Psyllid ID: psy9494


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MTWVFYHRAMLRLVSSVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTKLFDDFREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLGQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSMLADRATVLSECETCREEWMSERKHYIGISFELKFLQKKKKAKNGHLVHRPFPICKILENSHIPSQEL
ccHHHHHHHHHHccccEEEEEEccEEEEEEccccccccccHHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHccccHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccEEEEEccccccccEEEccccccccccccHHHHHccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHccccccHHHHHHcccccEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccc
cccEEEEHHHHHcHcEEEEEEcccEEEEEEccHHHHHHccHHHHHHHHHHHHHHHcccccEEEEEEccccEEEccccHHHHcccccHHHcHHHHHHHHHHccccEEEEEEcEEcccHHHHHHHHHEEEEHccccccccccEEccccccHccccEEEEEEEcccHHcHcHHHcccEEEEEEcccccHHHHHHHHHcHHHHHHHHHHccHccHHHHHHcccccEEccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHEHcccccccccc
MTWVFYHRAMLRLVSSVCTKKILNITLIslnrpdkinaiNLKTLDALQENIKrfeddtesplailygqegnfcsgfdlheldenpdtklFDDFREFLqkpakkpiIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALhvprtqlkhslrdnlsrdlaiptcdVTIRRLGqmigtsrtMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSMLADRATVLSECETCREEWMSERKHYIGISFELKFLQKKkkaknghlvhrpfpickilenshipsqel
MTWVFYHRAMLRLVSSVCTKKILNItlislnrpdkinAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTKLFDDFREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVprtqlkhslrdnlsrdlaiptcdvtirrlgqmigtsrtmDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSMLADRATVLSECETCREEWMSERKHYIGISFELKFLQKKKKAKnghlvhrpfpickilenshipsqel
MTWVFYHRAMLRLVSSVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTKLFDDFREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLGQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSMLADRATVLSECETCREEWMSERKHYIGISFELKFLQkkkkakNGHLVHRPFPICKILENSHIPSQEL
**WVFYHRAMLRLVSSVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTKLFDDFREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLGQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSMLADRATVLSECETCREEWMSERKHYIGISFELKFLQKKKKAKNGHLVHRPFPICKILE*********
********AMLRLVSSVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTKLFDDFREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLGQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSMLADRATVLSECETCREEWMSERKHYIGISFELKFLQKKKKAKN*HLVHRPFPICKILEN********
MTWVFYHRAMLRLVSSVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTKLFDDFREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLGQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSMLADRATVLSECETCREEWMSERKHYIGISFELKFLQKKKKAKNGHLVHRPFPICKILENSHIPSQEL
*TWVFYHRAMLRLVSSVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTKLFDDFREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLGQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSMLADRATVLSECETCREEWMSERKHYIGISFELKFLQKKKKAKNGHLVHRPFPICKILEN********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTWVFYHRAMLRLVSSVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTKLFDDFREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLGQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSMLADRATVLSECETCREEWMSERKHYIGISFELKFLQKKKKAKNGHLVHRPFPICKILENSHIPSQEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query314 2.2.26 [Sep-21-2011]
A4YI89259 3-hydroxypropionyl-coenzy yes N/A 0.630 0.764 0.301 8e-19
Q1ZXF1277 Probable enoyl-CoA hydrat no N/A 0.617 0.700 0.289 1e-16
O07137257 Probable enoyl-CoA hydrat yes N/A 0.675 0.824 0.264 4e-14
O34893260 Putative enoyl-CoA hydrat yes N/A 0.522 0.630 0.312 4e-14
P14604290 Enoyl-CoA hydratase, mito yes N/A 0.592 0.641 0.278 6e-14
P30084290 Enoyl-CoA hydratase, mito yes N/A 0.576 0.624 0.264 9e-14
Q58DM8290 Enoyl-CoA hydratase, mito yes N/A 0.601 0.651 0.278 9e-14
P34559288 Probable enoyl-CoA hydrat no N/A 0.550 0.600 0.263 2e-13
P64014243 Probable enoyl-CoA hydrat no N/A 0.649 0.839 0.258 2e-13
P64015243 Probable enoyl-CoA hydrat no N/A 0.649 0.839 0.258 2e-13
>sp|A4YI89|HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2001 PE=1 SV=1 Back     alignment and function desciption
 Score = 94.7 bits (234), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 109/239 (45%), Gaps = 41/239 (17%)

Query: 16  SVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSG 75
           ++ TKK  N+  I+LNRPDK+NA+N K L+ L   + + E D E  + I+ G+   FC+G
Sbjct: 5   TIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCAG 64

Query: 76  FDLHELDE-NPDT--KLFDDFREFLQK--PAKKPIIAAITGYAVGQGLDLALWCDLRFVE 130
            D+ + ++  P    K     RE + K     KP IA I GYA+G GL+LAL CD+R   
Sbjct: 65  ADITQFNQLTPAEAWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAA 124

Query: 131 ENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRL 190
           E   +G                         P              +L I       +RL
Sbjct: 125 EEAQLGL------------------------PEI------------NLGIYPGYGGTQRL 148

Query: 191 GQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSMLA 249
            ++IG  R ++M+  G  I  ++A  +GL N++V       E    A +++K S   LA
Sbjct: 149 TRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQETRKLAEKIAKKSPISLA 207




Plays a role in autotrophic carbon fixation via the 3-hydroxypropionate/4-hydroxybutyrate cycle. Catalyzes the reversible dehydration of 3-hydroxypropionyl-CoA to form acryloyl-CoA, and the reversible dehydration of (S)-3-hydroxybutyryl-CoA to form crotonyl-CoA. Inactive towards (R)-3-hydroxybutyryl-CoA.
Metallosphaera sedula (strain ATCC 51363 / DSM 5348) (taxid: 399549)
EC: 4EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 1EC: 6
>sp|Q1ZXF1|ECHM_DICDI Probable enoyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=echs1 PE=3 SV=1 Back     alignment and function description
>sp|O07137|ECHA8_MYCLE Probable enoyl-CoA hydratase echA8 OS=Mycobacterium leprae (strain TN) GN=echA8 PE=3 SV=1 Back     alignment and function description
>sp|O34893|YNGF_BACSU Putative enoyl-CoA hydratase/isomerase YngF OS=Bacillus subtilis (strain 168) GN=yngF PE=3 SV=1 Back     alignment and function description
>sp|P14604|ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus GN=Echs1 PE=1 SV=1 Back     alignment and function description
>sp|P30084|ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=ECHS1 PE=1 SV=4 Back     alignment and function description
>sp|Q58DM8|ECHM_BOVIN Enoyl-CoA hydratase, mitochondrial OS=Bos taurus GN=ECHS1 PE=2 SV=1 Back     alignment and function description
>sp|P34559|ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans GN=ech-6 PE=1 SV=1 Back     alignment and function description
>sp|P64014|ECHA6_MYCTU Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis GN=echA6 PE=1 SV=1 Back     alignment and function description
>sp|P64015|ECHA6_MYCBO Probable enoyl-CoA hydratase echA6 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA6 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query314
328697051248 PREDICTED: probable enoyl-CoA hydratase- 0.636 0.806 0.378 1e-38
427795379308 Putative enoyl-coa hydratase, partial [R 0.719 0.733 0.393 7e-38
91076844291 PREDICTED: similar to enoyl-CoA hydratas 0.621 0.670 0.383 2e-37
322783006269 hypothetical protein SINV_01098 [Solenop 0.643 0.750 0.371 1e-36
427795433278 Putative enoyl-coa hydratase, partial [R 0.624 0.705 0.376 1e-35
332028295267 Carnitinyl-CoA dehydratase [Acromyrmex e 0.614 0.722 0.385 4e-35
307209931312 Carnitinyl-CoA dehydratase [Harpegnathos 0.646 0.650 0.348 1e-34
391338306267 PREDICTED: 3-hydroxypropionyl-coenzyme A 0.643 0.756 0.365 1e-34
195112666386 GI10483 [Drosophila mojavensis] gi|19391 0.643 0.523 0.373 3e-34
195453919390 GK14405 [Drosophila willistoni] gi|19417 0.643 0.517 0.361 4e-34
>gi|328697051|ref|XP_001943800.2| PREDICTED: probable enoyl-CoA hydratase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  166 bits (421), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 92/243 (37%), Positives = 137/243 (56%), Gaps = 43/243 (17%)

Query: 13  LVSSVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNF 72
           + S+V T K  +ITLISLNRPD  N +N+ TLD L++ I  FE+D  S +A+LYG+ G+F
Sbjct: 42  IYSNVKTFKHQHITLISLNRPDDKNTLNVATLDDLRKAISNFENDPSSTIAVLYGEGGSF 101

Query: 73  CSGFDLHELDENPDTKLFDDFREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEEN 132
           C+G+D  EL +   ++++DD   F +   +KPIIAA++G+    G DL LWCDLR VEEN
Sbjct: 102 CAGYDPGELSK--ASQVYDD---FFKSHCQKPIIAAVSGFTYNVGFDLCLWCDLRIVEEN 156

Query: 133 VLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLGQ 192
            +M                                      + R L I    + ++RL +
Sbjct: 157 AVMA-------------------------------------IDRKLNISNSKIFLKRLLK 179

Query: 193 MIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQ-SMLADR 251
            +G SRTMD++  GR I ++EA + GL N++V CG++VG+A+  A  + K  Q SM  DR
Sbjct: 180 TVGYSRTMDLLLTGRDIKSKEAFECGLANRVVACGSSVGQAVNMAFNVGKFPQESMNYDR 239

Query: 252 ATV 254
           + +
Sbjct: 240 SVI 242




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|427795379|gb|JAA63141.1| Putative enoyl-coa hydratase, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|91076844|ref|XP_974775.1| PREDICTED: similar to enoyl-CoA hydratase, mitochondrial [Tribolium castaneum] gi|270001819|gb|EEZ98266.1| hypothetical protein TcasGA2_TC000708 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|322783006|gb|EFZ10718.1| hypothetical protein SINV_01098 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|427795433|gb|JAA63168.1| Putative enoyl-coa hydratase, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|332028295|gb|EGI68342.1| Carnitinyl-CoA dehydratase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307209931|gb|EFN86709.1| Carnitinyl-CoA dehydratase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|391338306|ref|XP_003743500.1| PREDICTED: 3-hydroxypropionyl-coenzyme A dehydratase-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|195112666|ref|XP_002000893.1| GI10483 [Drosophila mojavensis] gi|193917487|gb|EDW16354.1| GI10483 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195453919|ref|XP_002074002.1| GK14405 [Drosophila willistoni] gi|194170087|gb|EDW84988.1| GK14405 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query314
FB|FBgn0039531326 CG5611 [Drosophila melanogaste 0.420 0.404 0.388 1.3e-32
UNIPROTKB|Q7D9G0263 echA5 "Enoyl-coA hydratase/iso 0.372 0.444 0.393 3.7e-29
WB|WBGene00001152258 ech-3 [Caenorhabditis elegans 0.372 0.453 0.357 1.4e-27
DICTYBASE|DDB_G0276151271 DDB_G0276151 "enoyl-CoA hydrat 0.378 0.439 0.370 8.3e-26
UNIPROTKB|A4YI89259 Msed_2001 "3-hydroxypropionyl- 0.375 0.455 0.406 1e-23
FB|FBgn0038049378 CG5844 [Drosophila melanogaste 0.404 0.335 0.425 1.8e-23
ASPGD|ASPL0000052820296 AN0180 [Emericella nidulans (t 0.229 0.243 0.402 2.4e-23
ZFIN|ZDB-GENE-041010-72309 zgc:101569 "zgc:101569" [Danio 0.375 0.381 0.432 1.3e-20
DICTYBASE|DDB_G0285071277 echs1 "enoyl-CoA hydratase" [D 0.372 0.422 0.336 1.2e-17
UNIPROTKB|F1SAC1289 ECHS1 "Uncharacterized protein 0.366 0.397 0.325 2e-17
FB|FBgn0039531 CG5611 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 248 (92.4 bits), Expect = 1.3e-32, Sum P(2) = 1.3e-32
 Identities = 54/139 (38%), Positives = 82/139 (58%)

Query:    16 SVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSG 75
             +V  +K  +ITLI LNR  + N+I+  T + L E I +FE D  SP+ +LYG  G+FC+G
Sbjct:    42 TVLVEKDSHITLIGLNREQQRNSIDANTAEQLTEAISQFEADDTSPVGVLYGIGGSFCAG 101

Query:    76 FDLHELDENPDTKLFDDFREF------LQKPAKKPIIAAITGYAVGQGLDLALWCDLRFV 129
             +DL EL+        +            ++  +KP++  I+G+ V  GL+LAL CDLR +
Sbjct:   102 YDLEELEAEAQRGSLNFLLRHEGSVGPTRRHLRKPLVCGISGFCVAGGLELALMCDLRVM 161

Query:   130 EENVLMGFYNRRF-VYLKD 147
             E+  ++GF+NRR  V L D
Sbjct:   162 EDTAVLGFFNRRLGVPLSD 180


GO:0008416 "delta5-delta2,4-dienoyl-CoA isomerase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
UNIPROTKB|Q7D9G0 echA5 "Enoyl-coA hydratase/isomerase family protein" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
WB|WBGene00001152 ech-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276151 DDB_G0276151 "enoyl-CoA hydratase/isomerase family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|A4YI89 Msed_2001 "3-hydroxypropionyl-coenzyme A dehydratase" [Metallosphaera sedula DSM 5348 (taxid:399549)] Back     alignment and assigned GO terms
FB|FBgn0038049 CG5844 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000052820 AN0180 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-72 zgc:101569 "zgc:101569" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285071 echs1 "enoyl-CoA hydratase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAC1 ECHS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4YI89HPCD_METS54, ., 2, ., 1, ., 1, 1, 60.30120.63050.7644yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
PRK08259254 PRK08259, PRK08259, enoyl-CoA hydratase; Provision 1e-48
cd06558195 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme 4e-39
COG1024257 COG1024, CaiD, Enoyl-CoA hydratase/carnithine race 1e-36
pfam00378245 pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami 5e-28
PRK06688259 PRK06688, PRK06688, enoyl-CoA hydratase; Provision 4e-26
PRK06494259 PRK06494, PRK06494, enoyl-CoA hydratase; Provision 3e-23
PRK08252254 PRK08252, PRK08252, enoyl-CoA hydratase; Provision 8e-22
PRK06190258 PRK06190, PRK06190, enoyl-CoA hydratase; Provision 1e-20
PRK03580261 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Pr 2e-20
PRK07657260 PRK07657, PRK07657, enoyl-CoA hydratase; Provision 2e-19
PLN02600251 PLN02600, PLN02600, enoyl-CoA hydratase 4e-18
PRK07658257 PRK07658, PRK07658, enoyl-CoA hydratase; Provision 6e-18
PRK08150255 PRK08150, PRK08150, enoyl-CoA hydratase; Provision 1e-17
PRK07799263 PRK07799, PRK07799, enoyl-CoA hydratase; Provision 5e-17
PRK07854243 PRK07854, PRK07854, enoyl-CoA hydratase; Provision 4e-16
PRK09674255 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; 5e-16
PRK05809260 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata 5e-16
PRK05862257 PRK05862, PRK05862, enoyl-CoA hydratase; Provision 1e-15
PRK06072248 PRK06072, PRK06072, enoyl-CoA hydratase; Provision 3e-15
PRK07509262 PRK07509, PRK07509, enoyl-CoA hydratase; Provision 4e-15
TIGR02280256 TIGR02280, PaaB1, phenylacetate degradation probab 6e-15
PRK08258277 PRK08258, PRK08258, enoyl-CoA hydratase; Provision 1e-14
PRK09245266 PRK09245, PRK09245, enoyl-CoA hydratase; Provision 1e-14
PLN02888265 PLN02888, PLN02888, enoyl-CoA hydratase 3e-14
PRK06563255 PRK06563, PRK06563, enoyl-CoA hydratase; Provision 3e-14
PRK05870249 PRK05870, PRK05870, enoyl-CoA hydratase; Provision 3e-14
PRK06127269 PRK06127, PRK06127, enoyl-CoA hydratase; Provision 5e-14
PRK05980260 PRK05980, PRK05980, enoyl-CoA hydratase; Provision 6e-14
PRK06142272 PRK06142, PRK06142, enoyl-CoA hydratase; Provision 6e-14
PRK08138261 PRK08138, PRK08138, enoyl-CoA hydratase; Provision 1e-13
PLN02664275 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-d 2e-13
PRK06210272 PRK06210, PRK06210, enoyl-CoA hydratase; Provision 3e-13
PRK05981266 PRK05981, PRK05981, enoyl-CoA hydratase; Provision 2e-12
PRK05869222 PRK05869, PRK05869, enoyl-CoA hydratase; Validated 3e-12
PRK08140262 PRK08140, PRK08140, enoyl-CoA hydratase; Provision 7e-12
PRK08139266 PRK08139, PRK08139, enoyl-CoA hydratase; Validated 2e-11
PRK08272302 PRK08272, PRK08272, enoyl-CoA hydratase; Provision 5e-11
PRK05864276 PRK05864, PRK05864, enoyl-CoA hydratase; Provision 6e-11
PRK07511260 PRK07511, PRK07511, enoyl-CoA hydratase; Provision 1e-10
PRK06144262 PRK06144, PRK06144, enoyl-CoA hydratase; Provision 3e-10
PRK08260296 PRK08260, PRK08260, enoyl-CoA hydratase; Provision 1e-09
PRK09076258 PRK09076, PRK09076, enoyl-CoA hydratase; Provision 3e-09
PRK06495257 PRK06495, PRK06495, enoyl-CoA hydratase; Provision 4e-09
TIGR03210256 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hyd 7e-09
PRK07659260 PRK07659, PRK07659, enoyl-CoA hydratase; Provision 1e-08
PRK06213229 PRK06213, PRK06213, enoyl-CoA hydratase; Provision 2e-08
PRK12478298 PRK12478, PRK12478, enoyl-CoA hydratase; Provision 2e-08
PRK06023251 PRK06023, PRK06023, enoyl-CoA hydratase; Provision 3e-08
PLN02921327 PLN02921, PLN02921, naphthoate synthase 4e-08
PRK07396273 PRK07396, PRK07396, dihydroxynaphthoic acid synthe 7e-08
TIGR02441 737 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c 1e-07
TIGR02440 699 TIGR02440, FadJ, fatty oxidation complex, alpha su 1e-07
PRK08290288 PRK08290, PRK08290, enoyl-CoA hydratase; Provision 2e-07
PRK07468262 PRK07468, PRK07468, enoyl-CoA hydratase; Provision 2e-07
PRK06143256 PRK06143, PRK06143, enoyl-CoA hydratase; Provision 3e-07
TIGR01929259 TIGR01929, menB, naphthoate synthase (dihydroxynap 6e-07
COG0447282 COG0447, MenB, Dihydroxynaphthoic acid synthase [C 6e-07
PRK05995262 PRK05995, PRK05995, enoyl-CoA hydratase; Provision 6e-07
TIGR02437 714 TIGR02437, FadB, fatty oxidation complex, alpha su 1e-06
PRK11423261 PRK11423, PRK11423, methylmalonyl-CoA decarboxylas 2e-06
PRK05617342 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrol 2e-06
PRK11154 708 PRK11154, fadJ, multifunctional fatty acid oxidati 3e-06
PRK07112255 PRK07112, PRK07112, polyketide biosynthesis enoyl- 4e-06
PRK07327268 PRK07327, PRK07327, enoyl-CoA hydratase; Provision 5e-06
PRK05674265 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydr 7e-06
PLN02988381 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrol 3e-05
PLN02874379 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrol 6e-05
PRK07938249 PRK07938, PRK07938, enoyl-CoA hydratase; Provision 7e-05
PRK09120275 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydrata 1e-04
PRK11730 715 PRK11730, fadB, multifunctional fatty acid oxidati 1e-04
PRK07827260 PRK07827, PRK07827, enoyl-CoA hydratase; Provision 1e-04
PRK07110249 PRK07110, PRK07110, polyketide biosynthesis enoyl- 7e-04
PLN02851407 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrol 0.003
>gnl|CDD|236205 PRK08259, PRK08259, enoyl-CoA hydratase; Provisional Back     alignment and domain information
 Score =  162 bits (413), Expect = 1e-48
 Identities = 81/260 (31%), Positives = 120/260 (46%), Gaps = 65/260 (25%)

Query: 25  ITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDL------ 78
           +T + LNRP+  NA++  T  AL +  + F+ D  + +A+L+G  G FC+G DL      
Sbjct: 13  VTTVILNRPEVRNAVDGPTAAALADAFRAFDADDAASVAVLWGAGGTFCAGADLKAVGTG 72

Query: 79  --HELDENPD-----TKLFDDFREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEE 131
             + L  + D     +++             KP+IAA++GYAV  GL+LALWCDLR  EE
Sbjct: 73  RGNRLHPSGDGPMGPSRMR----------LSKPVIAAVSGYAVAGGLELALWCDLRVAEE 122

Query: 132 NVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLG 191
           + + G + RR+          GV                          P  D    RL 
Sbjct: 123 DAVFGVFCRRW----------GV--------------------------PLIDGGTVRLP 146

Query: 192 QMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQS-MLAD 250
           ++IG SR MD+I  GR + A EAL  GL N++V  G A   A   A +++   Q+ + AD
Sbjct: 147 RLIGHSRAMDLILTGRPVDADEALAIGLANRVVPKGQARAAAEELAAELAAFPQTCLRAD 206

Query: 251 RATV-----LSECETCREEW 265
           R +      L E      E+
Sbjct: 207 RLSALEQWGLPEEAALANEF 226


Length = 254

>gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181325 PRK08252, PRK08252, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|179599 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|178210 PLN02600, PLN02600, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181254 PRK08150, PRK08150, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181122 PRK07799, PRK07799, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236115 PRK07854, PRK07854, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|182026 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>gnl|CDD|180295 PRK05862, PRK05862, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168377 PRK06072, PRK06072, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181008 PRK07509, PRK07509, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>gnl|CDD|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|215480 PLN02888, PLN02888, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|180625 PRK06563, PRK06563, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180298 PRK05870, PRK05870, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235714 PRK06142, PRK06142, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|178269 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>gnl|CDD|180472 PRK06210, PRK06210, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235661 PRK05981, PRK05981, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235632 PRK05869, PRK05869, enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|236163 PRK08140, PRK08140, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181249 PRK08139, PRK08139, enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|236213 PRK08272, PRK08272, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168278 PRK05864, PRK05864, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181009 PRK07511, PRK07511, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180424 PRK06144, PRK06144, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236206 PRK08260, PRK08260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236373 PRK09076, PRK09076, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168580 PRK06495, PRK06495, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|132254 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|236073 PRK07659, PRK07659, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235744 PRK06213, PRK06213, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|183548 PRK12478, PRK12478, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168351 PRK06023, PRK06023, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|178509 PLN02921, PLN02921, naphthoate synthase Back     alignment and domain information
>gnl|CDD|180958 PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>gnl|CDD|131493 TIGR02440, FadJ, fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>gnl|CDD|236220 PRK08290, PRK08290, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180987 PRK07468, PRK07468, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180423 PRK06143, PRK06143, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|200143 TIGR01929, menB, naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>gnl|CDD|223524 COG0447, MenB, Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|236908 PRK11423, PRK11423, methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|235533 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|236864 PRK11154, fadJ, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|235938 PRK07112, PRK07112, polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|235991 PRK07327, PRK07327, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168168 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|178568 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|178462 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>gnl|CDD|181174 PRK07938, PRK07938, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236383 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|236109 PRK07827, PRK07827, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235936 PRK07110, PRK07110, polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|178443 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 314
KOG1680|consensus290 100.0
PRK05862257 enoyl-CoA hydratase; Provisional 100.0
PRK08252254 enoyl-CoA hydratase; Provisional 100.0
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 100.0
PRK06563255 enoyl-CoA hydratase; Provisional 100.0
PRK06494259 enoyl-CoA hydratase; Provisional 100.0
PRK09245266 enoyl-CoA hydratase; Provisional 100.0
PRK08140262 enoyl-CoA hydratase; Provisional 100.0
PRK07799263 enoyl-CoA hydratase; Provisional 100.0
PRK06142272 enoyl-CoA hydratase; Provisional 100.0
PRK09076258 enoyl-CoA hydratase; Provisional 100.0
PRK07658257 enoyl-CoA hydratase; Provisional 100.0
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 100.0
PRK08258277 enoyl-CoA hydratase; Provisional 100.0
PRK05995262 enoyl-CoA hydratase; Provisional 100.0
PRK05980260 enoyl-CoA hydratase; Provisional 100.0
PRK08139266 enoyl-CoA hydratase; Validated 100.0
PRK08150255 enoyl-CoA hydratase; Provisional 100.0
PRK06144262 enoyl-CoA hydratase; Provisional 100.0
PRK08138261 enoyl-CoA hydratase; Provisional 100.0
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 100.0
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 100.0
PRK05981266 enoyl-CoA hydratase; Provisional 100.0
PRK06127269 enoyl-CoA hydratase; Provisional 100.0
PLN02600251 enoyl-CoA hydratase 100.0
PRK07657260 enoyl-CoA hydratase; Provisional 100.0
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 100.0
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 100.0
PRK07327268 enoyl-CoA hydratase; Provisional 100.0
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 100.0
PRK06210272 enoyl-CoA hydratase; Provisional 100.0
PRK06495257 enoyl-CoA hydratase; Provisional 100.0
PRK06688259 enoyl-CoA hydratase; Provisional 100.0
PRK07659260 enoyl-CoA hydratase; Provisional 100.0
PRK07511260 enoyl-CoA hydratase; Provisional 100.0
PRK05864276 enoyl-CoA hydratase; Provisional 100.0
PRK08260296 enoyl-CoA hydratase; Provisional 100.0
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 100.0
PRK03580261 carnitinyl-CoA dehydratase; Provisional 100.0
PLN02888265 enoyl-CoA hydratase 100.0
PRK08259254 enoyl-CoA hydratase; Provisional 100.0
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 100.0
PRK07468262 enoyl-CoA hydratase; Provisional 100.0
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 100.0
PRK06143256 enoyl-CoA hydratase; Provisional 100.0
PRK06072248 enoyl-CoA hydratase; Provisional 100.0
PRK07509262 enoyl-CoA hydratase; Provisional 100.0
PLN02921327 naphthoate synthase 100.0
PRK07260255 enoyl-CoA hydratase; Provisional 100.0
PRK12478298 enoyl-CoA hydratase; Provisional 100.0
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 100.0
PRK06190258 enoyl-CoA hydratase; Provisional 100.0
PRK06023251 enoyl-CoA hydratase; Provisional 100.0
PRK07854243 enoyl-CoA hydratase; Provisional 100.0
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 100.0
PRK08321302 naphthoate synthase; Validated 100.0
PRK07938249 enoyl-CoA hydratase; Provisional 100.0
PRK05870249 enoyl-CoA hydratase; Provisional 100.0
PRK07827260 enoyl-CoA hydratase; Provisional 100.0
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 100.0
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 100.0
PRK05617342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 100.0
PRK05869222 enoyl-CoA hydratase; Validated 100.0
PLN02874379 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK08290288 enoyl-CoA hydratase; Provisional 100.0
PRK08272302 enoyl-CoA hydratase; Provisional 100.0
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 100.0
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 100.0
PLN02157401 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK08788287 enoyl-CoA hydratase; Validated 100.0
PRK06213229 enoyl-CoA hydratase; Provisional 100.0
KOG1679|consensus291 100.0
PRK11730 715 fadB multifunctional fatty acid oxidation complex 100.0
PLN02267239 enoyl-CoA hydratase/isomerase family protein 100.0
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 100.0
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 100.0
TIGR03200360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 100.0
KOG1681|consensus292 100.0
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 100.0
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 100.0
PLN02851407 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 100.0
KOG0016|consensus266 100.0
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 100.0
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 100.0
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 100.0
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 100.0
KOG1682|consensus287 100.0
KOG1684|consensus401 99.96
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.81
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.79
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 99.71
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 99.64
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 99.61
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 99.61
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 99.55
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 99.51
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 99.46
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 99.44
PRK10949618 protease 4; Provisional 99.19
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 99.16
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 99.03
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 98.77
PRK11778330 putative inner membrane peptidase; Provisional 98.73
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 98.65
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 98.49
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 98.38
KOG1683|consensus380 98.36
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 98.32
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 98.3
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 98.3
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 98.23
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 98.14
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 98.14
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 98.14
PRK10949 618 protease 4; Provisional 98.11
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 98.1
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 98.08
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 97.99
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 97.89
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 97.89
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 97.86
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 97.82
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 97.69
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 97.65
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 97.65
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 97.61
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 97.54
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 97.53
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 97.52
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 97.47
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 97.24
PRK07189301 malonate decarboxylase subunit beta; Reviewed 97.23
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 97.19
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 97.07
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 97.05
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 96.89
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 96.87
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 96.86
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 95.88
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 94.98
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase compon 94.71
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 92.16
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 92.08
COG4799526 Acetyl-CoA carboxylase, carboxyltransferase compon 81.84
>KOG1680|consensus Back     alignment and domain information
Probab=100.00  E-value=1.2e-52  Score=385.81  Aligned_cols=238  Identities=36%  Similarity=0.531  Sum_probs=208.5

Q ss_pred             EEEEEeCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHhhhCCCccEEEEEcCCCCccccCCcccccCCCCchh----HHH
Q psy9494          17 VCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTKL----FDD   92 (314)
Q Consensus        17 v~~~~~~~v~~itlnrp~~~Nal~~~~~~eL~~al~~~~~d~~vr~vVltg~g~~F~aG~Dl~~~~~~~~~~~----~~~   92 (314)
                      .....+++|+.|+||||+++|+++..|+.||.+++..+++|+.+.++||||.|++||+|.||+++......+.    ...
T Consensus        39 ~~~~~d~~I~lItlNRP~~~Nal~~~~m~eL~~A~~~~e~D~s~~viVltG~gksFcsG~Dl~e~~~~~~~~~~~~~~~~  118 (290)
T KOG1680|consen   39 ELVGEDNGIALITLNRPKALNALCRATMLELAEAFKDFESDDSVGVIVLTGSGKSFCSGADLKEMKKDEFQDVSDGIFLR  118 (290)
T ss_pred             EEeecCCCeEEEEeCChHHhccccHHHHHHHHHHHHHhhccCcccEEEEEcCCCccccccCHHHHhhccccccccccccc
Confidence            4455678999999999999999999999999999999999999999999999999999999999876433221    111


Q ss_pred             HHHHHhcCCCCcEEEEEcCccccccccccccCcEEEEeCCeEeeccccccccccccccccchhhhhcccccccccccccc
Q psy9494          93 FREFLQKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRD  172 (314)
Q Consensus        93 ~~~~~~~~~~kPvIAav~G~a~GgG~~lalacD~~ia~~~a~f~~pe~~~G~~~~~~~~~g~~~~~~~~~~~~~~~~~~~  172 (314)
                      ....+. +.+||+||+|||+|+|||++|++.||+|||+++|+|++++.++|                             
T Consensus       119 ~~~~~~-~~~KPvIaainG~AlgGG~ELalmCDirva~~~Akfg~~~~~~G-----------------------------  168 (290)
T KOG1680|consen  119 VWDLVS-RLKKPVIAAINGFALGGGLELALMCDIRVAGEGAKFGFFEIRMG-----------------------------  168 (290)
T ss_pred             hhhhhh-hcccceeEeeeceeeccchhhhhhcceEeccCCCeecccccccC-----------------------------
Confidence            222222 79999999999999999999999999999999999999999999                             


Q ss_pred             cccccccCCCCchHHHHHHHHhhHHHHHHHHhcCCCCCHHHHHHCCCceeeeCCCchHHHHHHHHHHHHhCCHH-HHHHH
Q psy9494         173 NLSRDLAIPTCDVTIRRLGQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQS-MLADR  251 (314)
Q Consensus       173 ~~~~~~~~~p~~g~~~~l~~~vG~~~a~~lll~G~~~sA~eA~~~GLV~~vv~~~~l~~~a~~~a~~la~~~~~-~~~~K  251 (314)
                             ++|.+|++++|++.||.++|+++++||++++|+||+++||||+|+|.++++++|.+++++|++.||. ++..|
T Consensus       169 -------i~p~~GGT~rl~r~vG~s~Ale~~ltg~~~~AqeA~~~GlVn~Vvp~~~~l~eAv~l~~~Ia~~~~~~v~~~K  241 (290)
T KOG1680|consen  169 -------IIPSWGGTQRLPRIVGKSRALEMILTGRRLGAQEAKKIGLVNKVVPSGDALGEAVKLAEQIAKNSPLVVRADK  241 (290)
T ss_pred             -------CccCCCchhhHHHHhChHHHHHHHHhcCcccHHHHHhCCceeEeecchhHHHHHHHHHHHHHhCCHHHHHHHH
Confidence                   8889999999999999999999999999999999999999999999999999999999999999999 99999


Q ss_pred             HHHHhhhhchHHHHHHHHHHHHhhhH--------HHHHHhcCCCCCCC
Q psy9494         252 ATVLSECETCREEWMSERKHYIGISF--------ELKFLQKKKKAKNG  291 (314)
Q Consensus       252 ~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~af~ekr~p~~~~  291 (314)
                      +.++...+....+.+..+.......+        ..+|.+||+|.|+.
T Consensus       242 ~svn~~~e~~l~e~l~~e~~~~~s~~~~~d~~Eg~~~f~~kr~~~~~k  289 (290)
T KOG1680|consen  242 ESVNAAYETTLFEGLELERDLFGSTFATEDRLEGMTAFAEKRKPKFSK  289 (290)
T ss_pred             HHHHHHhhccHHHHHHhhhhhhhhhhhhHHHHHHHHHhcccCCccccc
Confidence            99999877776655544433222222        26999999999975



>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1679|consensus Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>KOG1681|consensus Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>KOG0016|consensus Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>KOG1682|consensus Back     alignment and domain information
>KOG1684|consensus Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>KOG1683|consensus Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
3r9q_A262 Structure Of A Probable Enoyl-Coa HydrataseISOMERAS 7e-29
3qka_A261 Crystal Structure Of Enoyl-Coa Hydratase Echa5 From 1e-25
1ey3_A258 Structure Of Enoyl-Coa Hydratase Complexed With The 5e-15
1mj3_A260 Crystal Structure Analysis Of Rat Enoyl-Coa Hydrata 6e-15
1dub_A261 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6e-15
3hrx_A254 Crystal Structure Of Phenylacetic Acid Degradation 6e-15
3moy_A263 Crystal Structure Of Probable Enoyl-Coa Hydratase F 9e-15
3he2_A264 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 2e-14
2hw5_A286 The Crystal Structure Of Human Enoyl-Coenzyme A (Co 2e-14
3trr_A256 Crystal Structure Of A Probable Enoyl-Coa Hydratase 5e-14
3q0j_A258 Crystal Structure Of The Mycobacterium Tuberculosis 1e-13
3pzk_A257 Crystal Structure Of The Mycobacterium Tuberculosis 1e-13
3h81_A278 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 1e-13
3qxi_A265 Crystal Structure Of Enoyl-Coa Hydratase Echa1 From 2e-13
4fzw_A258 Crystal Structure Of The Paaf-paag Hydratase-isomer 1e-12
4f47_A278 The Structure Of Enoyl-Coa Hydratase Echa19 From My 6e-12
3r0o_A273 Crystal Structure Of Carnitinyl-Coa Hydratase From 1e-11
3r9t_A267 Structure Of Echa1_1 From Mycobacterium Paratubercu 1e-11
2pbp_A258 Crystal Structure Of Enoyl-Coa Hydrates Subunit I ( 1e-11
3qxz_A265 Crystal Structure Of A Probable Enoyl-Coa Hydratase 2e-11
3r9s_A267 Structure Of A Carnitinyl-Coa Dehydratase From Myco 2e-11
3sll_A290 Crystal Structure Of A Probable Enoyl-Coa Hydratase 3e-11
3p85_A270 Crystal Structure Enoyl-Coa Hydratase From Mycobact 5e-11
3kqf_A265 1.8 Angstrom Resolution Crystal Structure Of Enoyl- 5e-11
2iex_A272 Crystal Structure Of Dihydroxynapthoic Acid Synthet 1e-10
3qyr_A253 Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 M 2e-10
2uzf_A273 Crystal Structure Of Staphylococcus Aureus 1,4-Dihy 2e-09
1uiy_A253 Crystal Structure Of Enoyl-Coa Hydratase From Therm 3e-09
3rrv_A276 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 3e-09
1nzy_A269 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo 4e-09
1jxz_A269 Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coe 4e-09
3hin_A275 Crystal Structure Of Putative Enoyl-Coa Hydratase F 4e-09
1nzy_B269 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo 5e-09
3p5m_A255 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 6e-09
1dci_A275 Dienoyl-Coa Isomerase Length = 275 1e-08
3pe8_A256 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 2e-08
3myb_A286 Crystal Structure Of Enoyl-Coa Hydratase Mycobacter 9e-08
4di1_A277 Crystal Structure Of Enoyl-Coa Hydratase Echa17 Fro 2e-07
3pea_A261 Crystal Structure Of Enoyl-Coa Hydratase From Bacil 2e-07
3qmj_A256 Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 Fr 2e-07
3t3w_A279 Crystal Structure Of Probable Enoyl-Coa Hydratase F 2e-07
3ome_A282 Crystal Structure Of A Probable Enoyl-Coa Hydratase 3e-07
3qre_A298 Crystal Structure Of An Enoyl-Coa Hydratase Echa12_ 6e-07
3rsi_A265 The Structure Of A Putative Enoyl-Coa HydrataseISOM 7e-07
2a7k_A250 Carboxymethylproline Synthase (carb) From Pectobact 1e-06
3bpt_A363 Crystal Structure Of Human Beta-Hydroxyisobutyryl-C 1e-06
2fw2_A260 Catalytic Domain Of Cdy Length = 260 1e-06
2gtr_A261 Human Chromodomain Y-Like Protein Length = 261 1e-06
3tlf_A274 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 1e-06
2fbm_A291 Acetyltransferase Domain Of Cdy1 Length = 291 2e-06
2vre_A296 Crystal Structure Of Human Peroxisomal Delta3,5, De 2e-06
3swx_A265 Crystal Structure Of A Probable Enoyl-Coa Hydratase 4e-06
2vx2_A287 Crystal Structure Of Human Enoyl Coenzyme A Hydrata 6e-06
2f6q_A280 The Crystal Structure Of Human Peroxisomal Delta3, 1e-05
2ppy_A265 Crystal Structure Of Enoyl-Coa Hydrates (Gk_1992) F 2e-05
1wdk_A 715 Fatty Acid Beta-Oxidation Multienzyme Complex From 3e-05
4eml_A275 Synechocystis Sp. Pcc 6803 1,4-Dihydroxy-2-Naphthoy 4e-05
3zwb_A 742 Crystal Structure Of Rat Peroxisomal Multifunctiona 8e-05
2vss_E276 Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C 1e-04
2j5i_A276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 1e-04
2j5i_B276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 1e-04
2j5i_I276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 1e-04
3l3s_A263 Crystal Structure Of An Enoyl-Coa HydrotaseISOMERAS 1e-04
3t88_A289 Crystal Structure Of Escherichia Coli Menb In Compl 1e-04
2x58_A 727 The Crystal Structure Of Mfe1 Liganded With Coa Len 1e-04
3zw8_A 742 Crystal Structure Of Rat Peroxisomal Multifunctiona 1e-04
4els_A285 Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Co 1e-04
2vsu_C275 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 1e-04
2vsu_E276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 1e-04
2vsu_A276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 2e-04
2vss_F276 Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C 2e-04
3njb_A333 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 3e-04
2vsu_F276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 3e-04
3h02_A288 2.15 Angstrom Resolution Crystal Structure Of Napht 4e-04
3fdu_A266 Crystal Structure Of A Putative Enoyl-Coa Hydratase 5e-04
3oc7_A267 Crystal Structure Of An Enoyl-Coa Hydratase From My 7e-04
3isa_A254 Crystal Structure Of Putative Enoyl-Coa HydrataseIS 7e-04
>pdb|3R9Q|A Chain A, Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 262 Back     alignment and structure

Iteration: 1

Score = 124 bits (311), Expect = 7e-29, Method: Compositional matrix adjust. Identities = 82/253 (32%), Positives = 125/253 (49%), Gaps = 42/253 (16%) Query: 16 SVCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSG 75 +V +K +T + LNRP NA++ T AL F+ D E+ +A+L+G G FC+G Sbjct: 12 AVRVEKAGPVTTVILNRPHARNAVDGPTAAALLAAFTEFDADPEASVAVLWGDNGTFCAG 71 Query: 76 FDLHELDENPDTKLFDDFREFLQKPAK----KPIIAAITGYAVGQGLDLALWCDLRFVEE 131 DL + + +L + P++ KP+IAAI+G+AV G++LALWCDLR VEE Sbjct: 72 ADLKAMGTDRGNELHPHGPGPM-GPSRLRLSKPVIAAISGHAVAGGIELALWCDLRVVEE 130 Query: 132 NVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLG 191 + ++G + RR+ +P D RL Sbjct: 131 DAVLGVFCRRW------------------------------------GVPLIDGGTIRLP 154 Query: 192 QMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQSML-AD 250 ++IG SR MD+I GR + A EALD GL N++V G A A T A +++ Q + AD Sbjct: 155 RLIGHSRAMDLILTGRPVHANEALDIGLVNRVVARGQAREAAETLAAEIAAFPQQCVRAD 214 Query: 251 RATVLSECETCRE 263 R + +++ E Sbjct: 215 RDSAIAQWGMAEE 227
>pdb|3QKA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa5 From Mycobacterium Marinum Length = 261 Back     alignment and structure
>pdb|1EY3|A Chain A, Structure Of Enoyl-Coa Hydratase Complexed With The Substrate Dac-Coa Length = 258 Back     alignment and structure
>pdb|1MJ3|A Chain A, Crystal Structure Analysis Of Rat Enoyl-Coa Hydratase In Complex With Hexadienoyl-Coa Length = 260 Back     alignment and structure
>pdb|1DUB|A Chain A, 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6.5 Length = 261 Back     alignment and structure
>pdb|3HRX|A Chain A, Crystal Structure Of Phenylacetic Acid Degradation Protein Paag Length = 254 Back     alignment and structure
>pdb|3MOY|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycob Smegmatis Length = 263 Back     alignment and structure
>pdb|3HE2|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 264 Back     alignment and structure
>pdb|2HW5|A Chain A, The Crystal Structure Of Human Enoyl-Coenzyme A (Coa) Hydratase Short Chain 1, Echs1 Length = 286 Back     alignment and structure
>pdb|3TRR|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 256 Back     alignment and structure
>pdb|3Q0J|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Complex With The Inhibitor Acetoacetylcoa Length = 258 Back     alignment and structure
>pdb|3PZK|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Apo Form Length = 257 Back     alignment and structure
>pdb|3H81|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 278 Back     alignment and structure
>pdb|3QXI|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa1 From Mycobacterium Marinum Length = 265 Back     alignment and structure
>pdb|4FZW|A Chain A, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 258 Back     alignment and structure
>pdb|4F47|A Chain A, The Structure Of Enoyl-Coa Hydratase Echa19 From Mycobacterium Marinum Length = 278 Back     alignment and structure
>pdb|3R0O|A Chain A, Crystal Structure Of Carnitinyl-Coa Hydratase From Mycobacterium Avium Length = 273 Back     alignment and structure
>pdb|3R9T|A Chain A, Structure Of Echa1_1 From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 267 Back     alignment and structure
>pdb|2PBP|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates Subunit I (Gk_2039) From Geobacillus Kaustophilus Hta426 Length = 258 Back     alignment and structure
>pdb|3QXZ|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 Back     alignment and structure
>pdb|3R9S|A Chain A, Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Avium 104 Length = 267 Back     alignment and structure
>pdb|3SLL|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 290 Back     alignment and structure
>pdb|3P85|A Chain A, Crystal Structure Enoyl-Coa Hydratase From Mycobacterium Avium Length = 270 Back     alignment and structure
>pdb|3KQF|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis. Length = 265 Back     alignment and structure
>pdb|2IEX|A Chain A, Crystal Structure Of Dihydroxynapthoic Acid Synthetase (Gk2873) From Geobacillus Kaustophilus Hta426 Length = 272 Back     alignment and structure
>pdb|3QYR|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa Length = 273 Back     alignment and structure
>pdb|1UIY|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Thermus Thermophilus Hb8 Length = 253 Back     alignment and structure
>pdb|3RRV|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 276 Back     alignment and structure
>pdb|1NZY|A Chain A, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 Back     alignment and structure
>pdb|1JXZ|A Chain A, Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coenzyme A Dehalogenase Complexed With 4-Hydroxybenzoyl-Coenzyme A (Product) Length = 269 Back     alignment and structure
>pdb|3HIN|A Chain A, Crystal Structure Of Putative Enoyl-Coa Hydratase From Rhodopseudomonas Palustris Cga009 Length = 275 Back     alignment and structure
>pdb|1NZY|B Chain B, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 Back     alignment and structure
>pdb|3P5M|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Avium Length = 255 Back     alignment and structure
>pdb|1DCI|A Chain A, Dienoyl-Coa Isomerase Length = 275 Back     alignment and structure
>pdb|3PE8|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 256 Back     alignment and structure
>pdb|3MYB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Mycobacterium Smegm Length = 286 Back     alignment and structure
>pdb|4DI1|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa17 From Mycobacterium Marinum Length = 277 Back     alignment and structure
>pdb|3PEA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis Str. 'ames Ancestor' Length = 261 Back     alignment and structure
>pdb|3QMJ|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 From Mycobacterium Marinum Length = 256 Back     alignment and structure
>pdb|3T3W|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycobacterium Thermoresistibile Length = 279 Back     alignment and structure
>pdb|3OME|A Chain A, Crystal Structure Of A Probable Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 282 Back     alignment and structure
>pdb|3QRE|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase Echa12_1 From Mycobacterium Marinum Length = 298 Back     alignment and structure
>pdb|3RSI|A Chain A, The Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 265 Back     alignment and structure
>pdb|2A7K|A Chain A, Carboxymethylproline Synthase (carb) From Pectobacterium Carotovora, Apo Enzyme Length = 250 Back     alignment and structure
>pdb|3BPT|A Chain A, Crystal Structure Of Human Beta-Hydroxyisobutyryl-Coa Hydrolase In Complex With Quercetin Length = 363 Back     alignment and structure
>pdb|2FW2|A Chain A, Catalytic Domain Of Cdy Length = 260 Back     alignment and structure
>pdb|2GTR|A Chain A, Human Chromodomain Y-Like Protein Length = 261 Back     alignment and structure
>pdb|3TLF|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 274 Back     alignment and structure
>pdb|2FBM|A Chain A, Acetyltransferase Domain Of Cdy1 Length = 291 Back     alignment and structure
>pdb|2VRE|A Chain A, Crystal Structure Of Human Peroxisomal Delta3,5, Delta2,4-Dienoyl Coa Isomerase Length = 296 Back     alignment and structure
>pdb|3SWX|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 Back     alignment and structure
>pdb|2VX2|A Chain A, Crystal Structure Of Human Enoyl Coenzyme A Hydratase Domain-Containing Protein 3 (Echdc3) Length = 287 Back     alignment and structure
>pdb|2F6Q|A Chain A, The Crystal Structure Of Human Peroxisomal Delta3, Delta2 Enoyl Coa Isomerase (Peci) Length = 280 Back     alignment and structure
>pdb|2PPY|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates (Gk_1992) From Geobacillus Kaustophilus Hta426 Length = 265 Back     alignment and structure
>pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 715 Back     alignment and structure
>pdb|4EML|A Chain A, Synechocystis Sp. Pcc 6803 1,4-Dihydroxy-2-Naphthoyl-Coenzyme A Synthase (Menb) In Complex With Bicarbonate Length = 275 Back     alignment and structure
>pdb|3ZWB|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) Complexed With 2trans-hexenoyl-coa Length = 742 Back     alignment and structure
>pdb|2VSS|E Chain E, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 Back     alignment and structure
>pdb|2J5I|A Chain A, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|2J5I|B Chain B, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|2J5I|I Chain I, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|3L3S|A Chain A, Crystal Structure Of An Enoyl-Coa HydrotaseISOMERASE FAMILY Protein From Silicibacter Pomeroyi Length = 263 Back     alignment and structure
>pdb|3T88|A Chain A, Crystal Structure Of Escherichia Coli Menb In Complex With Substrate Analogue, Osb-Ncoa Length = 289 Back     alignment and structure
>pdb|2X58|A Chain A, The Crystal Structure Of Mfe1 Liganded With Coa Length = 727 Back     alignment and structure
>pdb|3ZW8|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) In Apo Form Length = 742 Back     alignment and structure
>pdb|4ELS|A Chain A, Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Coenzyme A Synthases (Menb) In Complex With Bicarbonate Length = 285 Back     alignment and structure
>pdb|2VSU|C Chain C, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 275 Back     alignment and structure
>pdb|2VSU|E Chain E, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 Back     alignment and structure
>pdb|2VSU|A Chain A, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism. Length = 276 Back     alignment and structure
>pdb|2VSS|F Chain F, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 Back     alignment and structure
>pdb|3NJB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis, Iodide Soak Length = 333 Back     alignment and structure
>pdb|2VSU|F Chain F, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 Back     alignment and structure
>pdb|3H02|A Chain A, 2.15 Angstrom Resolution Crystal Structure Of Naphthoate Synthase From Salmonella Typhimurium. Length = 288 Back     alignment and structure
>pdb|3FDU|A Chain A, Crystal Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Acinetobacter Baumannii Length = 266 Back     alignment and structure
>pdb|3OC7|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase From Mycobacterium Avium Length = 267 Back     alignment and structure
>pdb|3ISA|A Chain A, Crystal Structure Of Putative Enoyl-Coa HydrataseISOMERASE FROM Bordetella Parapertussis Length = 254 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 2e-53
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 2e-38
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 5e-38
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 2e-37
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 6e-37
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 8e-37
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 2e-36
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 5e-36
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 5e-36
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 7e-36
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 1e-35
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 1e-35
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 2e-35
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 5e-35
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 7e-35
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 1e-34
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 1e-34
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 6e-34
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 8e-34
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 8e-34
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 1e-33
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 1e-33
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, struct 2e-33
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 3e-33
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 3e-33
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 4e-33
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 7e-33
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 7e-33
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 1e-32
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 2e-32
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 2e-32
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 2e-32
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 2e-32
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 2e-32
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 3e-32
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 4e-32
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 5e-32
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 8e-32
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 9e-32
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 1e-31
3t3w_A279 Probable enoyl-COA hydratase; ssgcid, structural g 1e-31
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 2e-31
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 5e-31
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 6e-31
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 1e-30
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 4e-29
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 6e-29
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 2e-28
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 1e-27
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 1e-27
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 2e-27
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 5e-27
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 9e-27
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 2e-26
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 2e-25
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 2e-24
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 1e-09
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 3e-24
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 3e-24
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 2e-23
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 7e-10
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 3e-23
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 4e-08
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 4e-23
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 8e-22
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 4e-20
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 4e-20
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 7e-20
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 9e-20
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 2e-08
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 1e-19
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 8e-10
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 4e-19
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 1e-08
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 6e-19
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 3e-09
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 2e-18
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 3e-09
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 1e-17
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 1e-08
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 2e-12
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 Back     alignment and structure
 Score =  174 bits (443), Expect = 2e-53
 Identities = 84/273 (30%), Positives = 127/273 (46%), Gaps = 46/273 (16%)

Query: 24  NITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDE 83
            +T + LNRP   NA++  T  AL      F+ D E+ +A+L+G  G FC+G DL  +  
Sbjct: 20  PVTTVILNRPHARNAVDGPTAAALLAAFTEFDADPEASVAVLWGDNGTFCAGADLKAMGT 79

Query: 84  NPDTKLFDDFREFL---QKPAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNR 140
           +   +L       +   +    KP+IAAI+G+AV  G++LALWCDLR VEE+ ++G + R
Sbjct: 80  DRGNELHPHGPGPMGPSRLRLSKPVIAAISGHAVAGGIELALWCDLRVVEEDAVLGVFCR 139

Query: 141 RFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLGQMIGTSRTM 200
           R+          GV L       T                        RL ++IG SR M
Sbjct: 140 RW----------GVPLID---GGTI-----------------------RLPRLIGHSRAM 163

Query: 201 DMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQ-SMLADRATVLSECE 259
           D+I  GR + A EALD GL N++V  G A   A T A +++   Q  + ADR + +++  
Sbjct: 164 DLILTGRPVHANEALDIGLVNRVVARGQAREAAETLAAEIAAFPQQCVRADRDSAIAQWG 223

Query: 260 TCREE-WMSERKHYIGISFELK-----FLQKKK 286
              E    +E      ++ E       F   + 
Sbjct: 224 MAEEAALDNEFGSIERVATEALEGAGRFAAGEG 256


>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 Back     alignment and structure
>3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Length = 407 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Length = 363 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query314
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 100.0
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 100.0
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 100.0
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 100.0
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 100.0
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 100.0
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 100.0
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 100.0
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 100.0
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 100.0
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 100.0
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 100.0
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 100.0
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 100.0
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 100.0
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 100.0
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 100.0
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 100.0
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 100.0
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 100.0
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 100.0
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 100.0
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 100.0
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 100.0
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 100.0
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 100.0
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 100.0
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 100.0
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 100.0
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 100.0
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 100.0
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 100.0
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 100.0
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 100.0
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 100.0
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 100.0
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 100.0
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 100.0
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 100.0
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 100.0
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 100.0
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 100.0
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 100.0
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 100.0
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 100.0
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 100.0
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 100.0
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 100.0
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 100.0
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 100.0
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 100.0
4hdt_A353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 100.0
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 100.0
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 100.0
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 100.0
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 100.0
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 100.0
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 100.0
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 100.0
3bpt_A363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 100.0
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 100.0
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 100.0
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 100.0
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 100.0
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 100.0
3ju1_A407 Enoyl-COA hydratase/isomerase family protein; alph 100.0
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 100.0
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 100.0
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 100.0
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 100.0
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 100.0
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 100.0
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 100.0
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.87
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.82
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.79
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 99.58
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 99.57
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 99.44
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 99.41
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 99.11
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 98.68
2f6i_A215 ATP-dependent CLP protease, putative; structural g 98.6
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 98.54
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 98.5
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 98.43
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 98.22
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 98.01
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 97.79
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 97.64
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 97.62
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 97.47
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 97.39
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 97.36
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 97.32
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 97.23
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 96.93
2w3p_A556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 96.85
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 96.63
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 96.3
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 96.23
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 95.77
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 95.69
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 95.02
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 94.69
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 94.53
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 94.0
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 93.8
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 93.43
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 91.83
>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
Probab=100.00  E-value=1.3e-57  Score=420.08  Aligned_cols=240  Identities=24%  Similarity=0.355  Sum_probs=211.2

Q ss_pred             EEEEEeCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHhhhCCCccEEEEEcCCCCccccCCcccccCCCCch--hHHHHH
Q psy9494          17 VCTKKILNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTK--LFDDFR   94 (314)
Q Consensus        17 v~~~~~~~v~~itlnrp~~~Nal~~~~~~eL~~al~~~~~d~~vr~vVltg~g~~F~aG~Dl~~~~~~~~~~--~~~~~~   94 (314)
                      |.+|++|+|++||||||+++|+||.+|+.+|.++++++++|+++|+|||||.|++||+|.|++++.......  ....+.
T Consensus         2 vl~E~~dgVa~itlnrP~~~NAl~~~m~~~L~~al~~~~~d~~vr~vVltg~g~~F~aG~Dl~~~~~~~~~~~~~~~~~~   81 (254)
T 3hrx_A            2 VLKERQDGVLVLTLNRPEKLNAITGELLDALYAALKEGEEDREVRALLLTGAGRAFSAGQDLTEFGDRKPDYEAHLRRYN   81 (254)
T ss_dssp             EEEEEETTEEEEEECCGGGTTCBCHHHHHHHHHHHHHHHHCTTCCEEEEEESTTCSBCCBCGGGTTTSCCCHHHHTHHHH
T ss_pred             eEEEEECCEEEEEEcCCCcCCCCCHHHHHHHHHHHHHHHhCCCeEEEEEeCCCCCcccCccHHHhcccchhhHHHHHHHH
Confidence            678999999999999999999999999999999999999999999999999999999999999986543322  122233


Q ss_pred             HHHhc--CCCCcEEEEEcCccccccccccccCcEEEEeCCeEeeccccccccccccccccchhhhhcccccccccccccc
Q psy9494          95 EFLQK--PAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQLKHSLRD  172 (314)
Q Consensus        95 ~~~~~--~~~kPvIAav~G~a~GgG~~lalacD~~ia~~~a~f~~pe~~~G~~~~~~~~~g~~~~~~~~~~~~~~~~~~~  172 (314)
                      ..+..  ++||||||+|||+|+|||++|+++||+|||+++++|++||+++|                             
T Consensus        82 ~~~~~l~~~~kPvIAav~G~a~GgG~~lalacD~ria~~~a~f~~pe~~lG-----------------------------  132 (254)
T 3hrx_A           82 RVVEALSGLEKPLVVAVNGVAAGAGMSLALWGDLRLAAVGASFTTAFVRIG-----------------------------  132 (254)
T ss_dssp             HHHHHHHTCSSCEEEEECSEEETHHHHHHTTCSEEEEETTCEEECCGGGGT-----------------------------
T ss_pred             HHHHHHHhCCCCEEEEECCEeeehhhhhhhccceeeEcCCCEEEchhhCcC-----------------------------
Confidence            33333  99999999999999999999999999999999999999999999                             


Q ss_pred             cccccccCCCCchHHHHHHHHhhHHHHHHHHhcCCCCCHHHHHHCCCceeeeCCCchHHHHHHHHHHHHhCCHH-HHHHH
Q psy9494         173 NLSRDLAIPTCDVTIRRLGQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQS-MLADR  251 (314)
Q Consensus       173 ~~~~~~~~~p~~g~~~~l~~~vG~~~a~~lll~G~~~sA~eA~~~GLV~~vv~~~~l~~~a~~~a~~la~~~~~-~~~~K  251 (314)
                             +.|++|++++|++++|..+|++|+++|++++|+||+++||||+++|++++.+++.+++++|++.||. ++.+|
T Consensus       133 -------l~p~~g~~~~L~r~vG~~~A~~llltg~~i~A~eA~~~GLv~~vv~~~~l~~~a~~~a~~la~~~~~a~~~~K  205 (254)
T 3hrx_A          133 -------LVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRVVPAEKLMEEALSLAKELAQGPTRAYALTK  205 (254)
T ss_dssp             -------CCCCTTHHHHHHHHHCHHHHHHHHHHCCCEEHHHHHHHTSCSEEECGGGHHHHHHHHHHHHHTSCHHHHHHHH
T ss_pred             -------cCCcccHHHHHHHHhCcchHHHHhhcCcccCHHHHHHCCCeEEecCcHHHHHHHHHHHHHhhccchHHHHHHH
Confidence                   7788999999999999999999999999999999999999999999999999999999999999999 99999


Q ss_pred             HHHHhhhhchHHHHHHHHHHHHhhhH--------HHHHHhcCCCCCCCC
Q psy9494         252 ATVLSECETCREEWMSERKHYIGISF--------ELKFLQKKKKAKNGH  292 (314)
Q Consensus       252 ~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~af~ekr~p~~~~~  292 (314)
                      +.++.......++.+..+.......+        ..||+|||+|+|+||
T Consensus       206 ~~~~~~~~~~~~~~l~~e~~~~~~~~~s~d~~Eg~~AF~eKR~P~f~Gr  254 (254)
T 3hrx_A          206 KLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPRFQGR  254 (254)
T ss_dssp             HHHHHGGGSCHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTTSCCCCCCC
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHHHhCCHHHHHHHHHHhCCCCCCCCCC
Confidence            99998877665554433322211111        269999999999996



>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 314
d1mj3a_260 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat 4e-22
d1uiya_253 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {The 4e-16
d1dcia_275 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 1e-15
d1pjha_266 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 8e-12
d1q52a_297 c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacter 2e-10
d1nzya_269 c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Ps 1e-07
d1hzda_266 c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [T 2e-07
d1szoa_249 c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus 1e-05
d2f6qa1245 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-C 6e-05
d1ef8a_261 c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Esc 9e-05
d1wdka4310 c.14.1.3 (A:1-310) Fatty oxidation complex alpha s 1e-04
d2a7ka1230 c.14.1.3 (A:1-230) Carbapenem biosynthes protein C 2e-04
d2fw2a1258 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Hum 0.003
d1wz8a1263 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TT 0.004
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Enoyl-CoA hydratase (crotonase)
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 91.4 bits (226), Expect = 4e-22
 Identities = 52/206 (25%), Positives = 84/206 (40%), Gaps = 39/206 (18%)

Query: 24  NITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDE 83
           ++ LI LNRP  +NA+    ++ L + ++ FE+D      +L G E  F +G D+ E+  
Sbjct: 16  SVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQN 75

Query: 84  NPDTKLF-DDFREFLQK--PAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNR 140
                 +   F          KKP+IAA+ GYA+G G +LA+ CD+ +  E    G    
Sbjct: 76  RTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQ--- 132

Query: 141 RFVYLKDSLLSSGVVLYALHVPRTQLKHSLRDNLSRDLAIPTCDVTIRRLGQMIGTSRTM 200
                                P               L         +RL + +G S  M
Sbjct: 133 ---------------------PEIL------------LGTIPGAGGTQRLTRAVGKSLAM 159

Query: 201 DMISLGRHITAREALDWGLCNKMVNC 226
           +M+  G  I+A++A   GL +K+   
Sbjct: 160 EMVLTGDRISAQDAKQAGLVSKIFPV 185


>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Length = 253 Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 275 Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266 Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 297 Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Length = 269 Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 249 Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Length = 261 Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 310 Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Length = 230 Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Length = 263 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query314
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 100.0
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 100.0
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 100.0
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 100.0
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 100.0
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 100.0
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 100.0
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 100.0
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 100.0
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 100.0
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1wdka4310 Fatty oxidation complex alpha subunit, N-terminal 100.0
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 97.75
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 97.72
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 97.64
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 97.63
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 97.53
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 97.47
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 97.43
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 97.4
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 97.37
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 97.3
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 97.19
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 96.89
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 95.83
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 95.66
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 95.2
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 95.1
d1uyra1333 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 94.78
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 93.57
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Enoyl-CoA hydratase (crotonase)
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=7.6e-54  Score=391.25  Aligned_cols=244  Identities=27%  Similarity=0.380  Sum_probs=210.0

Q ss_pred             ccccEEEEEe---CCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHhhhCCCccEEEEEcCCCCccccCCcccccCCCCch-
Q psy9494          13 LVSSVCTKKI---LNITLISLNRPDKINAINLKTLDALQENIKRFEDDTESPLAILYGQEGNFCSGFDLHELDENPDTK-   88 (314)
Q Consensus        13 ~~~~v~~~~~---~~v~~itlnrp~~~Nal~~~~~~eL~~al~~~~~d~~vr~vVltg~g~~F~aG~Dl~~~~~~~~~~-   88 (314)
                      -|+.|.++++   ++|++||||||+++|+||.+|+.+|.+++++++.|+++++|||||.|++||+|+|++++....... 
T Consensus         2 ~~~~i~~e~~g~~~~I~~itlnrP~~~Nal~~~~~~~l~~~l~~~~~d~~v~~vvl~g~g~~F~aG~Dl~~~~~~~~~~~   81 (260)
T d1mj3a_           2 NFQYIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEMQNRTFQDC   81 (260)
T ss_dssp             CCSSEEEEEESGGGCEEEEEECCGGGTTCBCHHHHHHHHHHHHHHHHCTTCCEEEEECCSSEEECCBCHHHHTTCCHHHH
T ss_pred             CCeEEEEEEEcCCCCEEEEEEcCCCcCCCCCHHHHHHHHHHHHHHHhCCCcceEEEecccccccccchhhhhhccchhhh
Confidence            3678999986   489999999999999999999999999999999999999999999999999999999886543221 


Q ss_pred             hHHHHHHHHhc--CCCCcEEEEEcCccccccccccccCcEEEEeCCeEeeccccccccccccccccchhhhhcccccccc
Q psy9494          89 LFDDFREFLQK--PAKKPIIAAITGYAVGQGLDLALWCDLRFVEENVLMGFYNRRFVYLKDSLLSSGVVLYALHVPRTQL  166 (314)
Q Consensus        89 ~~~~~~~~~~~--~~~kPvIAav~G~a~GgG~~lalacD~~ia~~~a~f~~pe~~~G~~~~~~~~~g~~~~~~~~~~~~~  166 (314)
                      ....+...+..  ++||||||+|||+|+|||++|+++||+|||+++++|++||+++|                       
T Consensus        82 ~~~~~~~~~~~~~~~~kPvIaav~G~a~GgG~~lal~~D~~ia~~~a~f~~pe~~~G-----------------------  138 (260)
T d1mj3a_          82 YSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLG-----------------------  138 (260)
T ss_dssp             HHC--CCGGGGGGGCSSCEEEEECSEEETHHHHHHHHSSEEEEETTCEEECGGGGGT-----------------------
T ss_pred             hHHHHHHHHHHhccCCCeEEEEEcCeEeHHHHHHHHHCCEEEEcCCCEEECchhccC-----------------------
Confidence            11112222222  89999999999999999999999999999999999999999999                       


Q ss_pred             cccccccccccccCCCCchHHHHHHHHhhHHHHHHHHhcCCCCCHHHHHHCCCceeeeCCCchHHHHHHHHHHHHhCCHH
Q psy9494         167 KHSLRDNLSRDLAIPTCDVTIRRLGQMIGTSRTMDMISLGRHITAREALDWGLCNKMVNCGTAVGEAMTRAIQMSKLSQS  246 (314)
Q Consensus       167 ~~~~~~~~~~~~~~~p~~g~~~~l~~~vG~~~a~~lll~G~~~sA~eA~~~GLV~~vv~~~~l~~~a~~~a~~la~~~~~  246 (314)
                                   +.|++|++++|++++|.++|++++++|++++|+||+++|||+++++.+++.+.+.+++++++..+|.
T Consensus       139 -------------l~p~~~~~~~l~~~ig~~~a~~l~l~g~~~~a~eA~~~Glv~~v~~~~~~~~~a~~~a~~i~~~~~~  205 (260)
T d1mj3a_         139 -------------TIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKI  205 (260)
T ss_dssp             -------------CCCCSSTTTHHHHHHCHHHHHHHHHHCCCEEHHHHHHHTSCSEEECTTTHHHHHHHHHHHHHHSCHH
T ss_pred             -------------cCCcccHHHHHHHHhCHHHHHHHHHcCcccCchhhccCCCceeeecccccccccccccccccchhhH
Confidence                         7778899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             -HHHHHHHHHhhhhchHHHHHHHHHHHHhhh--------HHHHHHhcCCCCCCCC
Q psy9494         247 -MLADRATVLSECETCREEWMSERKHYIGIS--------FELKFLQKKKKAKNGH  292 (314)
Q Consensus       247 -~~~~K~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~af~ekr~p~~~~~  292 (314)
                       ++.+|+.++.......++....+.......        ...+|+|||+|.|+++
T Consensus       206 a~~~~K~~l~~~~~~~l~~~l~~E~~~~~~~~~s~d~~egi~aFleKR~P~f~~~  260 (260)
T d1mj3a_         206 IVAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFKDH  260 (260)
T ss_dssp             HHHHHHHHHHGGGSSCHHHHHHHHHHHHHHGGGSHHHHHHHHHHHTTSCCCCCCC
T ss_pred             HHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHhCCHHHHHHHHHHhCCCCCCCCCC
Confidence             999999999887765554433322211111        1279999999999985



>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure