++++ + P  LTP+  E   
Sbjct: 332 NNEHVREFVNEFL-----KTLEKPAVIDADAINVLDTS--VLKERKSPAVLTPHPGEMAR 384

Query: 126 LL--SGSEV----NAAYIKQGHPNLTVIVKGHEDVIKNNQISLTCKEGNSWRRCGGQGDL 179
           L+  +  +V      A       +  +++K    ++ + + +L    GN+    GG GD+
Sbjct: 385 LVKKTVGDVKYNYELAEEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDV 444

Query: 180 VAG 182
           + G
Sbjct: 445 LTG 447
>3bgk_A SMU.573, putative uncharacterized protein; alpha/beta three layer sandwich, unknown function; 2.50A {Streptococcus mutans} Length = 311 Back     alignment and structure
>2r3b_A YJEF-related protein; putative kinase in the ribokinase-like superfamily, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Enterococcus faecalis} PDB: 2r3e_A Length = 310 Back     alignment and structure
>3rpz_A ADP/ATP-dependent NAD(P)H-hydrate dehydratase; structural genomics, PSI-biology; HET: AMP NPW; 1.51A {Bacillus subtilis} PDB: 3rph_A* 3rq2_A* 3rq5_A* 3rq6_A* 3rq8_A* 3rqh_A* 3rqq_A* 3rqx_A* 1kyh_A Length = 279 Back     alignment and structure
>3k5w_A Carbohydrate kinase; 11206B,helicobacter pylori,PSI-II, NYSGXRC, , structural genomics, protein structure initiative; 2.60A {Helicobacter pylori} Length = 475 Back     alignment and structure
>1v8a_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, structural genomics, riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} SCOP: c.72.1.2 PDB: 3hpd_A Length = 265 Back     alignment and structure
>1ekq_A Hydroxyethylthiazole kinase; alpha-beta, transferase; 1.50A {Bacillus subtilis} SCOP: c.72.1.2 PDB: 1ekk_A 1c3q_A 1esj_A 1esq_A* Length = 272 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
3rpz_A279 ADP/ATP-dependent NAD(P)H-hydrate dehydratase; str 100.0
3rss_A502 Putative uncharacterized protein; unknown function 100.0
3k5w_A475 Carbohydrate kinase; 11206B,helicobacter pylori,PS 100.0
2r3b_A310 YJEF-related protein; putative kinase in the ribok 100.0
3bgk_A311 SMU.573, putative uncharacterized protein; alpha/b 100.0
3hpd_A265 Hydroxyethylthiazole kinase; alpha-beta, ATP bindi 99.95
3dzv_A273 4-methyl-5-(beta-hydroxyethyl)thiazole kinase; NP_ 99.94
1v8a_A265 Hydroxyethylthiazole kinase; alpha-beta, ATP bindi 99.93
3nl6_A540 Thiamine biosynthetic bifunctional enzyme; thiamin 99.93
1ekq_A272 Hydroxyethylthiazole kinase; alpha-beta, transfera 99.91
2i5b_A271 Phosphomethylpyrimidine kinase; ADP complex, PDXK, 99.66
3rm5_A 550 Hydroxymethylpyrimidine/phosphomethylpyrimidine K 99.63
1ub0_A258 THID, phosphomethylpyrimidine kinase; thiamin bios 99.46
1jxh_A288 Phosphomethylpyrimidine kinase; THID, ribokinase f 99.42
3h74_A282 Pyridoxal kinase; PSI-II, structural genomics, pro 99.27
3pzs_A289 PM kinase, pyridoxamine kinase; structural genomic 99.18
3mbh_A291 Putative phosphomethylpyrimidine kinase; structura 99.17
2ddm_A283 Pyridoxine kinase; pyridoxal kinase, ribokinase, p 99.14
3zs7_A300 Pyridoxal kinase; transferase, sleeping sickness; 99.01
1rkd_A309 Ribokinase; carbohydrate kinase, ribose, nucleotid 98.5
3ry7_A304 Ribokinase; transferase; 2.15A {Staphylococcus aur 98.48
2qhp_A296 Fructokinase; NP_810670.1, PFKB family carbohydrat 98.46
3ktn_A346 Carbohydrate kinase, PFKB family; PFKB family,ribo 98.42
2yxt_A312 Pyridoxal kinase; beta sheet with alpha helix, met 98.41
4e69_A328 2-dehydro-3-deoxygluconokinase; putative sugar kin 98.4
2jg5_A306 Fructose 1-phosphate kinase; 1-phosphofructokinase 98.4
4du5_A336 PFKB; structural genomics, PSI-biology, NEW YORK s 98.31
2fv7_A331 Ribokinase; structural genomics, structural genomi 98.31
3lhx_A319 Ketodeoxygluconokinase; structural genomics, PSI-2 98.25
3iq0_A330 Putative ribokinase II; transferase,kinase,SAD,rib 98.18
3ie7_A320 LIN2199 protein; phosphofructokinases, transferase 98.16
2rbc_A343 Sugar kinase, AGR_C_4560P; ribokinase family, ATP- 98.15
2afb_A351 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- 98.11
4e84_A352 D-beta-D-heptose 7-phosphate kinase; LPS-heptose b 98.08
3umo_A309 6-phosphofructokinase isozyme 2; glycolysis, trans 98.07
2f02_A323 Tagatose-6-phosphate kinase; LACC, structural geno 98.04
4e3a_A352 Sugar kinase protein; structural genomics, protein 98.03
3ljs_A338 Fructokinase; fructokianse, PSI2, NYSGXRC, structu 98.01
3cqd_A309 6-phosphofructokinase isozyme 2; phosphofructokina 98.0
2nwh_A317 AGR_C_3442P, carbohydrate kinase; structural genom 98.0
2abq_A306 Fructose 1-phosphate kinase; dimer, structural gen 97.98
3kzh_A328 Probable sugar kinase; NYSGXRC, PSI-II, protein st 97.97
1vm7_A311 Ribokinase; TM0960, structural genomics, JCSG, pro 97.95
3kd6_A313 Carbohydrate kinase, PFKB family; nucleoside kinas 97.93
1tyy_A339 Putative sugar kinase; ribokinase fold, alpha/beta 97.92
2jg1_A330 Tagatose-6-phosphate kinase; phosphoryl transfer, 97.91
3hj6_A327 Fructokinase, FRK; fructose, transferase, carbohyd 97.87
2qcv_A332 Putative 5-dehydro-2-deoxygluconokinase; structura 97.83
3pl2_A319 Sugar kinase, ribokinase family; PFKB PFAM motif, 97.82
3ikh_A299 Carbohydrate kinase; transferase,kinase,SAD,ribose 97.67
2ajr_A331 Sugar kinase, PFKB family; TM0828, possible 1-phos 97.64
3h49_A325 Ribokinase; transferase,PFKB family,sugar kinase Y 97.59
2c4e_A302 Sugar kinase MJ0406; transferase, nucleoside kinas 97.57
3vas_A370 Putative adenosine kinase; ribokinase, enzyme, tra 97.57
1v1a_A309 2-keto-3-deoxygluconate kinase; ATP, structural ge 97.57
2pkf_A334 Adenosine kinase; transferase, S genomics, TB stru 97.47
1bx4_A345 Protein (adenosine kinase); human adenosine kinase 97.47
3go6_A310 Ribokinase RBSK; phosphofructokinase, carbohydrate 97.43
2abs_A383 Adenosine kinase, AK; ribokinase fold, alpha/beta, 97.3
1vk4_A298 PFKB carbohydrate kinase TM0415; structural genomi 97.28
3otx_A347 Adenosine kinase, putative; AP5A, transferase-tran 97.27
2dcn_A311 Hypothetical fructokinase; 2-keto-3-deoxygluconate 97.16
2v78_A313 Fructokinase; transferase, PFKB family carbohydrat 97.06
3b1n_A326 Ribokinase, putative; rossmann fold, ATP binding, 96.93
3loo_A365 Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad 96.93
4gm6_A351 PFKB family carbohydrate kinase; enzyme function i 96.87
3ewm_A313 Uncharacterized sugar kinase PH1459; carbohydrate 96.61
2hlz_A312 Ketohexokinase; non-protein kinase, creatine kinas 96.42
3uq6_A372 Adenosine kinase, putative; ribokinase, transferas 96.04
3bf5_A306 Ribokinase related protein; 10640157, putative rib 94.95
>3rpz_A ADP/ATP-dependent NAD(P)H-hydrate dehydratase; structural genomics, PSI-biology; HET: AMP NPW; 1.51A {Bacillus subtilis} PDB: 3rph_A* 3rq2_A* 3rq5_A* 3rq6_A* 3rq8_A* 3rqh_A* 3rqq_A* 3rqx_A* 1kyh_A Back     alignment and structure
Probab=100.00  E-value=5.1e-39  Score=271.57  Aligned_cols=168  Identities=23%  Similarity=0.268  Sum_probs=138.7

Q ss_pred             ccchhhcccceeEEEecCCchhhhhhcCCceEEecccCCCcchHHHHHHhcccCcEEEEccCCCCCHHHHHHHHHHHHHH
Q psy9483           2 GGILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISIIHKL   81 (186)
Q Consensus         2 ~~~~~r~GaGlv~v~~~~~~~~~~~~~~Pe~~v~~~~~~~~~~~~~~~~~~~~~~aivIGpGlg~~~~~~~~~~~~l~~~   81 (186)
                      +++|+|+|||+|++++|+++...++++.||+|+.+-  +  ...++..+.++++|+++||||||+++++.++++.+++  
T Consensus        50 a~aAlr~GaGlv~~~~~~~~~~~~~~~~Pe~m~~~~--~--~~~~~~~~~l~~~davviGPGlg~~~~~~~~~~~~l~--  123 (279)
T 3rpz_A           50 GLGAMRSGLGKLVIGTSENVIPLIVPVLPEATYWRD--G--WKKAADAQLEETYRAIAIGPGLPQTESVQQAVDHVLT--  123 (279)
T ss_dssp             HHHHHTTTCSEEEEEECTTTHHHHTTTCTTCEEEET--H--HHHTTTSCCSSCCSEEEECTTCCCCHHHHHHHHHHTT--
T ss_pred             HHHHHHhCCCeEEEEecHHHHHHHHhcCCeeEEccc--c--ccchhhHhhccCCCEEEECCCCCCCHHHHHHHHHHHh--
Confidence            368999999999999999999999999999999631  0  0001122356889999999999999988887776653  


Q ss_pred             HhcCCCCCEEEecccccccccCcccccccCCCeEecCCHHHHhhhcCCC--h-----HHHHH-HHHhCCCEEEEEeCCee
Q psy9483          82 KAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSGS--E-----VNAAY-IKQGHPNLTVIVKGHED  153 (186)
Q Consensus        82 ~~~~~~~p~VlDadal~~l~~~~~l~~~~~~~~iiTPh~~E~~rL~~~~--~-----~~~a~-~a~~~~~~~vvlKG~~~  153 (186)
                        .  .+|+||||||+++     +.+.....|+|||||.+||+||++.+  +     .+.++ +++++ +++|++||.+|
T Consensus       124 --~--~~p~VlDAdal~~-----~~l~~~~~~~vlTPN~~E~~~L~g~~~~~~~~d~~~aa~~la~~~-~~~VvlKG~~~  193 (279)
T 3rpz_A          124 --A--DCPVILDAGALAK-----RTYPKREGPVILTPHPGEFFRMTGVPVNELQKKRAEYAKEWAAQL-QTVIVLKGNQT  193 (279)
T ss_dssp             --S--SSCEEECGGGCCS-----CCCCCCSSCEEECCCHHHHHHHHCCCHHHHTTSHHHHHHHHHHHH-TSEEEECSTTC
T ss_pred             --h--CCCEEEECCccch-----hhhhhccCCEEEecCHHHHHHHhCCCccchHHHHHHHHHHHHHHc-CeEEEEeCCCc
Confidence              3  6899999999996     22333346799999999999999972  2     23677 99999 59999999999


Q ss_pred             EEEcCC-eEEEEcCCCCCCCCCChhHHHHhhhc
Q psy9483         154 VIKNNQ-ISLTCKEGNSWRRCGGQGDLVAGHRD  185 (186)
Q Consensus       154 ~I~~~~-~~~~~~~g~~~la~~GsGDvLaGiia  185 (186)
                      +|++++ +.|++.+|+|+|+++||||+|||+|+
T Consensus       194 vi~~~~g~~~~~~~g~~~~at~GtGD~Lag~ia  226 (279)
T 3rpz_A          194 VIAFPDGDCWLNPTGNGALAKGGTGDTLTGMIL  226 (279)
T ss_dssp             EEECTTSCEEECCCCCGGGCSTTHHHHHHHHHH
T ss_pred             EEECCCceEEEeCCCCCCCCCCChHHHHHHHHH
Confidence            999876 78999999999999999999999986
>3rss_A Putative uncharacterized protein; unknown function, ADP/ATP-dependent NAD(P)H-hydrate dehydrat lyase; HET: NAP; 1.95A {Thermotoga maritima} PDB: 3rrb_A* 2ax3_A* 3rre_A* 3rrj_A* 3rs8_A* 3rs9_A* 3rsf_A* 3rsg_A* 3rrf_A* 3rsq_A* 3rt7_A* 3rt9_A* 3rta_A* 3rtb_A* 3rtc_A* 3rtd_A* 3rte_A* 3rtg_A* 3ru2_A* 3ru3_A* Back     alignment and structure
>3k5w_A Carbohydrate kinase; 11206B,helicobacter pylori,PSI-II, NYSGXRC, , structural genomics, protein structure initiative; 2.60A {Helicobacter pylori} Back     alignment and structure
>2r3b_A YJEF-related protein; putative kinase in the ribokinase-like superfamily, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Enterococcus faecalis} PDB: 2r3e_A Back     alignment and structure
>3bgk_A SMU.573, putative uncharacterized protein; alpha/beta three layer sandwich, unknown function; 2.50A {Streptococcus mutans} Back     alignment and structure
>3hpd_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, ATP-binding, M metal-binding, nucleotide-binding, thiamine biosynthesis; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3dzv_A 4-methyl-5-(beta-hydroxyethyl)thiazole kinase; NP_816404.1, structural genomics, joint center for structural genomics, JCSG; HET: ADP; 2.57A {Enterococcus faecalis} Back     alignment and structure
>1v8a_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, structural genomics, riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} PDB: 3hpd_A Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>1ekq_A Hydroxyethylthiazole kinase; alpha-beta, transferase; 1.50A {Bacillus subtilis} SCOP: c.72.1.2 PDB: 1ekk_A 1c3q_A 1esj_A 1esq_A* Back     alignment and structure
>2i5b_A Phosphomethylpyrimidine kinase; ADP complex, PDXK, THID, ribokinase superfamily, transferase; HET: ADP; 2.80A {Bacillus subtilis} Back     alignment and structure
>3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} Back     alignment and structure
>1ub0_A THID, phosphomethylpyrimidine kinase; thiamin biosynthesis, ribokinase family, phosphorylati structural genomics; 2.05A {Thermus thermophilus} SCOP: c.72.1.2 Back     alignment and structure
>1jxh_A Phosphomethylpyrimidine kinase; THID, ribokinase family, phophorylation, transferase; 2.30A {Salmonella typhimurium} SCOP: c.72.1.2 PDB: 1jxi_A* Back     alignment and structure
>3h74_A Pyridoxal kinase; PSI-II, structural genomics, prote structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.30A {Lactobacillus plantarum} PDB: 3hyo_A* 3ibq_A* Back     alignment and structure
>3pzs_A PM kinase, pyridoxamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; HET: MSE; 1.89A {Yersinia pestis} SCOP: c.72.1.5 PDB: 1td2_A* 1vi9_A* Back     alignment and structure
>3mbh_A Putative phosphomethylpyrimidine kinase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE PXL; 2.00A {Bacteroides thetaiotaomicron} PDB: 3mbj_A* Back     alignment and structure
>2ddm_A Pyridoxine kinase; pyridoxal kinase, ribokinase, pyridoxal 5'-phosphate, vitamin B6, phosphorylation, transferase; 2.10A {Escherichia coli} PDB: 2ddo_A* 2ddw_A* Back     alignment and structure
>3zs7_A Pyridoxal kinase; transferase, sleeping sickness; HET: ATP; 2.00A {Trypanosoma brucei} Back     alignment and structure
>1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* Back     alignment and structure
>3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} Back     alignment and structure
>2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} Back     alignment and structure
>2yxt_A Pyridoxal kinase; beta sheet with alpha helix, metal ION, transferase; 2.00A {Homo sapiens} PDB: 2yxu_A* 3kbi_A* 3keu_A* 4en4_A* 4eoh_A* 2f7k_A 3fhy_A* 3fhx_A* 2ajp_A* 1lhp_A 1lhr_A* 1rft_A* 1rfu_A* 1rfv_A* 1ygj_A* 1ygk_A* 1yhj_A* Back     alignment and structure
>4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* Back     alignment and structure
>2jg5_A Fructose 1-phosphate kinase; 1-phosphofructokinase, transferase; 2.3A {Staphylococcus aureus} Back     alignment and structure
>4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} Back     alignment and structure
>2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 Back     alignment and structure
>3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} Back     alignment and structure
>3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} SCOP: c.72.1.0 PDB: 3k9e_A Back     alignment and structure
>3ie7_A LIN2199 protein; phosphofructokinases, transferase, glycero ION, PSI-II, NYSGXRC, kinase, structural genomics, structure initiative; HET: ATP; 1.60A {Listeria innocua} PDB: 3hic_A* 3jul_A* 3q1y_A Back     alignment and structure
>2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>4e84_A D-beta-D-heptose 7-phosphate kinase; LPS-heptose biosynthesis, beta-clAsp dimerization region, PF carbohydrate kinase, phosphorylation; HET: MSE ANP M7B GMZ; 2.60A {Burkholderia cenocepacia} PDB: 4e8w_A* 4e8y_A* 4e8z_A* Back     alignment and structure
>3umo_A 6-phosphofructokinase isozyme 2; glycolysis, transferase, PFK, enzyme; HET: ATP; 1.70A {Escherichia coli} PDB: 3n1c_A* 3cqd_A* 3ump_A* 3uqd_A* 3uqe_A* Back     alignment and structure
>2f02_A Tagatose-6-phosphate kinase; LACC, structural genomics, PSI, protein structure initiative YORK SGX research center for structural genomics; HET: ATP; 1.90A {Enterococcus faecalis} SCOP: c.72.1.1 PDB: 2awd_A* Back     alignment and structure
>4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* Back     alignment and structure
>3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} SCOP: c.72.1.0 PDB: 3lki_A* Back     alignment and structure
>3cqd_A 6-phosphofructokinase isozyme 2; phosphofructokinases, PFK-2, glycolysis, transferase; HET: ATP; 1.98A {Escherichia coli} PDB: 3n1c_A* Back     alignment and structure
>2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Back     alignment and structure
>2abq_A Fructose 1-phosphate kinase; dimer, structural genomics, PSI, protein structure initiative; 2.10A {Bacillus halodurans} SCOP: c.72.1.1 Back     alignment and structure
>3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Back     alignment and structure
>1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Back     alignment and structure
>1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* Back     alignment and structure
>2jg1_A Tagatose-6-phosphate kinase; phosphoryl transfer, conformational changes, transferase, lactose metabolism; HET: MSE ANP TA6; 2.00A {Staphylococcus aureus} PDB: 2jgv_A* 2q5r_A* Back     alignment and structure
>3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} Back     alignment and structure
>2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} SCOP: c.72.1.0 Back     alignment and structure
>3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* Back     alignment and structure
>2ajr_A Sugar kinase, PFKB family; TM0828, possible 1-phosphofructokinase (EC 2.7.1.56), struct genomics, joint center for structural genomics, JCSG; HET: MSE; 2.46A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Back     alignment and structure
>2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Back     alignment and structure
>3vas_A Putative adenosine kinase; ribokinase, enzyme, transferase; HET: ADN; 2.26A {Schistosoma mansoni} PDB: 4dc3_A* 3vaq_A* 3uq6_A* 3uq9_A* Back     alignment and structure
>1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Back     alignment and structure
>2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* Back     alignment and structure
>1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* Back     alignment and structure
>3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* Back     alignment and structure
>2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* Back     alignment and structure
>1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* Back     alignment and structure
>2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* Back     alignment and structure
>2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* Back     alignment and structure
>3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* Back     alignment and structure
>3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} Back     alignment and structure
>4gm6_A PFKB family carbohydrate kinase; enzyme function initiative, transferase; 2.00A {Listeria grayi dsm 20601} Back     alignment and structure
>3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* Back     alignment and structure
>2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A Back     alignment and structure
>3uq6_A Adenosine kinase, putative; ribokinase, transferase; HET: ADN AMP; 2.30A {Schistosoma mansoni} PDB: 3uq9_A* Back     alignment and structure
>3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 186
d1ekqa_269 c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kin 3e-08
d1v8aa_264 c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kin 6e-08
>d1ekqa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis [TaxId: 1423]} Length = 269 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: Thiamin biosynthesis kinases
domain: Hydroxyethylthiazole kinase (THZ kinase, ThiK)
species: Bacillus subtilis [TaxId: 1423]

 Score = 49.6 bits (118), Expect = 3e-08
 Identities = 30/196 (15%), Positives = 62/196 (31%), Gaps = 45/196 (22%)

Query: 7   CATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDRNDSVDHIMYWMNRMHSVLIGPGLGT 66
            A   L++     GA P++     E+  +                     ++++  G  +
Sbjct: 32  TANGLLAL-----GASPVMAYAKEEVADMA----------------KIAGALVLNIGTLS 70

Query: 67  EPLVQSNVISIIHKLKAAN-LNVPLVIDADGLKLVAEHPGLIQDYRG---PVYLTPNKRE 122
           +     +V ++I   K+AN   VP+++D  G           +D         +  N  E
Sbjct: 71  KE----SVEAMIIAGKSANEHGVPVILDPVGAGATPFRTESARDIIREVRLAAIRGNAAE 126

Query: 123 YENLLSGSE---------------VNAAYIKQGHPNLTVIVKGHEDVIKNNQISLTCKEG 167
             + +  ++               +  A       N  + + G  DVI +     T   G
Sbjct: 127 IAHTVGVTDWLIKGVDAGEGGGDIIRLAQQAAQKLNTVIAITGEVDVIADTSHVYTLHNG 186

Query: 168 NSW-RRCGGQGDLVAG 182
           +    +  G G L+  
Sbjct: 187 HKLLTKVTGAGCLLTS 202
>d1v8aa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d2ax3a1278 Hypothetical protein TM0922, C-terminal domain {Th 100.0
d1kyha_275 Hypothetical protein YxkO {Bacillus subtilis [TaxI 100.0
d1ekqa_269 Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Ba 99.96
d1v8aa_264 Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Ar 99.95
d1jxha_266 4-amino-5-hydroxymethyl-2-methylpyrimidine phospha 99.35
d1ub0a_258 4-amino-5-hydroxymethyl-2-methylpyrimidine phospha 99.29
d1vi9a_288 Pyridoxamine kinase {Escherichia coli [TaxId: 562] 99.1
d1lhpa_309 Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940] 99.06
d2ajra1319 Putative sugar kinase TM0828 {Thermotoga maritima 97.74
d2f02a1313 Tagatose-6-phosphate kinase LacC {Enterococcus fae 97.09
d2abqa1306 Fructose 1-phosphate kinase FruB {Bacillus halodur 96.81
d1vk4a_288 Hypothetical protein TM0415 {Thermotoga maritima [ 95.46
d2afba1333 2-keto-3-deoxygluconate kinase {Thermotoga maritim 93.11
d1rkda_306 Ribokinase {Escherichia coli [TaxId: 562]} 89.1
d1v19a_302 2-keto-3-deoxygluconate kinase {Thermus thermophil 83.18
>d2ax3a1 c.72.1.4 (A:212-489) Hypothetical protein TM0922, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: YjeF C-terminal domain-like
domain: Hypothetical protein TM0922, C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

Probab=100.00  E-value=6.1e-42  Score=287.08  Aligned_cols=175  Identities=22%  Similarity=0.326  Sum_probs=150.7

Q ss_pred             cchhhcccceeEEEecCCchhhhhhcCCceEEecccCCC----cchHHHHHHhcccCcEEEEccCCCCCHHHHHHHHHHH
Q psy9483           3 GILQCATVTLSIYVCSEGAVPILKNYSPELIVLPHYLDR----NDSVDHIMYWMNRMHSVLIGPGLGTEPLVQSNVISII   78 (186)
Q Consensus         3 ~~~~r~GaGlv~v~~~~~~~~~~~~~~Pe~~v~~~~~~~----~~~~~~~~~~~~~~~aivIGpGlg~~~~~~~~~~~~l   78 (186)
                      ++|+|+|||+|++++|++....+..+.||+|+.++..+.    ...++++.++.+++|+++||||+++++++..++.+++
T Consensus        42 ~aAlr~GaGlv~v~~~~~~~~~~~~~~Pe~i~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~iGpGlg~~~~~~~~~~~~~  121 (278)
T d2ax3a1          42 MGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGNNEHVREFVNEFL  121 (278)
T ss_dssp             HHHHHTTCSEEEEEEETTTTHHHHHHCTTSEEEEECCSSSSCCGGGHHHHHHHHHTCSEEEECTTCCCSHHHHHHHHHHH
T ss_pred             HHHHHHCCCEEEEEechhhHHHHHhcCCceEEeeeecccccccHHHHHHHHHhcccCCEEEecCCcccchHHHHHHHHHH
Confidence            689999999999999999999999999999999873221    2356777778889999999999999998888887777


Q ss_pred             HHHHhcCCCCCEEEecccccccccCcccccccCCCeEecCCHHHHhhhcCC--Ch----HHHHH-HHHhCCCEEEEEeCC
Q psy9483          79 HKLKAANLNVPLVIDADGLKLVAEHPGLIQDYRGPVYLTPNKREYENLLSG--SE----VNAAY-IKQGHPNLTVIVKGH  151 (186)
Q Consensus        79 ~~~~~~~~~~p~VlDadal~~l~~~~~l~~~~~~~~iiTPh~~E~~rL~~~--~~----~~~a~-~a~~~~~~~vvlKG~  151 (186)
                      ..   .  +.|+|+||||++++..+  ++..++.++|||||.+||+||++.  ++    .+.++ +++++ +++||+||.
T Consensus       122 ~~---~--~~~~vldadal~~~~~~--~l~~~~~~~IlTPH~gE~~rL~~~~~~~~~~~~~~a~~~a~~~-~~~vvlKG~  193 (278)
T d2ax3a1         122 KT---L--EKPAVIDADAINVLDTS--VLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKEN-DCVLVLKSA  193 (278)
T ss_dssp             HH---C--CSCEEECHHHHHTCCHH--HHHTCSSCEEECCCHHHHHHHHTCCHHHHTTCHHHHHHHHHHH-TSEEEECSS
T ss_pred             hc---c--chheecchhhhhhhhhh--hhhhcCCCEEeCCCHhHHHHHhhcccchhhhHHHHHHHHHHHc-CCcEEecCc
Confidence            54   4  79999999999987654  344455679999999999999997  22    24777 99999 699999999


Q ss_pred             eeEEEcCCeEEEEcCCCCCCCCCChhHHHHhhhc
Q psy9483         152 EDVIKNNQISLTCKEGNSWRRCGGQGDLVAGHRD  185 (186)
Q Consensus       152 ~~~I~~~~~~~~~~~g~~~la~~GsGDvLaGiia  185 (186)
                      +|+|++++++|+|.+|+|+|+++||||||||+||
T Consensus       194 ~t~i~~~~~~~~~~~g~~~la~~GtGDvLaGiIa  227 (278)
T d2ax3a1         194 TTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIA  227 (278)
T ss_dssp             SEEEECSSCEEEECCCC-CCSSTTHHHHHHHHHH
T ss_pred             cccccCcccceeecCCCCccccccchhHHHHHHH
Confidence            9999999999999999999999999999999997
>d1kyha_ c.72.1.4 (A:) Hypothetical protein YxkO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ekqa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v8aa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jxha_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ub0a_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vi9a_ c.72.1.5 (A:) Pyridoxamine kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lhpa_ c.72.1.5 (A:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure