Psyllid ID: psy9521


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MYTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQIDINTVRLNFWDLGGQLELQSLWDKDIRDCMGVREVKPIFNKNSAHLIGRRDCMVMPVSALT
cHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHccccccccccccccccccccEEEEEEEccEEEEEEEcccccccHHHHHHHHcccccEEEcccEEEEEccccccccccccccccccc
ccHHHHHHHHHHHccccEEEEEEccccccHHHHHHEEEccccccccccEEEEEccEEEEEEEEEEEEEEEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHccc
MYTLVSGFYKYMLRKDEFCVLILGldnagkttYLESAKTKftknykgmnpskitttvglnigqidinTVRLNFWDLGGQLELQSLWdkdirdcmgvrevkpifnknsahligrrdcmvmpvsalt
MYTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTkftknykgmnpskITTTVGLNIGQIDINTVRLNFWDLGGQLELQSLWDKDIRDCMGvrevkpifnknsahligrrdcmVMPVSALT
MYTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQIDINTVRLNFWDLGGQLELQSLWDKDIRDCMGVREVKPIFNKNSAHLIGRRDCMVMPVSALT
**TLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQIDINTVRLNFWDLGGQLELQSLWDKDIRDCMGVREVKPIFNKNSAHLIGRRDCMVM******
MYTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQIDINTVRLNFWDLGGQLELQSLWDKDIRDCMGVREVKPIFNKNSAHLIGRRDCMVMPVSALT
MYTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQIDINTVRLNFWDLGGQLELQSLWDKDIRDCMGVREVKPIFNKNSAHLIGRRDCMVMPVSALT
*YTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQIDINTVRLNFWDLGGQLELQSLWDKDIRDCMGVREVKPIFNKNSAHLIGRRDCMVMPVS***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQIDINTVRLNFWDLGGQLELQSLWDKDIRDCMGVREVKPIFNKNSAHLIGRRDCMVMPVSALT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
Q32LJ2201 ADP-ribosylation factor-r yes N/A 0.992 0.616 0.479 9e-38
Q5R579201 ADP-ribosylation factor-r yes N/A 0.992 0.616 0.468 3e-37
Q13795201 ADP-ribosylation factor-r no N/A 0.992 0.616 0.468 3e-37
Q63055201 ADP-ribosylation factor-r yes N/A 0.992 0.616 0.468 6e-37
Q8BXL7201 ADP-ribosylation factor-r yes N/A 0.992 0.616 0.468 6e-37
Q02804198 ADP-ribosylation factor-l yes N/A 0.976 0.616 0.327 5e-19
P39110191 GTP-binding protein CIN4 no N/A 0.632 0.413 0.404 8e-09
Q9D0J4184 ADP-ribosylation factor-l no N/A 0.6 0.407 0.385 4e-08
P36404184 ADP-ribosylation factor-l no N/A 0.6 0.407 0.385 4e-08
Q2TA37184 ADP-ribosylation factor-l no N/A 0.6 0.407 0.385 4e-08
>sp|Q32LJ2|ARFRP_BOVIN ADP-ribosylation factor-related protein 1 OS=Bos taurus GN=ARFRP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  155 bits (391), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 83/173 (47%), Positives = 100/173 (57%), Gaps = 49/173 (28%)

Query: 1   MYTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLN 60
           MYTL+SG YKYM +KDE+CVLILGLDNAGKTT+LE +KT+F KNYKGM+ SKITTTVGLN
Sbjct: 1   MYTLLSGLYKYMFQKDEYCVLILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLN 60

Query: 61  IGQIDINTVRLNFWDLGGQLELQSLWDK-------------------------------- 88
           IG +D+   RL FWDLGGQ ELQSLWDK                                
Sbjct: 61  IGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLSESKQAFEKMVT 120

Query: 89  ----------------DIRDCMGVREVKPIFNKNSAHLIGRRDCMVMPVSALT 125
                           D+  C+ + ++K  F+ + A  IGRRDC+    SALT
Sbjct: 121 SEALDGVPILVLANKQDVETCLSIPDIKTAFS-DCASKIGRRDCLTQACSALT 172




Possibly involved in plasma membrane-related signaling events.
Bos taurus (taxid: 9913)
>sp|Q5R579|ARFRP_PONAB ADP-ribosylation factor-related protein 1 OS=Pongo abelii GN=ARFRP1 PE=2 SV=1 Back     alignment and function description
>sp|Q13795|ARFRP_HUMAN ADP-ribosylation factor-related protein 1 OS=Homo sapiens GN=ARFRP1 PE=1 SV=1 Back     alignment and function description
>sp|Q63055|ARFRP_RAT ADP-ribosylation factor-related protein 1 OS=Rattus norvegicus GN=Arfrp1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BXL7|ARFRP_MOUSE ADP-ribosylation factor-related protein 1 OS=Mus musculus GN=Arfrp1 PE=2 SV=2 Back     alignment and function description
>sp|Q02804|ARL3_YEAST ADP-ribosylation factor-like protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL3 PE=1 SV=1 Back     alignment and function description
>sp|P39110|CIN4_YEAST GTP-binding protein CIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIN4 PE=1 SV=1 Back     alignment and function description
>sp|Q9D0J4|ARL2_MOUSE ADP-ribosylation factor-like protein 2 OS=Mus musculus GN=Arl2 PE=1 SV=1 Back     alignment and function description
>sp|P36404|ARL2_HUMAN ADP-ribosylation factor-like protein 2 OS=Homo sapiens GN=ARL2 PE=1 SV=4 Back     alignment and function description
>sp|Q2TA37|ARL2_BOVIN ADP-ribosylation factor-like protein 2 OS=Bos taurus GN=ARL2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
156552517205 PREDICTED: ADP-ribosylation factor-relat 0.984 0.6 0.627 9e-51
312375482 1101 hypothetical protein AND_14113 [Anophele 0.992 0.112 0.595 3e-50
157126089201 ARL3, putative [Aedes aegypti] gi|108873 0.992 0.616 0.583 7e-50
31212513201 AGAP004586-PA [Anopheles gambiae str. PE 0.992 0.616 0.583 1e-49
170050739201 ADP-ribosylation factor [Culex quinquefa 0.992 0.616 0.578 2e-49
189240847202 PREDICTED: similar to AGAP004586-PA [Tri 0.992 0.613 0.595 5e-49
66554170205 PREDICTED: ADP-ribosylation factor-relat 0.984 0.6 0.604 9e-49
332373066202 unknown [Dendroctonus ponderosae] 0.992 0.613 0.589 9e-49
383850076205 PREDICTED: ADP-ribosylation factor-relat 0.984 0.6 0.604 9e-49
332028448205 ADP-ribosylation factor-related protein 0.984 0.6 0.604 1e-48
>gi|156552517|ref|XP_001599319.1| PREDICTED: ADP-ribosylation factor-related protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  203 bits (517), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 108/172 (62%), Positives = 117/172 (68%), Gaps = 49/172 (28%)

Query: 1   MYTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLN 60
           MYTL+SGFYKY+++KDEF +LILGLDNAGKTTYLE+AKTKFTKNYKGMNPSKITTTVGLN
Sbjct: 1   MYTLLSGFYKYLVQKDEFFILILGLDNAGKTTYLEAAKTKFTKNYKGMNPSKITTTVGLN 60

Query: 61  IGQIDINTVRLNFWDLGGQLELQSLWDK-------------------------------- 88
           IG+ID   +RLNFWDLGGQ ELQSLWDK                                
Sbjct: 61  IGKIDTAGIRLNFWDLGGQEELQSLWDKYYAESHAVIYIVDSSDRDRIPVSKETFDKVIS 120

Query: 89  ----------------DIRDCMGVREVKPIFNKNSAHLIGRRDCMVMPVSAL 124
                           DI DCMGVREVKPIFN+N AHLIGRRDCMVMPVSAL
Sbjct: 121 SEHLQGVPLLVLANKQDIDDCMGVREVKPIFNQN-AHLIGRRDCMVMPVSAL 171




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312375482|gb|EFR22848.1| hypothetical protein AND_14113 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|157126089|ref|XP_001654530.1| ARL3, putative [Aedes aegypti] gi|108873374|gb|EAT37599.1| AAEL010423-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|31212513|ref|XP_315241.1| AGAP004586-PA [Anopheles gambiae str. PEST] gi|347972205|ref|XP_003436856.1| AGAP004586-PB [Anopheles gambiae str. PEST] gi|21298433|gb|EAA10578.1| AGAP004586-PA [Anopheles gambiae str. PEST] gi|333469359|gb|EGK97267.1| AGAP004586-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170050739|ref|XP_001861447.1| ADP-ribosylation factor [Culex quinquefasciatus] gi|167872249|gb|EDS35632.1| ADP-ribosylation factor [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|189240847|ref|XP_001812473.1| PREDICTED: similar to AGAP004586-PA [Tribolium castaneum] gi|270013511|gb|EFA09959.1| hypothetical protein TcasGA2_TC012116 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|66554170|ref|XP_392858.2| PREDICTED: ADP-ribosylation factor-related protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|332373066|gb|AEE61674.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|383850076|ref|XP_003700643.1| PREDICTED: ADP-ribosylation factor-related protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332028448|gb|EGI68491.1| ADP-ribosylation factor-related protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
FB|FBgn0030088200 CG7039 [Drosophila melanogaste 0.768 0.48 0.770 1.8e-48
UNIPROTKB|Q32LJ2201 ARFRP1 "ADP-ribosylation facto 0.768 0.477 0.739 2.2e-42
ZFIN|ZDB-GENE-050227-14201 arfrp1 "ADP-ribosylation facto 0.768 0.477 0.739 2.8e-42
UNIPROTKB|Q13795201 ARFRP1 "ADP-ribosylation facto 0.768 0.477 0.729 7.5e-42
MGI|MGI:1923938201 Arfrp1 "ADP-ribosylation facto 0.768 0.477 0.729 9.5e-42
RGD|621683201 Arfrp1 "ADP-ribosylation facto 0.768 0.477 0.729 9.5e-42
UNIPROTKB|E1C1J0201 ARFRP1 "Uncharacterized protei 0.768 0.477 0.718 2.8e-40
UNIPROTKB|J9P4D5201 ARFRP1 "Uncharacterized protei 0.768 0.477 0.697 3.2e-39
WB|WBGene00021841191 Y54E10BR.2 [Caenorhabditis ele 0.688 0.450 0.546 4.4e-25
SGD|S000005972198 ARL3 "GTPase of the Ras superf 0.752 0.474 0.422 1.2e-24
FB|FBgn0030088 CG7039 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 403 (146.9 bits), Expect = 1.8e-48, Sum P(2) = 1.8e-48
 Identities = 74/96 (77%), Positives = 85/96 (88%)

Query:     1 MYTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLN 60
             MYTL+ GFYKYM +KD++CV+ILGLDNAGKTTYLE+AKT FT+NYKG+NPSKITTTVGLN
Sbjct:     1 MYTLMHGFYKYMTQKDDYCVVILGLDNAGKTTYLEAAKTTFTRNYKGLNPSKITTTVGLN 60

Query:    61 IGQIDINTVRLNFWDLGGQLELQSLWDKDIRDCMGV 96
             IG ID+  VRLNFWDLGGQ ELQSLWDK  ++  GV
Sbjct:    61 IGTIDVQGVRLNFWDLGGQQELQSLWDKYYQESHGV 96


GO:0003924 "GTPase activity" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005525 "GTP binding" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
UNIPROTKB|Q32LJ2 ARFRP1 "ADP-ribosylation factor-related protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050227-14 arfrp1 "ADP-ribosylation factor related protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q13795 ARFRP1 "ADP-ribosylation factor-related protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1923938 Arfrp1 "ADP-ribosylation factor related protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621683 Arfrp1 "ADP-ribosylation factor related protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1J0 ARFRP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P4D5 ARFRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00021841 Y54E10BR.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
SGD|S000005972 ARL3 "GTPase of the Ras superfamily required to recruit Arl1p to the Golgi" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q63055ARFRP_RATNo assigned EC number0.46820.9920.6169yesN/A
Q02804ARL3_YEASTNo assigned EC number0.32750.9760.6161yesN/A
Q5R579ARFRP_PONABNo assigned EC number0.46820.9920.6169yesN/A
Q8BXL7ARFRP_MOUSENo assigned EC number0.46820.9920.6169yesN/A
Q32LJ2ARFRP_BOVINNo assigned EC number0.47970.9920.6169yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
cd04160168 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) 2e-53
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 5e-18
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 2e-15
cd04154173 cd04154, Arl2, Arf-like 2 (Arl2) GTPase 2e-15
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 3e-13
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 5e-12
cd04149168 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) 2e-10
cd04151158 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) 5e-10
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 1e-09
cd04157162 cd04157, Arl6, Arf-like 6 (Arl6) GTPase 3e-09
smart00177175 smart00177, ARF, ARF-like small GTPases; ARF, ADP- 6e-09
COG1100 219 COG1100, COG1100, GTPase SAR1 and related small G 2e-08
cd04152183 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) 2e-08
PLN00223181 PLN00223, PLN00223, ADP-ribosylation factor; Provi 3e-08
PTZ00133182 PTZ00133, PTZ00133, ADP-ribosylation factor; Provi 4e-08
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 2e-07
cd00879191 cd00879, Sar1, Sar1 is an essential component of C 2e-07
cd04150159 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A 7e-07
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 1e-06
cd04158169 cd04158, ARD1, (ADP-ribosylation factor domain pro 1e-06
cd04162164 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp 3e-06
smart00178184 smart00178, SAR, Sar1p-like members of the Ras-fam 1e-05
cd04161167 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (A 2e-05
pfam08477116 pfam08477, Miro, Miro-like protein 1e-04
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 5e-04
cd09914161 cd09914, RocCOR, Ras of complex proteins (Roc) C-t 0.002
PLN03071 219 PLN03071, PLN03071, GTP-binding nuclear protein Ra 0.003
cd00877166 cd00877, Ran, Ras-related nuclear proteins (Ran)/T 0.004
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 0.004
>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) Back     alignment and domain information
 Score =  165 bits (419), Expect = 2e-53
 Identities = 74/155 (47%), Positives = 86/155 (55%), Gaps = 49/155 (31%)

Query: 19  CVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQIDINTVRLNFWDLGG 78
           CVLILGLDNAGKTT+LE  KTKF+KNYKG+NPSKIT TVGLNIG I++   RL FWDLGG
Sbjct: 1   CVLILGLDNAGKTTFLEQTKTKFSKNYKGLNPSKITPTVGLNIGTIEVGKARLMFWDLGG 60

Query: 79  QLELQSLWDK------------------------------------------------DI 90
           Q EL+SLWDK                                                D+
Sbjct: 61  QEELRSLWDKYYAESHGVIYVIDSTDRERFNESKSAFEKVINNEALEGVPLLVLANKQDL 120

Query: 91  RDCMGVREVKPIFNKNSAHLIGRRDCMVMPVSALT 125
            D + V E+K +F+     LIGRRDC+V PVSAL 
Sbjct: 121 PDALSVAEIKEVFDD-CIALIGRRDCLVQPVSALE 154


Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif. Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes. It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network. Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D. Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development. Length = 168

>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) Back     alignment and domain information
>gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase Back     alignment and domain information
>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases Back     alignment and domain information
>gnl|CDD|165788 PLN00223, PLN00223, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|206645 cd00879, Sar1, Sar1 is an essential component of COPII vesicle coats Back     alignment and domain information
>gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) Back     alignment and domain information
>gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp2-like GTPase Back     alignment and domain information
>gnl|CDD|197556 smart00178, SAR, Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>gnl|CDD|133361 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (Arl2l1) and Arl13 Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206741 cd09914, RocCOR, Ras of complex proteins (Roc) C-terminal of Roc (COR) domain family Back     alignment and domain information
>gnl|CDD|178620 PLN03071, PLN03071, GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>gnl|CDD|206643 cd00877, Ran, Ras-related nuclear proteins (Ran)/TC4 family of small GTPases Back     alignment and domain information
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
KOG0071|consensus180 99.93
KOG0094|consensus221 99.93
KOG0070|consensus181 99.93
KOG0084|consensus205 99.91
KOG0076|consensus197 99.9
KOG0092|consensus200 99.88
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.88
KOG0087|consensus222 99.88
KOG0080|consensus209 99.87
KOG0086|consensus214 99.87
KOG0078|consensus207 99.87
KOG0079|consensus198 99.86
PLN00223181 ADP-ribosylation factor; Provisional 99.86
KOG0098|consensus216 99.86
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.85
PTZ00133182 ADP-ribosylation factor; Provisional 99.85
KOG0073|consensus185 99.85
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.84
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.84
KOG0095|consensus213 99.84
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.84
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.83
KOG0394|consensus210 99.83
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.83
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.82
KOG0091|consensus213 99.82
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.82
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.82
cd04174 232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.81
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.81
cd04173 222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.81
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.81
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.81
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.8
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.8
PTZ00369189 Ras-like protein; Provisional 99.8
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.79
KOG0393|consensus198 99.79
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.79
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.79
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.79
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.79
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.78
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.78
PLN00023 334 GTP-binding protein; Provisional 99.78
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.78
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.78
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.78
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.78
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.78
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.78
KOG0093|consensus193 99.78
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.77
KOG0075|consensus186 99.77
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.77
KOG0081|consensus219 99.77
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.77
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.77
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.77
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.77
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.77
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.77
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.76
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.76
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.76
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.76
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.76
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.75
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.75
cd04126 220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.75
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.75
KOG0088|consensus218 99.75
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.75
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.75
PLN03110216 Rab GTPase; Provisional 99.75
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.75
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.75
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.74
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.74
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.74
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.74
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.74
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.74
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.74
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.74
KOG0074|consensus185 99.73
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.73
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.73
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.73
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.73
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.73
KOG0097|consensus215 99.72
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.72
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.72
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.72
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.72
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.71
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.71
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.71
cd04143 247 Rhes_like Rhes_like subfamily. This subfamily incl 99.71
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.71
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.71
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.71
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.7
PLN03108210 Rab family protein; Provisional 99.7
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.69
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.69
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.68
KOG0083|consensus192 99.68
KOG0072|consensus182 99.68
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.67
PLN03118211 Rab family protein; Provisional 99.67
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.67
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.67
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.67
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.67
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.66
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.65
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.65
KOG0395|consensus196 99.65
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.65
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.65
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.64
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.63
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.63
COG1100219 GTPase SAR1 and related small G proteins [General 99.63
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.63
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.62
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.61
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.61
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.61
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.6
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.57
cd04148 221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.57
KOG4252|consensus 246 99.55
KOG0096|consensus216 99.51
KOG1673|consensus205 99.49
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.48
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.43
cd04105203 SR_beta Signal recognition particle receptor, beta 99.38
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.37
PRK15494 339 era GTPase Era; Provisional 99.37
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.36
KOG0077|consensus193 99.34
COG2229187 Predicted GTPase [General function prediction only 99.32
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.32
TIGR00450 442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.29
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.29
PRK04213201 GTP-binding protein; Provisional 99.27
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.26
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.23
KOG4423|consensus229 99.23
cd00881189 GTP_translation_factor GTP translation factor fami 99.22
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.21
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.19
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.18
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.17
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.17
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.16
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.15
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.14
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.13
PRK03003 472 GTP-binding protein Der; Reviewed 99.13
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.11
KOG3883|consensus198 99.08
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.08
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.08
PRK05291 449 trmE tRNA modification GTPase TrmE; Reviewed 99.06
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.05
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.05
PRK05306 787 infB translation initiation factor IF-2; Validated 99.04
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.04
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.04
PRK00093 435 GTP-binding protein Der; Reviewed 99.03
PRK03003 472 GTP-binding protein Der; Reviewed 99.02
PRK12299335 obgE GTPase CgtA; Reviewed 99.02
PTZ00099176 rab6; Provisional 99.01
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 98.99
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 98.99
TIGR00436 270 era GTP-binding protein Era. Era is an essential G 98.99
KOG1707|consensus 625 98.98
PRK11058 426 GTPase HflX; Provisional 98.98
PRK12317 425 elongation factor 1-alpha; Reviewed 98.98
PRK10218 607 GTP-binding protein; Provisional 98.98
CHL00189 742 infB translation initiation factor 2; Provisional 98.98
cd01896 233 DRG The developmentally regulated GTP-binding prot 98.98
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 98.95
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.95
cd01850 276 CDC_Septin CDC/Septin. Septins are a conserved fam 98.94
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 98.94
PRK00093 435 GTP-binding protein Der; Reviewed 98.93
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.93
PF04670 232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.92
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.9
PRK00089 292 era GTPase Era; Reviewed 98.88
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.87
COG1160 444 Predicted GTPases [General function prediction onl 98.87
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.85
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.84
PRK12297 424 obgE GTPase CgtA; Reviewed 98.84
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 98.83
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 98.82
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.82
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 98.81
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.81
PF09439181 SRPRB: Signal recognition particle receptor beta s 98.8
cd01853 249 Toc34_like Toc34-like (Translocon at the Outer-env 98.79
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.79
PRK04000 411 translation initiation factor IF-2 subunit gamma; 98.78
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.77
PRK12296 500 obgE GTPase CgtA; Reviewed 98.76
cd04168 237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.75
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.75
TIGR00485 394 EF-Tu translation elongation factor TU. This align 98.74
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.74
smart00275 342 G_alpha G protein alpha subunit. Subunit of G prot 98.72
KOG0090|consensus238 98.7
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 98.69
PLN03126 478 Elongation factor Tu; Provisional 98.69
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.69
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.69
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 98.67
COG1159 298 Era GTPase [General function prediction only] 98.67
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 98.66
cd04169 267 RF3 RF3 subfamily. Peptide chain release factor 3 98.66
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.66
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.66
PRK12736 394 elongation factor Tu; Reviewed 98.66
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 98.65
COG0486 454 ThdF Predicted GTPase [General function prediction 98.65
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 98.65
cd04165 224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.64
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.64
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 98.63
PRK12735 396 elongation factor Tu; Reviewed 98.62
cd04170 268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.62
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.61
TIGR00991 313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.61
PRK13351 687 elongation factor G; Reviewed 98.6
PF04548 212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.6
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 98.59
COG1084346 Predicted GTPase [General function prediction only 98.58
PRK04004 586 translation initiation factor IF-2; Validated 98.58
CHL00071 409 tufA elongation factor Tu 98.55
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.54
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.53
COG1160 444 Predicted GTPases [General function prediction onl 98.53
PRK00049 396 elongation factor Tu; Reviewed 98.52
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.52
PRK12298 390 obgE GTPase CgtA; Reviewed 98.51
PRK05433 600 GTP-binding protein LepA; Provisional 98.48
PF00735 281 Septin: Septin; InterPro: IPR000038 Septins consti 98.48
PRK09563287 rbgA GTPase YlqF; Reviewed 98.45
PTZ00141 446 elongation factor 1- alpha; Provisional 98.44
cd01886 270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.44
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.44
KOG1191|consensus 531 98.42
COG3596 296 Predicted GTPase [General function prediction only 98.42
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 98.4
PRK09602 396 translation-associated GTPase; Reviewed 98.38
KOG1423|consensus 379 98.36
PLN00043 447 elongation factor 1-alpha; Provisional 98.35
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 98.33
cd01899 318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.32
COG1161322 Predicted GTPases [General function prediction onl 98.31
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.3
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 98.29
cd01885 222 EF2 EF2 (for archaea and eukarya). Translocation r 98.29
PLN03127 447 Elongation factor Tu; Provisional 98.29
PRK00741 526 prfC peptide chain release factor 3; Provisional 98.29
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 98.27
KOG0082|consensus 354 98.25
COG5019 373 CDC3 Septin family protein [Cell division and chro 98.23
COG0218200 Predicted GTPase [General function prediction only 98.2
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.17
TIGR00503 527 prfC peptide chain release factor 3. This translat 98.16
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.13
PRK09601 364 GTP-binding protein YchF; Reviewed 98.13
PRK12289352 GTPase RsgA; Reviewed 98.11
KOG2655|consensus 366 98.09
cd01900 274 YchF YchF subfamily. YchF is a member of the Obg f 98.08
PTZ00258 390 GTP-binding protein; Provisional 98.08
KOG3905|consensus 473 98.08
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.08
PRK12288347 GTPase RsgA; Reviewed 98.06
COG1163 365 DRG Predicted GTPase [General function prediction 98.0
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.0
KOG3886|consensus 295 97.99
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 97.92
KOG1547|consensus 336 97.88
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 97.88
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 97.87
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.86
PRK12739 691 elongation factor G; Reviewed 97.84
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.82
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.82
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.8
PRK13796365 GTPase YqeH; Provisional 97.79
PRK12740 668 elongation factor G; Reviewed 97.74
cd01851 224 GBP Guanylate-binding protein (GBP), N-terminal do 97.73
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.7
KOG1145|consensus 683 97.67
PRK00098298 GTPase RsgA; Reviewed 97.67
PRK00007 693 elongation factor G; Reviewed 97.63
COG4917148 EutP Ethanolamine utilization protein [Amino acid 97.62
PRK08118167 topology modulation protein; Reviewed 97.59
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 97.59
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 97.58
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.57
KOG1707|consensus625 97.52
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.51
PRK07261171 topology modulation protein; Provisional 97.48
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 97.48
COG1162301 Predicted GTPases [General function prediction onl 97.46
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 97.46
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.45
PRK06547172 hypothetical protein; Provisional 97.43
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 97.36
cd03116159 MobB Molybdenum is an essential trace element in t 97.35
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.34
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 97.34
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.28
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.27
PRK06217183 hypothetical protein; Validated 97.26
KOG1486|consensus 364 97.25
COG0012 372 Predicted GTPase, probable translation factor [Tra 97.24
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.23
KOG3859|consensus 406 97.22
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.2
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.2
KOG1489|consensus366 97.2
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.19
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 97.19
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.18
COG4525 259 TauB ABC-type taurine transport system, ATPase com 97.18
smart00382148 AAA ATPases associated with a variety of cellular 97.17
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 97.17
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.16
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 97.15
PF00004132 AAA: ATPase family associated with various cellula 97.15
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 97.12
COG2262 411 HflX GTPases [General function prediction only] 97.12
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 97.11
PRK05480209 uridine/cytidine kinase; Provisional 97.11
PRK00300205 gmk guanylate kinase; Provisional 97.09
PLN00116 843 translation elongation factor EF-2 subunit; Provis 97.07
COG3638 258 ABC-type phosphate/phosphonate transport system, A 97.07
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 97.07
PRK14530 215 adenylate kinase; Provisional 97.07
PRK03839180 putative kinase; Provisional 97.07
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 97.06
PRK14737186 gmk guanylate kinase; Provisional 97.06
PF1355562 AAA_29: P-loop containing region of AAA domain 97.05
PRK14532188 adenylate kinase; Provisional 97.05
TIGR00101199 ureG urease accessory protein UreG. This model rep 97.04
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 97.04
PRK08233182 hypothetical protein; Provisional 97.03
PHA00729 226 NTP-binding motif containing protein 97.02
KOG1532|consensus 366 97.02
PRK14531183 adenylate kinase; Provisional 97.02
COG4107 258 PhnK ABC-type phosphonate transport system, ATPase 97.01
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 97.0
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.99
PRK14738206 gmk guanylate kinase; Provisional 96.99
PRK02496184 adk adenylate kinase; Provisional 96.98
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.98
COG4987 573 CydC ABC-type transport system involved in cytochr 96.98
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.98
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.96
PTZ00088 229 adenylate kinase 1; Provisional 96.96
KOG2484|consensus435 96.94
TIGR01351 210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 96.94
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.93
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 96.93
KOG1491|consensus 391 96.92
PTZ00416 836 elongation factor 2; Provisional 96.92
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 96.91
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.91
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 96.91
KOG0099|consensus 379 96.91
PF05729166 NACHT: NACHT domain 96.91
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 96.9
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 96.89
PRK13949169 shikimate kinase; Provisional 96.89
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 96.89
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.88
PF13479 213 AAA_24: AAA domain 96.88
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 96.87
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.87
PF03029 238 ATP_bind_1: Conserved hypothetical ATP binding pro 96.86
PLN02200234 adenylate kinase family protein 96.86
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 96.85
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 96.85
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 96.84
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 96.83
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 96.83
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 96.83
PLN02674 244 adenylate kinase 96.83
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 96.83
PRK07560 731 elongation factor EF-2; Reviewed 96.82
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 96.82
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 96.82
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 96.82
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 96.82
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 96.81
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 96.81
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 96.81
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 96.81
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 96.81
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 96.8
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 96.79
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 96.79
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 96.79
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 96.79
cd03269210 ABC_putative_ATPase This subfamily is involved in 96.79
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 96.78
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 96.78
PRK09270229 nucleoside triphosphate hydrolase domain-containin 96.77
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 96.77
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 96.77
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 96.77
PRK13695174 putative NTPase; Provisional 96.75
COG4559 259 ABC-type hemin transport system, ATPase component 96.75
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 96.75
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 96.74
KOG3887|consensus 347 96.74
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 96.74
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 96.74
PRK10908222 cell division protein FtsE; Provisional 96.74
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 96.74
cd03216163 ABC_Carb_Monos_I This family represents the domain 96.74
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 96.74
PRK05057172 aroK shikimate kinase I; Reviewed 96.73
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 96.73
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 96.73
PRK14528186 adenylate kinase; Provisional 96.73
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 96.73
PRK00279 215 adk adenylate kinase; Reviewed 96.72
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 96.72
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 96.72
PRK14529 223 adenylate kinase; Provisional 96.72
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 96.72
cd03215182 ABC_Carb_Monos_II This family represents domain II 96.72
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 96.71
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 96.71
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 96.71
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 96.71
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 96.7
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 96.7
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 96.7
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 96.7
COG4619223 ABC-type uncharacterized transport system, ATPase 96.7
PRK06762166 hypothetical protein; Provisional 96.7
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 96.7
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 96.69
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 96.69
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 96.69
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 96.69
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 96.68
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 96.68
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.67
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 96.67
PRK08099399 bifunctional DNA-binding transcriptional repressor 96.67
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 96.67
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 96.67
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 96.66
KOG2485|consensus335 96.66
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 96.66
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 96.66
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 96.66
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 96.65
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 96.65
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.65
PLN02459 261 probable adenylate kinase 96.65
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 96.65
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.64
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 96.64
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.64
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 96.64
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 96.64
cd03246173 ABCC_Protease_Secretion This family represents the 96.64
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 96.64
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 96.64
KOG3347|consensus176 96.63
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 96.63
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 96.62
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.62
KOG1490|consensus 620 96.62
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 96.61
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 96.61
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 96.61
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 96.61
cd02025 220 PanK Pantothenate kinase (PanK) catalyzes the phos 96.61
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 96.6
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 96.6
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 96.6
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 96.6
COG1936180 Predicted nucleotide kinase (related to CMP and AM 96.59
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 96.59
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 96.59
>KOG0071|consensus Back     alignment and domain information
Probab=99.93  E-value=9.2e-26  Score=142.82  Aligned_cols=114  Identities=33%  Similarity=0.555  Sum_probs=105.1

Q ss_pred             ChhhHHHHHhhhccCceEEEEEEeCCCCcHHHHHHHHhhccccccCCCCCCccccccceeeEEEEeCCEEEEEEECCCcc
Q psy9521           1 MYTLVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQIDINTVRLNFWDLGGQL   80 (125)
Q Consensus         1 m~~~~~~~~~~~~~~~~~ki~v~G~~~~GKTsl~~~i~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~i~D~~G~~   80 (125)
                      |++.++.++.++|.+++++|+++|..++||||++..++-+.+....        ||+|++++++..+++.|++||++||+
T Consensus         1 Mgn~~sk~~~k~f~~KE~~ilmlGLd~aGKTtiLyKLkl~~~~~~i--------pTvGFnvetVtykN~kfNvwdvGGqd   72 (180)
T KOG0071|consen    1 MGNYMSKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTI--------PTVGFNVETVTYKNVKFNVWDVGGQD   72 (180)
T ss_pred             CcchHHHHHHHHhCcccceEEEEecccCCceehhhHHhcCCCcccc--------cccceeEEEEEeeeeEEeeeeccCch
Confidence            8889999999999999999999999999999999997654444444        99999999999999999999999999


Q ss_pred             cccccccc------------------------------------------------cccCccCHHHHHHHHhhhcccccC
Q psy9521          81 ELQSLWDK------------------------------------------------DIRDCMGVREVKPIFNKNSAHLIG  112 (125)
Q Consensus        81 ~~~~~~~~------------------------------------------------Di~~~~s~~~i~~~l~~~~~~~~~  112 (125)
                      +.|.+|..                                                |++++.+..+|++++++-   .+.
T Consensus        73 ~iRplWrhYy~gtqglIFV~Dsa~~dr~eeAr~ELh~ii~~~em~~~~~LvlANkQDlp~A~~pqei~d~leLe---~~r  149 (180)
T KOG0071|consen   73 KIRPLWRHYYTGTQGLIFVVDSADRDRIEEARNELHRIINDREMRDAIILILANKQDLPDAMKPQEIQDKLELE---RIR  149 (180)
T ss_pred             hhhHHHHhhccCCceEEEEEeccchhhHHHHHHHHHHHhCCHhhhcceEEEEecCcccccccCHHHHHHHhccc---ccc
Confidence            99999998                                                999999999999999986   689


Q ss_pred             CCCeEEEEeeccC
Q psy9521         113 RRDCMVMPVSALT  125 (125)
Q Consensus       113 ~~~~~i~~~sA~~  125 (125)
                      +++|.+++|||.+
T Consensus       150 ~~~W~vqp~~a~~  162 (180)
T KOG0071|consen  150 DRNWYVQPSCALS  162 (180)
T ss_pred             CCccEeecccccc
Confidence            9999999999974



>KOG0094|consensus Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0087|consensus Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>KOG0095|consensus Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>KOG0091|consensus Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>KOG0393|consensus Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>KOG0081|consensus Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>KOG0097|consensus Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>KOG4252|consensus Back     alignment and domain information
>KOG0096|consensus Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>KOG4423|consensus Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>KOG0082|consensus Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG2655|consensus Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>KOG3905|consensus Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>KOG3859|consensus Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>KOG0099|consensus Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>KOG3887|consensus Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
1ksh_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Nati 3e-09
1ksg_A186 Complex Of Arl2 And Pde Delta, Crystal Form 1 Lengt 3e-09
3doe_A192 Complex Of Arl2 And Bart, Crystal Form 1 Length = 1 3e-09
4goj_A189 The Crystal Structure Of Full Length Arl3gppnhp In 3e-08
1fzq_A181 Crystal Structure Of Murine Arl3-Gdp Length = 181 3e-08
3bh7_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 5e-08
1z6y_A179 Structure Of Human Adp-Ribosylation Factor-Like 5 L 7e-08
1zj6_A187 Crystal Structure Of Human Arl5 Length = 187 7e-08
2h16_A183 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 8e-08
3lvr_E497 The Crystal Structure Of Asap3 In Complex With Arf6 9e-08
2h17_A181 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 9e-08
4gok_B169 The Crystal Structure Of Arl2gppnhp In Complex With 1e-07
3bh6_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 4e-07
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 7e-07
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 8e-07
1rrg_A181 Non-Myristoylated Rat Adp-Ribosylation Factor-1 Com 1e-06
1moz_A183 Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharo 1e-06
2h18_A193 Structure Of Human Adp-Ribosylation Factor-Like 10b 1e-06
2a5d_A175 Structural Basis For The Activation Of Cholera Toxi 1e-06
1e0s_A174 Small G Protein Arf6-Gdp Length = 174 1e-06
3lrp_A181 Crystal Structure Of Plasmodium Falciparum Adp-Ribo 1e-06
1hur_A180 Human Adp-Ribosylation Factor 1 Complexed With Gdp, 2e-06
1ksj_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Seme 2e-06
3n5c_A162 Crystal Structure Of Arf6delta13 Complexed With Gdp 3e-06
4fme_C160 Espg-Rab1-Arf6 Complex Length = 160 3e-06
3tjz_A164 Crystal Structure Of Arf1 Bound To The GammaZETA-Co 3e-06
3aq4_A184 Molecular Insights Into Plant Cell Proliferation Di 4e-06
3pcr_B162 Structure Of Espg-Arf6 Complex Length = 162 6e-06
1yzg_A179 Structure Of Human Adp-ribosylation Factor-like 8 L 7e-06
2al7_A186 Structure Of Human Adp-Ribosylation Factor-Like 10c 8e-06
1z6x_A180 Structure Of Human Adp-Ribosylation Factor 4 Length 8e-06
1zd9_A188 Structure Of Human Adp-Ribosylation Factor-Like 10b 8e-06
1r4a_A165 Crystal Structure Of Gtp-Bound Adp-Ribosylation Fac 1e-05
3o47_A329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 1e-05
3vhx_A172 The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesi 1e-05
2a5g_A175 Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length 1e-05
2w83_A165 Crystal Structure Of The Arf6 Gtpase In Complex Wit 1e-05
2ksq_A181 The Myristoylated Yeast Arf1 In A Gtp And Bicelle B 3e-05
3rd1_A178 Structure Of An Adp Ribosylation Factor From Entamo 3e-05
2b6h_A192 Structure Of Human Adp-Ribosylation Factor 5 Length 5e-05
1re0_A164 Structure Of Arf1-Gdp Bound To Sec7 Domain Complexe 7e-05
4bas_A199 Structure Of The Arl6 Bbs3 Small Gtpase From Trypan 8e-05
4dcn_A166 Crystal Structure Analysis Of The Arfaptin2 Bar Dom 1e-04
1upt_A171 Structure Of A Complex Of The Golgin-245 Grip Domai 2e-04
2qtv_B167 Structure Of Sec23-Sar1 Complexed With The Active F 2e-04
1m2o_B190 Crystal Structure Of The Sec23-Sar1 Complex Length 3e-04
2h57_A190 Crystal Structure Of Human Adp-Ribosylation Factor- 3e-04
2y8e_A179 Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo 5e-04
1j2j_A166 Crystal Structure Of Gga1 Gat N-terminal Region In 7e-04
>pdb|1KSH|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Native) Length = 186 Back     alignment and structure

Iteration: 1

Score = 57.0 bits (136), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 32/83 (38%), Positives = 47/83 (56%), Gaps = 8/83 (9%) Query: 4 LVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQ 63 L++ K ++ E +L+LGLDNAGKTT L K + G + I+ T+G NI Sbjct: 5 LLTILKKMKQKERELRLLMLGLDNAGKTTIL--------KKFNGEDVDTISPTLGFNIKT 56 Query: 64 IDINTVRLNFWDLGGQLELQSLW 86 ++ +LN WD+GGQ L+S W Sbjct: 57 LEHRGFKLNIWDVGGQKSLRSYW 79
>pdb|1KSG|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 1 Length = 186 Back     alignment and structure
>pdb|3DOE|A Chain A, Complex Of Arl2 And Bart, Crystal Form 1 Length = 192 Back     alignment and structure
>pdb|4GOJ|A Chain A, The Crystal Structure Of Full Length Arl3gppnhp In Complex With Unc119a Length = 189 Back     alignment and structure
>pdb|1FZQ|A Chain A, Crystal Structure Of Murine Arl3-Gdp Length = 181 Back     alignment and structure
>pdb|3BH7|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gdp-Alf4 Length = 164 Back     alignment and structure
>pdb|1Z6Y|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 Length = 179 Back     alignment and structure
>pdb|1ZJ6|A Chain A, Crystal Structure Of Human Arl5 Length = 187 Back     alignment and structure
>pdb|2H16|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) Length = 183 Back     alignment and structure
>pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Soaked With Calcium Length = 497 Back     alignment and structure
>pdb|2H17|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) (Casp Target) Length = 181 Back     alignment and structure
>pdb|4GOK|B Chain B, The Crystal Structure Of Arl2gppnhp In Complex With Unc119a Length = 169 Back     alignment and structure
>pdb|3BH6|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gppnhp Length = 164 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|1RRG|A Chain A, Non-Myristoylated Rat Adp-Ribosylation Factor-1 Complexed With Gdp, Dimeric Crystal Form Length = 181 Back     alignment and structure
>pdb|1MOZ|A Chain A, Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharomyces Cerevisiae Length = 183 Back     alignment and structure
>pdb|2H18|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b (Arl10b) Length = 193 Back     alignment and structure
>pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By Human Arf6-Gtp Length = 175 Back     alignment and structure
>pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp Length = 174 Back     alignment and structure
>pdb|3LRP|A Chain A, Crystal Structure Of Plasmodium Falciparum Adp-Ribosylation Factor 1 Length = 181 Back     alignment and structure
>pdb|1HUR|A Chain A, Human Adp-Ribosylation Factor 1 Complexed With Gdp, Full Length = 180 Back     alignment and structure
>pdb|1KSJ|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Semet) Length = 186 Back     alignment and structure
>pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta13 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex Length = 160 Back     alignment and structure
>pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 Back     alignment and structure
>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance By Agrobacterium Protein 6b Length = 184 Back     alignment and structure
>pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex Length = 162 Back     alignment and structure
>pdb|1YZG|A Chain A, Structure Of Human Adp-ribosylation Factor-like 8 Length = 179 Back     alignment and structure
>pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 Back     alignment and structure
>pdb|1Z6X|A Chain A, Structure Of Human Adp-Ribosylation Factor 4 Length = 180 Back     alignment and structure
>pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 Back     alignment and structure
>pdb|1R4A|A Chain A, Crystal Structure Of Gtp-Bound Adp-Ribosylation Factor Like Protein 1 (Arl1) And Grip Domain Of Golgin245 Complex Length = 165 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|3VHX|A Chain A, The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesin-Like Protein 1) Complex Length = 172 Back     alignment and structure
>pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length = 175 Back     alignment and structure
>pdb|2W83|A Chain A, Crystal Structure Of The Arf6 Gtpase In Complex With A Specific Effector, Jip4 Length = 165 Back     alignment and structure
>pdb|2KSQ|A Chain A, The Myristoylated Yeast Arf1 In A Gtp And Bicelle Bound Conformation Length = 181 Back     alignment and structure
>pdb|3RD1|A Chain A, Structure Of An Adp Ribosylation Factor From Entamoeba Histolytica Hm- 1:imss Bound To Mg-Gdp Length = 178 Back     alignment and structure
>pdb|2B6H|A Chain A, Structure Of Human Adp-Ribosylation Factor 5 Length = 192 Back     alignment and structure
>pdb|1RE0|A Chain A, Structure Of Arf1-Gdp Bound To Sec7 Domain Complexed With Brefeldin A Length = 164 Back     alignment and structure
>pdb|4BAS|A Chain A, Structure Of The Arl6 Bbs3 Small Gtpase From Trypanosoma Brucei With Bound Nucleotide Analogue Gppnp Length = 199 Back     alignment and structure
>pdb|4DCN|A Chain A, Crystal Structure Analysis Of The Arfaptin2 Bar Domain In Complex With Arl1 Length = 166 Back     alignment and structure
>pdb|1UPT|A Chain A, Structure Of A Complex Of The Golgin-245 Grip Domain With Arl1 Length = 171 Back     alignment and structure
>pdb|2QTV|B Chain B, Structure Of Sec23-Sar1 Complexed With The Active Fragment Of Sec31 Length = 167 Back     alignment and structure
>pdb|1M2O|B Chain B, Crystal Structure Of The Sec23-Sar1 Complex Length = 190 Back     alignment and structure
>pdb|2H57|A Chain A, Crystal Structure Of Human Adp-Ribosylation Factor-Like 6 Length = 190 Back     alignment and structure
>pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 Back     alignment and structure
>pdb|1J2J|A Chain A, Crystal Structure Of Gga1 Gat N-terminal Region In Complex With Arf1 Gtp Form Length = 166 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 3e-26
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 2e-24
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 3e-24
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 4e-24
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 1e-23
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 5e-23
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 5e-23
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 4e-21
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 8e-21
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 3e-20
3t1o_A198 Gliding protein MGLA; G domain containing protein, 5e-20
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 4e-19
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 8e-19
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 7e-18
2fh5_B 214 SR-beta, signal recognition particle receptor beta 3e-12
2ged_A193 SR-beta, signal recognition particle receptor beta 4e-11
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-11
1nrj_B 218 SR-beta, signal recognition particle receptor beta 9e-11
3o47_A329 ADP-ribosylation factor GTPase-activating protein 3e-10
3llu_A196 RAS-related GTP-binding protein C; structural geno 5e-09
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 5e-08
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3gj0_A 221 GTP-binding nuclear protein RAN; G protein, GDP, a 4e-04
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
 Score = 95.4 bits (238), Expect = 3e-26
 Identities = 38/170 (22%), Positives = 60/170 (35%), Gaps = 59/170 (34%)

Query: 4   LVSGFYKYMLRKDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQ 63
           L++   K   ++ E  +L+LGLDNAGKTT L        K + G +   I+ T+G NI  
Sbjct: 5   LLTILKKMKQKERELRLLMLGLDNAGKTTIL--------KKFNGEDVDTISPTLGFNIKT 56

Query: 64  IDINTVRLNFWDLGGQLELQSLWDK----------------------------------- 88
           ++    +LN WD+GGQ  L+S W                                     
Sbjct: 57  LEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEER 116

Query: 89  -------------DIRDCMGVREVKPIFNKNSAHLIGRRDCMVMPVSALT 125
                        D+   +    ++     +S   I      +   SA+T
Sbjct: 117 LAGATLLIFANKQDLPGALSCNAIQEALELDS---IRSHHWRIQGCSAVT 163


>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.89
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.87
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.87
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.85
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.84
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.83
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.83
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.82
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.81
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.79
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.78
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.76
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.76
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.76
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.76
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.76
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.76
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.75
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.75
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.75
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.74
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.74
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.74
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.74
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.74
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.74
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.74
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.74
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.74
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.74
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.73
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.73
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.73
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.73
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.73
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.73
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.73
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.73
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.73
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.73
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.73
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.73
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.73
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.73
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.73
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.73
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.72
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.72
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.72
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.72
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.72
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.72
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.72
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.72
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.72
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.72
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.72
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.72
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.72
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.72
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.72
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.71
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.71
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.71
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.71
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.71
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.71
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.71
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.71
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.71
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.71
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.7
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.7
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.7
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.7
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.7
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.7
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.7
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.7
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.7
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.69
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.69
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.69
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.68
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.68
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.68
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.68
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.68
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.67
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.67
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.66
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.66
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.66
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.66
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 99.65
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.64
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.64
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.64
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.64
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.64
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.43
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.62
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.61
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.6
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.59
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.58
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.53
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.5
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.49
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.47
2ged_A193 SR-beta, signal recognition particle receptor beta 99.46
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.46
4fid_A 340 G protein alpha subunit; RAS-like domain, all-heli 99.44
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.44
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.43
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.41
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.41
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.4
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.38
3a1s_A 258 Iron(II) transport protein B; FEOB, iron transport 99.36
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.35
1azs_C 402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.34
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.32
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.28
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.27
3i8s_A 274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.27
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.25
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 99.25
3k53_A 271 Ferrous iron transport protein B; GTPase fold, hel 99.24
3iby_A 256 Ferrous iron transport protein B; G protein, G dom 99.24
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.23
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.23
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.22
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.21
3b1v_A 272 Ferrous iron uptake transporter protein B; G prote 99.19
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.17
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.17
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.17
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.17
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.16
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.16
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.16
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 99.15
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.15
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.13
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.13
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 99.12
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.12
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.11
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 99.09
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.09
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.08
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.08
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 99.07
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.06
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 99.06
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 99.05
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.05
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.05
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.05
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 99.03
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 99.02
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.0
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 98.98
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 98.93
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.93
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.91
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.91
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.91
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.9
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 98.89
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.85
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.82
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 98.82
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 98.81
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.76
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 98.73
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.73
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.73
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 98.73
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.71
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.7
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.7
1wxq_A 397 GTP-binding protein; structural genomics, riken st 98.69
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.65
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.6
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.56
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 98.55
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.53
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 98.53
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 98.51
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 98.5
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 98.48
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.45
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 98.45
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.43
2dby_A 368 GTP-binding protein; GDP, structural genomics, NPP 98.41
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.29
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 98.28
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.27
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 98.27
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.18
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 97.99
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.89
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 97.73
3sop_A 270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.6
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 97.58
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.48
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.45
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.45
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 97.42
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.4
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 97.37
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.31
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.31
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.3
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.29
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.27
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.26
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.26
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 97.24
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 97.23
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.21
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 97.2
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.2
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.18
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.17
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.13
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 97.12
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.1
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.09
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.08
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.07
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.07
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.06
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 97.06
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.05
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.05
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 97.04
3l82_B 227 F-box only protein 4; TRFH domain, helix, GTPase d 97.04
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 97.04
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.03
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.03
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 97.03
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.01
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.01
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.01
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.01
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.0
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.0
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.0
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.0
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 97.0
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 96.99
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.98
3vaa_A199 Shikimate kinase, SK; structural genomics, center 96.98
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.97
1b0u_A 262 Histidine permease; ABC transporter, transport pro 96.97
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 96.95
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 96.95
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 96.95
1g6h_A 257 High-affinity branched-chain amino acid transport 96.95
1sgw_A214 Putative ABC transporter; structural genomics, P p 96.94
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 96.94
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 96.94
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.93
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.93
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.92
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.92
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.92
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.91
1ji0_A240 ABC transporter; ATP binding protein, structural g 96.91
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 96.9
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.89
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.89
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 96.89
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 96.89
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 96.88
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 96.88
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 96.87
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.87
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.87
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 96.86
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.85
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 96.85
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.85
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.84
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.84
2ghi_A 260 Transport protein; multidrug resistance protein, M 96.84
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 96.84
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.83
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.83
4a74_A231 DNA repair and recombination protein RADA; hydrola 96.83
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 96.83
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 96.81
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 96.81
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.81
2eyu_A 261 Twitching motility protein PILT; pilus retraction 96.81
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 96.79
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.78
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 96.78
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.77
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.77
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 96.77
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.76
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.75
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 96.75
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.75
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.74
1via_A175 Shikimate kinase; structural genomics, transferase 96.74
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.73
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 96.73
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.72
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.71
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 96.71
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 96.71
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 96.71
1gtv_A 214 TMK, thymidylate kinase; transferase, transferase 96.7
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.69
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 96.69
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.68
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.68
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 96.68
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 96.67
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.67
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 96.66
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 96.66
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.66
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 96.66
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 96.66
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 96.65
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.65
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.65
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.65
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.65
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 96.64
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.63
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 96.63
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.63
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.63
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 96.63
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 96.62
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.61
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 96.61
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 96.59
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.59
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.59
3bos_A242 Putative DNA replication factor; P-loop containing 96.58
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 96.58
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 96.58
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.58
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 96.57
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.57
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.55
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 96.55
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 96.54
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.54
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 96.53
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.52
3l2o_B 312 F-box only protein 4; small G protein fold, UBL co 96.52
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 96.51
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 96.51
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.51
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.51
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.5
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 96.49
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.49
1vht_A 218 Dephospho-COA kinase; structural genomics, transfe 96.47
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.46
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 96.46
3kta_A182 Chromosome segregation protein SMC; structural mai 96.46
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.46
2og2_A359 Putative signal recognition particle receptor; nuc 96.45
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.45
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.44
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.44
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.43
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.43
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 96.4
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.39
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.39
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.38
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.36
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.36
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.34
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.33
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 96.32
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.32
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 96.31
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 96.3
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.29
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.27
1p9r_A 418 General secretion pathway protein E; bacterial typ 96.27
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.25
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 96.24
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.23
2ewv_A 372 Twitching motility protein PILT; pilus retraction 96.23
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.2
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.19
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 96.19
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.18
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 96.18
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 96.17
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 96.16
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 96.16
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 96.16
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 96.16
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 96.15
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.12
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.11
1nij_A 318 Hypothetical protein YJIA; structural genomics, P- 96.09
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.08
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 96.08
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.07
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.07
1ltq_A 301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.07
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 96.06
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 96.04
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 96.02
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 96.02
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 96.02
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.01
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 96.0
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 95.98
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 95.97
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.97
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.96
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.96
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 95.95
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 95.94
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 95.93
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.92
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 95.92
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.91
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 95.9
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 95.89
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 95.88
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 95.88
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 95.87
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 95.86
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 95.86
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 95.85
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 95.84
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 95.84
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.83
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.82
1vma_A306 Cell division protein FTSY; TM0570, structural gen 95.82
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 95.81
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.8
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 95.8
2ocp_A 241 DGK, deoxyguanosine kinase; protein-nucleotide com 95.79
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.79
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 95.78
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 95.74
3co5_A143 Putative two-component system transcriptional RES 95.74
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.71
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 95.69
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 95.69
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.69
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 95.68
2fna_A 357 Conserved hypothetical protein; structural genomic 95.67
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 95.66
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 95.64
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.64
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 95.63
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.62
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 95.62
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 95.6
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 95.6
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 95.6
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 95.58
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 95.58
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 95.57
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 95.57
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 95.55
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 95.55
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 95.51
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 95.51
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 95.5
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 95.46
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 95.43
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 95.42
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 95.41
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 95.41
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 95.4
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.4
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 95.39
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.38
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 95.35
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 95.34
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 95.34
1tue_A212 Replication protein E1; helicase, replication, E1E 95.33
1a7j_A 290 Phosphoribulokinase; transferase, calvin cycle; 2. 95.32
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.31
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 95.3
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 95.3
3tmk_A 216 Thymidylate kinase; phosphotransferase; HET: T5A; 95.3
2qgz_A308 Helicase loader, putative primosome component; str 95.28
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.25
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.24
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
Probab=99.89  E-value=3.8e-23  Score=141.16  Aligned_cols=98  Identities=22%  Similarity=0.446  Sum_probs=70.8

Q ss_pred             CceEEEEEEeCCCCcHHHHHHH-HhhccccccCCCCCCccccccceeeE--EEEeCC--EEEEEEECCCcccccccccc-
Q psy9521          15 KDEFCVLILGLDNAGKTTYLES-AKTKFTKNYKGMNPSKITTTVGLNIG--QIDINT--VRLNFWDLGGQLELQSLWDK-   88 (125)
Q Consensus        15 ~~~~ki~v~G~~~~GKTsl~~~-i~~~~~~~~~~~~~~~~~~t~~~~~~--~~~~~~--~~~~i~D~~G~~~~~~~~~~-   88 (125)
                      -+++||+++|++|||||||++| +.+.|..++.        ||++.++.  .+..++  +++++|||+||++|+.+++. 
T Consensus        11 ~k~~KivlvGd~~VGKTsLi~r~~~~~f~~~~~--------~Tig~d~~~k~~~~~~~~v~l~iwDtaGqe~~~~l~~~~   82 (216)
T 4dkx_A           11 LRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQ--------ATIGIDFLSKTMYLEDRTIRLQLWDTAGLERFRSLIPSY   82 (216)
T ss_dssp             --CEEEEEECSTTSSHHHHHHHHHHSCCC------------------CEEEEEECSSCEEEEEEECCSCTTTCGGGHHHH
T ss_pred             CCcEEEEEECcCCcCHHHHHHHHHhCCCCCCcC--------CccceEEEEEEEEecceEEEEEEEECCCchhhhhHHHHH
Confidence            4679999999999999999999 7899998887        99998875  344444  88999999999999998876 


Q ss_pred             -----------cccCccCHHHHHHHHhhhcccccCCCCeEEEEee
Q psy9521          89 -----------DIRDCMGVREVKPIFNKNSAHLIGRRDCMVMPVS  122 (125)
Q Consensus        89 -----------Di~~~~s~~~i~~~l~~~~~~~~~~~~~~i~~~s  122 (125)
                                 |++++.||+++..|+..+  ......+++++.+-
T Consensus        83 ~~~a~~~ilv~di~~~~Sf~~i~~~~~~i--~~~~~~~~piilVg  125 (216)
T 4dkx_A           83 IRDSAAAVVVYDITNVNSFQQTTKWIDDV--RTERGSDVIIMLVG  125 (216)
T ss_dssp             HTTCSEEEEEEETTCHHHHHTHHHHHHHH--HHHHTTSSEEEEEE
T ss_pred             hccccEEEEEeecchhHHHHHHHHHHHHH--HHhcCCCCeEEEEe
Confidence                       999999999999999987  22233455555554



>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 125
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 5e-10
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 3e-09
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 4e-09
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 5e-09
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 9e-09
d1azta2 221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 1e-08
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 1e-08
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 2e-08
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 7e-08
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 9e-08
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 2e-07
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 3e-07
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 6e-07
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 1e-06
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-06
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 2e-06
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 4e-06
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 7e-06
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-05
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 2e-04
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 2e-04
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 4e-04
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 5e-04
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 7e-04
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 9e-04
d1nrjb_ 209 c.37.1.8 (B:) Signal recognition particle receptor 0.001
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 0.002
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 0.003
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 0.003
d2fh5b1 207 c.37.1.8 (B:63-269) Signal recognition particle re 0.004
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Rab8a
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 52.1 bits (124), Expect = 5e-10
 Identities = 24/113 (21%), Positives = 43/113 (38%), Gaps = 10/113 (8%)

Query: 9   YKYMLRKDEFCVLILGLDNAGKTTYLES-AKTKFTKNYKGMNPSKITTTVGLNIGQIDIN 67
           Y Y+ +     +L++G    GKT  L   ++  F   +       I     +   ++D  
Sbjct: 3   YDYLFK-----LLLIGDSGVGKTCVLFRFSEDAFNSTFIST----IGIDFKIRTIELDGK 53

Query: 68  TVRLNFWDLGGQLELQSLWDKDIRDCMGVREVKPIFNKNSAHLIGRRDCMVMP 120
            ++L  WD  GQ   +++     R  MG+  V  I N+ S   I      +  
Sbjct: 54  RIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEE 106


>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.88
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.85
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.85
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.84
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.83
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.82
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.82
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.81
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.81
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.81
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.8
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.8
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.79
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.79
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.79
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.79
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.79
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.79
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.79
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.79
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.78
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.77
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.77
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.75
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.75
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.74
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.71
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.71
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.7
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.7
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.69
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.67
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.58
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.56
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.39
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.35
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.27
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.25
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.24
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.24
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.17
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.16
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.09
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.08
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.9
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.89
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 98.88
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 98.87
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 98.87
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.82
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.79
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 98.76
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.73
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.64
d1r5ba3 245 Eukaryotic peptide chain release factor ERF2, G do 98.63
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.59
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 98.58
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 98.54
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.38
d1g7sa4 227 Initiation factor IF2/eIF5b, N-terminal (G) domain 98.33
d2dy1a2 267 Elongation factor G (EF-G), N-terminal (G) domain 98.28
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 98.22
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.19
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 98.08
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.98
d1jala1 278 YchF GTP-binding protein N-terminal domain {Haemop 97.98
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.94
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.94
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 97.84
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.81
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.79
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 97.76
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.62
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.62
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.6
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.57
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.57
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.56
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.55
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.55
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.54
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.53
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.53
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.53
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.52
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.5
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.48
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.47
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.46
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.45
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.43
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.38
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.36
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.36
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.34
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.29
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 97.29
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 97.27
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.26
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.26
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.25
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.24
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.22
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.21
d1g2912 240 Maltose transport protein MalK, N-terminal domain 97.2
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.19
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.18
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.18
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 97.18
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.17
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.14
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 97.12
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.1
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.1
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 97.1
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.09
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.08
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 97.07
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 97.07
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.07
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.04
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 97.04
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.03
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.02
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 96.99
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.99
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.97
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 96.96
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.95
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.94
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.93
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.9
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 96.9
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.89
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.87
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.87
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 96.86
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.83
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.78
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 96.77
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.75
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 96.75
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 96.74
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 96.73
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.71
d1vmaa2213 GTPase domain of the signal recognition particle r 96.69
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 96.68
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.67
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.67
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.65
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 96.59
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 96.59
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.59
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 96.57
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.5
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.49
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.46
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.45
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.36
d2qy9a2211 GTPase domain of the signal recognition particle r 96.31
d1okkd2207 GTPase domain of the signal recognition particle r 96.3
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.29
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 96.29
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 96.27
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.25
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.2
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.19
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 96.19
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 96.18
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.15
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.11
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.08
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.08
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 96.04
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.99
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 95.87
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.86
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.79
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.74
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.73
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 95.67
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 95.66
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 95.59
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.58
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.56
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 95.56
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 95.56
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.55
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.52
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 95.52
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.4
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.34
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.33
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 95.23
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 95.21
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 95.2
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.19
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.01
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 94.99
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 94.99
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.97
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.89
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.8
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 94.78
d1cp2a_ 269 Nitrogenase iron protein {Clostridium pasteurianum 94.65
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 94.6
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.6
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 94.59
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 94.49
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 94.29
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.18
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 94.15
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.04
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.92
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 93.59
d1xpua3 289 Transcription termination factor Rho, ATPase domai 93.55
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 93.47
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.47
d1tuea_205 Replication protein E1 helicase domain {Human papi 93.17
d2afhe1 289 Nitrogenase iron protein {Azotobacter vinelandii [ 93.07
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 92.96
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 92.92
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 92.84
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 92.54
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 92.41
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 91.77
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.31
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 91.09
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 90.99
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 90.94
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.44
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 90.18
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 89.5
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 89.42
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 89.32
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 89.07
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 89.02
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 88.62
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 87.73
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 87.39
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 87.02
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 86.64
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 86.63
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 86.52
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.34
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 86.3
d1g3qa_ 237 Cell division regulator MinD {Archaeon Pyrococcus 85.9
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 85.86
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 85.47
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 85.39
d1hyqa_ 232 Cell division regulator MinD {Archaeon Archaeoglob 85.1
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 84.61
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 84.35
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 80.65
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 80.56
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]
Probab=99.88  E-value=2.1e-22  Score=131.85  Aligned_cols=97  Identities=30%  Similarity=0.496  Sum_probs=76.2

Q ss_pred             hhhHHHHHhhhcc-CceEEEEEEeCCCCcHHHHHHHHhhccccccCCCCCCccccccceeeEEEEeCCEEEEEEECCCcc
Q psy9521           2 YTLVSGFYKYMLR-KDEFCVLILGLDNAGKTTYLESAKTKFTKNYKGMNPSKITTTVGLNIGQIDINTVRLNFWDLGGQL   80 (125)
Q Consensus         2 ~~~~~~~~~~~~~-~~~~ki~v~G~~~~GKTsl~~~i~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~i~D~~G~~   80 (125)
                      ++.+++++++++. ++++||+++|++|||||||++++.+....+..        ||.+.....+..+++.+.+||++|++
T Consensus         1 ~~~~~~~~~~l~~~~k~~KI~lvG~~~vGKTsLi~~l~~~~~~~~~--------~t~~~~~~~~~~~~~~~~i~D~~g~~   72 (182)
T d1moza_           1 GNIFSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTK--------PTIGFNVETLSYKNLKLNVWDLGGQT   72 (182)
T ss_dssp             CHHHHHHHGGGTTCSSCEEEEEEEETTSSHHHHHHHTCCSEEEEEC--------SSTTCCEEEEEETTEEEEEEEEC---
T ss_pred             ChhHHHHHHHHhCCCceEEEEEECCCCCCHHHHHHHHhcCCCCccc--------cccceEEEEEeeCCEEEEEEeccccc
Confidence            4678899988754 79999999999999999999995433333444        88888888888889999999999999


Q ss_pred             cccccccc------------cccCccCHHHHHHHHhhh
Q psy9521          81 ELQSLWDK------------DIRDCMGVREVKPIFNKN  106 (125)
Q Consensus        81 ~~~~~~~~------------Di~~~~s~~~i~~~l~~~  106 (125)
                      .++.++..            |.++..++.++..|+...
T Consensus        73 ~~~~~~~~~~~~~~~ii~v~d~~d~~s~~~~~~~l~~~  110 (182)
T d1moza_          73 SIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLM  110 (182)
T ss_dssp             -CCTTGGGTTTTEEEEEEEEETTCTTTHHHHHHHHHHH
T ss_pred             ccchhHHhhhccceeEEEEeeecccccchhHHHHHHHH
Confidence            99888877            888888888888776553



>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure