Psyllid ID: psy954
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 337 | ||||||
| 242019639 | 4568 | low-density lipoprotein receptor, putati | 0.881 | 0.065 | 0.492 | 5e-85 | |
| 270016386 | 1751 | hypothetical protein TcasGA2_TC004260 [T | 0.937 | 0.180 | 0.540 | 2e-82 | |
| 91094565 | 1731 | PREDICTED: similar to low-density lipopr | 0.937 | 0.182 | 0.540 | 2e-82 | |
| 321476336 | 4507 | hypothetical protein DAPPUDRAFT_43397 [D | 0.905 | 0.067 | 0.458 | 2e-75 | |
| 357622730 | 4358 | hypothetical protein KGM_12959 [Danaus p | 0.884 | 0.068 | 0.498 | 9e-75 | |
| 281360654 | 4769 | megalin, isoform A [Drosophila melanogas | 0.890 | 0.062 | 0.485 | 2e-74 | |
| 195446934 | 4521 | GK25553 [Drosophila willistoni] gi|19416 | 0.943 | 0.070 | 0.540 | 2e-74 | |
| 195350484 | 2360 | GM11366 [Drosophila sechellia] gi|194123 | 0.890 | 0.127 | 0.485 | 3e-74 | |
| 195481687 | 3879 | GE15450 [Drosophila yakuba] gi|194189263 | 0.890 | 0.077 | 0.485 | 3e-74 | |
| 198471567 | 4543 | GA11430 [Drosophila pseudoobscura pseudo | 0.943 | 0.069 | 0.537 | 6e-74 |
| >gi|242019639|ref|XP_002430267.1| low-density lipoprotein receptor, putative [Pediculus humanus corporis] gi|212515374|gb|EEB17529.1| low-density lipoprotein receptor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 320 bits (821), Expect = 5e-85, Method: Compositional matrix adjust.
Identities = 186/378 (49%), Positives = 217/378 (57%), Gaps = 81/378 (21%)
Query: 10 VLISATIYPFAITVHRNYIYWTDLQLRGVYRAEKHTGANMIEMVKRLEDSPRDIHVYSAD 69
VL++ATIYPFAITVH NYIYWTDLQLRGVYRAEKHTGANMIEMVKRLEDSPRDIHV+S
Sbjct: 2532 VLVAATIYPFAITVHGNYIYWTDLQLRGVYRAEKHTGANMIEMVKRLEDSPRDIHVFSKS 2591
Query: 70 SQKCSVNPCNIHNGGCAQSCHPGPNGTAECKCDESTKLVNEGRMCVAKNITCDGSKFFCR 129
Q C NPCNI+NGGCAQSCHPGPNG AECKCD+++KLVNE RMCV KN+TCD SKF+C+
Sbjct: 2592 RQMCDSNPCNINNGGCAQSCHPGPNGKAECKCDDNSKLVNENRMCVPKNLTCDSSKFYCK 2651
Query: 130 NGKCISRMWSCDGDDDCGDNSDEDPNYCNVQITGVSQPPGELGVPGHVQITGVSQPPGIV 189
NGKCISRMWSCDGD+DCGD SDED NYC S P E I
Sbjct: 2652 NGKCISRMWSCDGDNDCGDGSDEDVNYCTYH----SCNPNEFRCANGRCI---------- 2697
Query: 190 MVMTTVQTGLMNHPNNRK------------CDEETEFTCTENKAWNRAQCIPKKWLCDGD 237
++ + +H N+ K CD +EFTC + CIP +C+G
Sbjct: 2698 -----FKSWVCDHENDCKDGSDELECVYPPCD-SSEFTCANYR------CIPMSQVCNGV 2745
Query: 238 PDCVDGADENTTALNCPKQSSCSPDQFSCGNGR-CINTGWLCDHDNDCGDGSDEG----- 291
DC D + T CPK ++C P+ C N C+ WLCD DNDCGD SDE
Sbjct: 2746 NDCKDNVTSDETHERCPKNTTCPPNHLKCSNTNICVEPYWLCDGDNDCGDNSDEDSLHCA 2805
Query: 292 -------------------------------------KECHDKYRTCSSEEFACQNFKCI 314
+ C + RTC + F C N CI
Sbjct: 2806 QRTCPQNSFRCPNHRCIPATWYCDGDDDCGDGADEPPEYCKSEGRTCFGDLFTCDNGNCI 2865
Query: 315 RKTYHCDGEDDCGDRSDE 332
+ Y CDG++DC D SDE
Sbjct: 2866 PRIYICDGDNDCLDNSDE 2883
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270016386|gb|EFA12832.1| hypothetical protein TcasGA2_TC004260 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91094565|ref|XP_967627.1| PREDICTED: similar to low-density lipoprotein receptor (ldl), partial [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|321476336|gb|EFX87297.1| hypothetical protein DAPPUDRAFT_43397 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|357622730|gb|EHJ74141.1| hypothetical protein KGM_12959 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|281360654|ref|NP_001096924.2| megalin, isoform A [Drosophila melanogaster] gi|272506047|gb|ABW09371.2| megalin, isoform A [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195446934|ref|XP_002070989.1| GK25553 [Drosophila willistoni] gi|194167074|gb|EDW81975.1| GK25553 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195350484|ref|XP_002041770.1| GM11366 [Drosophila sechellia] gi|194123575|gb|EDW45618.1| GM11366 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195481687|ref|XP_002101739.1| GE15450 [Drosophila yakuba] gi|194189263|gb|EDX02847.1| GE15450 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|198471567|ref|XP_001355664.2| GA11430 [Drosophila pseudoobscura pseudoobscura] gi|198145975|gb|EAL32723.2| GA11430 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 337 | ||||||
| FB|FBgn0261260 | 4769 | mgl "Megalin" [Drosophila mela | 0.391 | 0.027 | 0.757 | 1.2e-121 | |
| UNIPROTKB|F1NJS9 | 4644 | LRP2 "Uncharacterized protein" | 0.353 | 0.025 | 0.5 | 8.9e-60 | |
| UNIPROTKB|F1NCT2 | 4645 | LRP2 "Uncharacterized protein" | 0.353 | 0.025 | 0.5 | 8.9e-60 | |
| ZFIN|ZDB-GENE-050119-2 | 4673 | lrp2a "low density lipoprotein | 0.878 | 0.063 | 0.337 | 6.4e-38 | |
| UNIPROTKB|F1PIB4 | 4549 | LRP2 "Uncharacterized protein" | 0.364 | 0.027 | 0.484 | 3.3e-54 | |
| UNIPROTKB|P98164 | 4655 | LRP2 "Low-density lipoprotein | 0.391 | 0.028 | 0.438 | 3.9e-53 | |
| UNIPROTKB|F1N6H1 | 4626 | LRP2 "Uncharacterized protein" | 0.400 | 0.029 | 0.455 | 5.5e-52 | |
| UNIPROTKB|K7GS03 | 1602 | LOC100514839 "Uncharacterized | 0.362 | 0.076 | 0.459 | 6.3e-50 | |
| MGI|MGI:96828 | 4545 | Lrp1 "low density lipoprotein | 0.305 | 0.022 | 0.523 | 1.1e-47 | |
| UNIPROTKB|G3V928 | 4545 | Lrp1 "Protein Lrp1" [Rattus no | 0.305 | 0.022 | 0.514 | 2.9e-47 |
| FB|FBgn0261260 mgl "Megalin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 628 (226.1 bits), Expect = 1.2e-121, Sum P(2) = 1.2e-121
Identities = 100/132 (75%), Positives = 110/132 (83%)
Query: 204 NNRKCDEETEFTCTENKAWNRAQCIPKKWLCDGDPDCVDGADENTTALNCPKQSSCSPDQ 263
N+RKCDEETEFTC ENK+W RAQCIPKKW+CDGDPDCVDGADENTT NC Q C D
Sbjct: 3073 NDRKCDEETEFTCVENKSWQRAQCIPKKWICDGDPDCVDGADENTTLHNCATQQPCGEDM 3132
Query: 264 FSCGNGRCINTGWLCDHDNDCGDGSDEGKECHDKYRTCSSEEFACQNFKCIRKTYHCDGE 323
F+CGNGRCIN GW+CDHDNDCGDG+DEGK C+ KY+TCS++EF CQNFKCIR CDGE
Sbjct: 3133 FTCGNGRCINKGWICDHDNDCGDGTDEGKFCNSKYKTCSAQEFTCQNFKCIRNQSRCDGE 3192
Query: 324 DDCGDRSDEFNC 335
DDCGD SDE C
Sbjct: 3193 DDCGDHSDEVGC 3204
|
|
| UNIPROTKB|F1NJS9 LRP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NCT2 LRP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050119-2 lrp2a "low density lipoprotein receptor-related protein 2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PIB4 LRP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P98164 LRP2 "Low-density lipoprotein receptor-related protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N6H1 LRP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GS03 LOC100514839 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96828 Lrp1 "low density lipoprotein receptor-related protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V928 Lrp1 "Protein Lrp1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 337 | |||
| cd00112 | 35 | cd00112, LDLa, Low Density Lipoprotein Receptor Cl | 5e-10 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 3e-09 | |
| cd00112 | 35 | cd00112, LDLa, Low Density Lipoprotein Receptor Cl | 4e-09 | |
| pfam00057 | 37 | pfam00057, Ldl_recept_a, Low-density lipoprotein r | 1e-08 | |
| cd00112 | 35 | cd00112, LDLa, Low Density Lipoprotein Receptor Cl | 2e-08 | |
| pfam00057 | 37 | pfam00057, Ldl_recept_a, Low-density lipoprotein r | 5e-08 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 8e-08 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 6e-07 | |
| pfam00057 | 37 | pfam00057, Ldl_recept_a, Low-density lipoprotein r | 1e-06 | |
| cd00112 | 35 | cd00112, LDLa, Low Density Lipoprotein Receptor Cl | 1e-04 | |
| pfam00057 | 37 | pfam00057, Ldl_recept_a, Low-density lipoprotein r | 2e-04 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 6e-04 |
| >gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
Score = 53.7 bits (130), Expect = 5e-10
Identities = 20/32 (62%), Positives = 26/32 (81%)
Query: 259 CSPDQFSCGNGRCINTGWLCDHDNDCGDGSDE 290
C P++F C NGRCI + W+CD ++DCGDGSDE
Sbjct: 1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
|
Length = 35 |
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 337 | |||
| KOG1215|consensus | 877 | 99.84 | ||
| KOG1214|consensus | 1289 | 99.68 | ||
| KOG1215|consensus | 877 | 99.38 | ||
| PF00057 | 37 | Ldl_recept_a: Low-density lipoprotein receptor dom | 99.19 | |
| PF00057 | 37 | Ldl_recept_a: Low-density lipoprotein receptor dom | 99.16 | |
| cd00112 | 35 | LDLa Low Density Lipoprotein Receptor Class A doma | 99.15 | |
| cd00112 | 35 | LDLa Low Density Lipoprotein Receptor Class A doma | 99.11 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 99.07 | |
| smart00192 | 33 | LDLa Low-density lipoprotein receptor domain class | 99.04 | |
| smart00192 | 33 | LDLa Low-density lipoprotein receptor domain class | 98.82 | |
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 98.78 | |
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 98.54 | |
| PF00058 | 42 | Ldl_recept_b: Low-density lipoprotein receptor rep | 98.25 | |
| KOG1214|consensus | 1289 | 98.2 | ||
| smart00135 | 43 | LY Low-density lipoprotein-receptor YWTD domain. T | 97.71 | |
| KOG2397|consensus | 480 | 97.55 | ||
| PF00058 | 42 | Ldl_recept_b: Low-density lipoprotein receptor rep | 96.79 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 96.73 | |
| KOG3509|consensus | 964 | 96.67 | ||
| KOG2397|consensus | 480 | 96.52 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 95.34 | |
| KOG3509|consensus | 964 | 93.05 | ||
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 93.03 | |
| PF09064 | 34 | Tme5_EGF_like: Thrombomodulin like fifth domain, E | 92.68 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 92.53 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 90.4 | |
| PF01436 | 28 | NHL: NHL repeat; InterPro: IPR001258 The NHL repea | 90.12 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 88.24 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 85.35 | |
| PF08450 | 246 | SGL: SMP-30/Gluconolaconase/LRE-like region; Inter | 81.62 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 80.5 |
| >KOG1215|consensus | Back alignment and domain information |
|---|
Probab=99.84 E-value=6e-21 Score=203.21 Aligned_cols=215 Identities=37% Similarity=0.711 Sum_probs=170.8
Q ss_pred EEEEECCEEEEEeCCCCceEEEecccCCceEEEeecccCCCccceeeccCccccCCCCCcCC-CCCccccccCCCCCcCe
Q psy954 20 AITVHRNYIYWTDLQLRGVYRAEKHTGANMIEMVKRLEDSPRDIHVYSADSQKCSVNPCNIH-NGGCAQSCHPGPNGTAE 98 (337)
Q Consensus 20 ~Lav~~d~IYWtDw~~~~I~r~~k~~G~~~~~l~~~~~~~p~gI~v~~~~~q~~~~npC~~~-nggCs~lCl~~~~~~~~ 98 (337)
+|++|+++|||+| +.|.+++|.+|....++...... |+.|+++++..++...++|..+ +++|+|
T Consensus 73 ~l~~~~~~~y~~d---~~v~~~~~~sg~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------- 137 (877)
T KOG1215|consen 73 ALTLFEDGLYWTD---KSVSAANKKTGKDVTRLSQDSHF-PLDIHAYHPSSQPLAPDPCAESGNGPCSH----------- 137 (877)
T ss_pred eeeeeccceeecc---chhhhhccCCCCcceeehhcCCC-CcceeEEecCCCCCCCCcccccCCCCCcc-----------
Confidence 9999999999999 78999999999999988877755 9999999999888877887763 223333
Q ss_pred ecCCCCcccccCCcccccCCCCCCCCccccC--CCceeCCccccCCCCCCCCCCCCCCCccCCcccCCCCCCCCcccCCC
Q psy954 99 CKCDESTKLVNEGRMCVAKNITCDGSKFFCR--NGKCISRMWSCDGDDDCGDNSDEDPNYCNVQITGVSQPPGELGVPGH 176 (337)
Q Consensus 99 C~Cp~g~~L~~~~~~C~~~~~~C~~~~f~C~--~g~CI~~~~~CDG~~DC~DgsDE~~~~C~~~~c~c~~~~~~~~~~~~ 176 (337)
|...+|.|. +++||+..|+|||..||+||+||.. |....+.
T Consensus 138 ----------------------~~~~~~~c~~~~~~Cip~~~~cd~~~~C~dg~de~~--~~~~~~~------------- 180 (877)
T KOG1215|consen 138 ----------------------CCLDKFSCRTGSCKCIPGDWLCDGEADCPDGSDELN--CAVRRCE------------- 180 (877)
T ss_pred ----------------------ccCCCCCCcCccccCCCCceeCCCCCccccchhhhc--ccccccC-------------
Confidence 333446666 7899999999999999999999986 2211000
Q ss_pred ccccCCCCCCCCccceeeecCCCCCCCCCCCCCCCCceeeCCCCCCCCCeeecCCCcccCCCCCCCCCccccccCCCCCC
Q psy954 177 VQITGVSQPPGIVMVMTTVQTGLMNHPNNRKCDEETEFTCTENKAWNRAQCIPKKWLCDGDPDCVDGADENTTALNCPKQ 256 (337)
Q Consensus 177 ~C~~~~~~~~~~C~~~~~C~~~~d~~c~~~~C~~~~~f~C~~~~~~~~~~Ci~~~~~CDg~~dC~dgsDE~~~~~~C~~~ 256 (337)
+.... | +||...|+||+..+|.+++|| ..+..
T Consensus 181 -------------------------------~~~~~-~-----------~~~~~~~~~d~~~~~~~~~d~----~~~~~- 212 (877)
T KOG1215|consen 181 -------------------------------PRGAS-L-----------DCIVAIKVCDIQHDCADDYDE----SEGRI- 212 (877)
T ss_pred -------------------------------ccccc-c-----------ccceeeeecCccccccccccc----ccCcc-
Confidence 00000 2 448889999999999999999 34432
Q ss_pred CCCC---CCcEEeeC-CceecCCCcCCCCCCCCCCCCCC-CCCCCCCCCCCCCcEEcCCCCeecCCCCCCCcCCCCCCCC
Q psy954 257 SSCS---PDQFSCGN-GRCINTGWLCDHDNDCGDGSDEG-KECHDKYRTCSSEEFACQNFKCIRKTYHCDGEDDCGDRSD 331 (337)
Q Consensus 257 ~~C~---~~~f~C~~-g~Ci~~~~~CDg~~dC~d~sDE~-~~C~~~~~~C~~~~f~C~~~~Ci~~~~~CDg~~dC~dgsD 331 (337)
..+. ...++|.. .+||...|.|||..||.+++||. .++. ...|...++.|.++.|++..++|||..||+||+|
T Consensus 213 ~~~~~~~~~~~~c~g~~~~i~~~~~~Dg~~dc~~~~de~~~~~~--~~~~~~~e~~~~~~~~~~~~~~~~g~~d~pdg~d 290 (877)
T KOG1215|consen 213 YWTDDSRIEVTRCDGSSRCILISEVCDGPRDCVDGPDEGVMNCS--DATCEAPEIECADGDCSDRQKLCDGDLDCPDGLD 290 (877)
T ss_pred cccCCcceeEEEecCCCcEEeehhccCCCcccccCCcCceeEee--ccccCCcceeecCCCCccceEEecCccCCCCccc
Confidence 2232 57889987 59999999999999999999994 3454 4567778999999999999999999999999999
Q ss_pred CCCCC
Q psy954 332 EFNCN 336 (337)
Q Consensus 332 E~~C~ 336 (337)
|..|.
T Consensus 291 e~~~~ 295 (877)
T KOG1215|consen 291 EDYCK 295 (877)
T ss_pred ccccc
Confidence 98775
|
|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1215|consensus | Back alignment and domain information |
|---|
| >PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >smart00192 LDLa Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >smart00192 LDLa Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
| >PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >smart00135 LY Low-density lipoprotein-receptor YWTD domain | Back alignment and domain information |
|---|
| >KOG2397|consensus | Back alignment and domain information |
|---|
| >PF00058 Ldl_recept_b: Low-density lipoprotein receptor repeat class B; InterPro: IPR000033 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >KOG2397|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 337 | ||||
| 3m0c_C | 791 | The X-Ray Crystal Structure Of Pcsk9 In Complex Wit | 9e-18 | ||
| 3m0c_C | 791 | The X-Ray Crystal Structure Of Pcsk9 In Complex Wit | 3e-16 | ||
| 1n7d_A | 699 | Extracellular Domain Of The Ldl Receptor Length = 6 | 1e-17 | ||
| 1n7d_A | 699 | Extracellular Domain Of The Ldl Receptor Length = 6 | 6e-16 | ||
| 2fyj_A | 82 | Nmr Solution Structure Of Calcium-Loaded Lrp Double | 3e-14 | ||
| 3soq_A | 318 | The Structure Of The First Ywtd Beta Propeller Doma | 2e-12 | ||
| 3sob_B | 316 | The Structure Of The First Ywtd Beta Propeller Doma | 3e-12 | ||
| 3s94_A | 619 | Crystal Structure Of Lrp6-E1e2 Length = 619 | 4e-12 | ||
| 4dg6_A | 616 | Crystal Structure Of Domains 1 And 2 Of Lrp6 Length | 4e-12 | ||
| 2lgp_A | 94 | Solution Structure Of La45 From Ldlr Length = 94 | 2e-10 | ||
| 3v65_B | 386 | Crystal Structure Of Agrin And Lrp4 Complex Length | 3e-09 | ||
| 3v64_C | 349 | Crystal Structure Of Agrin And Lrp4 Length = 349 | 4e-09 | ||
| 2fcw_B | 80 | Structure Of A Complex Between The Pair Of The Ldl | 2e-08 | ||
| 2fcw_B | 80 | Structure Of A Complex Between The Pair Of The Ldl | 5e-08 | ||
| 4a0p_A | 628 | Crystal Structure Of Lrp6p3e3p4e4 Length = 628 | 5e-08 | ||
| 3s2k_A | 629 | Structural Basis Of Wnt Signaling Inhibition By Dic | 5e-08 | ||
| 3s8v_A | 623 | Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 | 5e-08 | ||
| 1f5y_A | 85 | Nmr Structure Of A Concatemer Of The First And Seco | 3e-07 | ||
| 3p5c_L | 440 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 4e-07 | ||
| 3p5b_L | 400 | The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE | 4e-07 | ||
| 1ijq_A | 316 | Crystal Structure Of The Ldl Receptor Ywtd-Egf Doma | 1e-06 | ||
| 2xrc_A | 565 | Human Complement Factor I Length = 565 | 3e-06 | ||
| 2m0p_A | 52 | Solution Structure Of The Tenth Complement Type Rep | 3e-05 | ||
| 1j8e_A | 44 | Crystal Structure Of Ligand-Binding Repeat Cr7 From | 6e-05 | ||
| 1d2l_A | 45 | Nmr Solution Structure Of Complement-Like Repeat Cr | 1e-04 | ||
| 2kny_A | 80 | Fusion Construct Of Cr17 From Lrp-1 And Apoe Residu | 3e-04 | ||
| 2knx_A | 50 | Solution Structure Of Complement Repeat Cr17 From L | 5e-04 |
| >pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 | Back alignment and structure |
|
| >pdb|3M0C|C Chain C, The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ldl Receptor Length = 791 | Back alignment and structure |
| >pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 | Back alignment and structure |
| >pdb|1N7D|A Chain A, Extracellular Domain Of The Ldl Receptor Length = 699 | Back alignment and structure |
| >pdb|2FYJ|A Chain A, Nmr Solution Structure Of Calcium-Loaded Lrp Double Module Length = 82 | Back alignment and structure |
| >pdb|3SOQ|A Chain A, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Dkk1 Peptide Length = 318 | Back alignment and structure |
| >pdb|3SOB|B Chain B, The Structure Of The First Ywtd Beta Propeller Domain Of Lrp6 In Complex With A Fab Length = 316 | Back alignment and structure |
| >pdb|3S94|A Chain A, Crystal Structure Of Lrp6-E1e2 Length = 619 | Back alignment and structure |
| >pdb|4DG6|A Chain A, Crystal Structure Of Domains 1 And 2 Of Lrp6 Length = 616 | Back alignment and structure |
| >pdb|2LGP|A Chain A, Solution Structure Of La45 From Ldlr Length = 94 | Back alignment and structure |
| >pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 | Back alignment and structure |
| >pdb|3V64|C Chain C, Crystal Structure Of Agrin And Lrp4 Length = 349 | Back alignment and structure |
| >pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 | Back alignment and structure |
| >pdb|2FCW|B Chain B, Structure Of A Complex Between The Pair Of The Ldl Receptor Ligand-Binding Modules 3-4 And The Receptor Associated Protein (Rap) Length = 80 | Back alignment and structure |
| >pdb|4A0P|A Chain A, Crystal Structure Of Lrp6p3e3p4e4 Length = 628 | Back alignment and structure |
| >pdb|3S2K|A Chain A, Structural Basis Of Wnt Signaling Inhibition By Dickkopf Binding To Lrp56. Length = 629 | Back alignment and structure |
| >pdb|3S8V|A Chain A, Crystal Structure Of Lrp6-Dkk1 Complex Length = 623 | Back alignment and structure |
| >pdb|1F5Y|A Chain A, Nmr Structure Of A Concatemer Of The First And Second Ligand-Binding Modules Of The Human Ldl Receptor Length = 85 | Back alignment and structure |
| >pdb|3P5C|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 440 | Back alignment and structure |
| >pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 | Back alignment and structure |
| >pdb|1IJQ|A Chain A, Crystal Structure Of The Ldl Receptor Ywtd-Egf Domain Pair Length = 316 | Back alignment and structure |
| >pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 | Back alignment and structure |
| >pdb|2M0P|A Chain A, Solution Structure Of The Tenth Complement Type Repeat Of Human Megalin Length = 52 | Back alignment and structure |
| >pdb|1J8E|A Chain A, Crystal Structure Of Ligand-Binding Repeat Cr7 From Lrp Length = 44 | Back alignment and structure |
| >pdb|1D2L|A Chain A, Nmr Solution Structure Of Complement-Like Repeat Cr3 From The Low Density Lipoprotein Receptor-Related Protein (Lrp) . Evidence For Specific Binding To The Receptor Binding Domain Of Human Alpha-2 Macroglobulin Length = 45 | Back alignment and structure |
| >pdb|2KNY|A Chain A, Fusion Construct Of Cr17 From Lrp-1 And Apoe Residues 130-14 Length = 80 | Back alignment and structure |
| >pdb|2KNX|A Chain A, Solution Structure Of Complement Repeat Cr17 From Lrp-1 Length = 50 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 337 | |||
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 1e-33 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 2e-28 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 8e-28 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 3e-20 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 1e-19 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 6e-11 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 9e-11 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 2e-32 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 1e-29 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 5e-26 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 5e-23 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 9e-19 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 4e-13 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 1e-09 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 2e-28 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 2e-21 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 7e-15 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 1e-09 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 2e-08 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 3e-26 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 8e-21 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 7e-13 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 2e-10 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 1e-08 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 4e-21 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 1e-17 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 5e-09 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 8e-16 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 1e-15 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 7e-13 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 1e-09 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 1e-12 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 3e-12 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 4e-10 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 1e-09 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 7e-06 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 4e-12 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 1e-11 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 1e-11 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 4e-10 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 6e-10 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 8e-05 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 2e-11 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 7e-10 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 2e-08 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 2e-05 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 2e-11 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 9e-11 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 9e-10 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 3e-05 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 1e-10 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 4e-10 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 3e-08 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 6e-07 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 7e-06 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 1e-09 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 4e-07 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 3e-04 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 1e-09 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 2e-09 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 1e-07 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 5e-04 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 2e-09 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 5e-09 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 4e-08 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 1e-05 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 2e-09 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 3e-08 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 5e-07 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 7e-07 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 1e-08 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 3e-08 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 8e-07 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 5e-06 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 2e-08 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 1e-07 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 2e-06 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 2e-05 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 6e-08 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 5e-07 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 6e-07 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 1e-05 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 1e-07 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 8e-07 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 2e-06 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 2e-05 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 2e-07 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 2e-07 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 4e-05 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 8e-05 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 3e-07 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 9e-07 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 4e-06 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 7e-04 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 6e-05 | |
| 3ojy_A | 554 | Complement component C8 alpha chain; macpf, lipoca | 1e-04 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 1e-04 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 4e-04 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 5e-04 |
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
Score = 130 bits (327), Expect = 1e-33
Identities = 69/240 (28%), Positives = 97/240 (40%), Gaps = 62/240 (25%)
Query: 98 ECKCDESTKLVNEGRMCVAKNITCDGSKFFCRNGKCISRMWSCDGDDDCGDNSDEDPNYC 157
+ + + L G C+ ++F C++GKCIS W CDG +C D SDE C
Sbjct: 4 KLRWTVALLLAAAGTAV---GDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETC 60
Query: 158 NVQITGVSQPPGELGVPGHVQITGVSQPPGIVMVMTTVQTGLMNHPNNRKCDEETEFTCT 217
+ C +F+C
Sbjct: 61 L----------------------------------------------SVTCKSG-DFSCG 73
Query: 218 ENKAWNRAQCIPKKWLCDGDPDCVDGADENTTALNCPKQSSCSPDQFSCGNGRCINTGWL 277
+CIP+ W CDG DC +G+DE CP +CS D+F C +G+CI+ ++
Sbjct: 74 GRVN----RCIPQFWRCDGQVDCDNGSDE----QGCP-PKTCSQDEFRCHDGKCISRQFV 124
Query: 278 CDHDNDCGDGSDEGKECHDKYRTCSSEEFACQNFKCIRKTYHCDGEDDCGDRSDEFNCNY 337
CD D DC DGSD E TC F C + CI + + CD + DC D SDE+
Sbjct: 125 CDSDRDCLDGSD---EASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRC 181
|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Length = 628 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Length = 318 | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Length = 316 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} Length = 619 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Length = 349 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Length = 267 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 220 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Length = 39 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Length = 69 | Back alignment and structure |
|---|
| >3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Length = 554 | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Length = 53 | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Length = 59 | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 337 | |||
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 100.0 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 100.0 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 100.0 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 100.0 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 99.88 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 99.88 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 99.87 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 99.87 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 99.86 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 99.86 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 99.84 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 99.84 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 99.84 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 99.83 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 99.83 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 99.82 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 99.8 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 99.52 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 99.42 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 99.34 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 99.25 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 99.24 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 99.23 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 99.23 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 99.22 | |
| 2m0p_A | 52 | Low-density lipoprotein receptor-related protein; | 99.2 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 99.2 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 99.2 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 99.19 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 99.18 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 99.18 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 99.17 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 99.17 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 99.16 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 99.16 | |
| 2m0p_A | 52 | Low-density lipoprotein receptor-related protein; | 99.14 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 99.14 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 99.13 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 99.1 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 99.1 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 99.1 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 99.09 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 99.07 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 99.04 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 99.01 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 99.01 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 98.99 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 98.7 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 98.68 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 98.63 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 98.61 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 98.6 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 98.59 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 98.54 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 98.48 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 98.27 | |
| 3ojy_B | 537 | Complement component C8 beta chain; macpf, lipocal | 98.18 | |
| 3ojy_A | 554 | Complement component C8 alpha chain; macpf, lipoca | 98.13 | |
| 3ojy_B | 537 | Complement component C8 beta chain; macpf, lipocal | 98.1 | |
| 3ojy_A | 554 | Complement component C8 alpha chain; macpf, lipoca | 98.05 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 97.97 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 97.8 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 97.79 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 97.79 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 97.76 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 97.53 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.4 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 97.31 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 97.27 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 97.23 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 97.14 | |
| 1npe_A | 267 | Nidogen, entactin; glycoprotein, basement membrane | 96.57 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 96.54 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 96.3 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 96.02 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 95.48 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 95.28 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 95.27 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 95.15 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 95.04 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 94.46 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 94.3 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 94.22 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 93.77 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 93.63 | |
| 3s25_A | 302 | Hypothetical 7-bladed beta-propeller-like protein; | 93.49 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 93.13 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 93.04 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 89.82 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 89.67 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 88.61 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 88.09 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 88.08 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 87.17 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 86.96 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 86.9 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 86.26 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 86.23 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 85.54 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 85.52 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 84.74 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 84.17 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 84.11 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 84.11 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 83.69 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 82.15 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 81.96 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 81.89 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 81.25 | |
| 3e5z_A | 296 | Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco | 81.15 | |
| 2iwa_A | 266 | Glutamine cyclotransferase; pyroglutamate, acyltra | 81.1 | |
| 1rwi_B | 270 | Serine/threonine-protein kinase PKND; beta propell | 80.22 |
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.3e-39 Score=332.29 Aligned_cols=197 Identities=38% Similarity=0.876 Sum_probs=136.2
Q ss_pred CCCCCccccCCCceeCCccccCCCCCCCCCCCCCCCccCCcccCCCCCCCCcccCC--CccccCCCCCCCCccceeeecC
Q psy954 120 TCDGSKFFCRNGKCISRMWSCDGDDDCGDNSDEDPNYCNVQITGVSQPPGELGVPG--HVQITGVSQPPGIVMVMTTVQT 197 (337)
Q Consensus 120 ~C~~~~f~C~~g~CI~~~~~CDG~~DC~DgsDE~~~~C~~~~c~c~~~~~~~~~~~--~~C~~~~~~~~~~C~~~~~C~~ 197 (337)
+|.+.+|+|.+|+||+..|+|||+.||+|+|||.+..|....|. ..+|.|.+ ++||+.++. |++..+|.+
T Consensus 5 ~C~~~~f~C~~g~ci~~~~~Cdg~~dC~d~sDE~~~~C~~~~C~----~~~f~C~~~~~~Ci~~~~~----Cdg~~dC~d 76 (699)
T 1n7d_A 5 RCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCK----SGDFSCGGRVNRCIPQFWR----CDGQVDCDN 76 (699)
T ss_dssp ---------------------------------------CCSCS----SSSCCCCC--CCCCCSSST----TSSSCCC-C
T ss_pred CCCccceeCCCCcEEcHHhcCCCcccCCCCCCCCccccCCcCCC----CCccCCCCCCCceeCccee----cCCcccCCC
Confidence 58899999999999999999999999999999988778766543 57899976 489987653 999999999
Q ss_pred CCCC-CCCCCCCCCCCceeeCCCCCCCCCeeecCCCcccCCCCCCCCCccccccCCCCCCCCCCCCcEEeeCCceecCCC
Q psy954 198 GLMN-HPNNRKCDEETEFTCTENKAWNRAQCIPKKWLCDGDPDCVDGADENTTALNCPKQSSCSPDQFSCGNGRCINTGW 276 (337)
Q Consensus 198 ~~d~-~c~~~~C~~~~~f~C~~~~~~~~~~Ci~~~~~CDg~~dC~dgsDE~~~~~~C~~~~~C~~~~f~C~~g~Ci~~~~ 276 (337)
+.|| +|+..+|...+ |+|.++ +||+..|+|||+.||.||||| .+|.. ..|++.+|+|.+++||+..|
T Consensus 77 gsDE~~C~~~~C~~~~-f~C~~g------~Ci~~~~~Cdg~~dC~dgsDE----~~C~~-~~C~~~~f~C~~~~Ci~~~~ 144 (699)
T 1n7d_A 77 GSDEQGCPPKTCSQDE-FRCHDG------KCISRQFVCDSDRDCLDGSDE----ASCPV-LTCGPASFQCNSSTCIPQLW 144 (699)
T ss_dssp CCTTTSCSSCCCCSSC-CCSSCC----------CCCTTCSSCCSSSSCSS----SSCCC-CCCCSSCCCCSSSCCCCTTS
T ss_pred CcccCcccccccccCc-EEcCCC------CEecHHHcCCCcCcCCCCCcc----CCcCc-cccCccccCCCCCcccchhc
Confidence 9999 89888999887 999988 999999999999999999999 79986 78999999999999999999
Q ss_pred cCCCCCCCCCCCCCC-CCCCCC------CCCCCCCcEEcCCCCeecCCCCCCCcCCCCCCCCCCCCC
Q psy954 277 LCDHDNDCGDGSDEG-KECHDK------YRTCSSEEFACQNFKCIRKTYHCDGEDDCGDRSDEFNCN 336 (337)
Q Consensus 277 ~CDg~~dC~d~sDE~-~~C~~~------~~~C~~~~f~C~~~~Ci~~~~~CDg~~dC~dgsDE~~C~ 336 (337)
+|||+.||.|+|||. .+|... ...|...+|+|.+|.||+.+|+|||+.||.|||||.+|.
T Consensus 145 ~Cdg~~dC~dgsDE~~~~C~~~~~~~~~~~~C~~~~f~C~~g~Ci~~~~~CDg~~dC~dgsDE~~C~ 211 (699)
T 1n7d_A 145 ACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCA 211 (699)
T ss_dssp TTCSSCCSSSSSSSSCSSSSCCCCCSSCCCCSCSSSCCCSSSCCCSTTCTTSSSCCSTTSCSSCSCC
T ss_pred ccCCCCcCCCCcccccccCCCcccccCCCCCCCCcceecCCCceEechhccCCCCCCCCCcccccCC
Confidence 999999999999993 568632 347999999999999999999999999999999999985
|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* | Back alignment and structure |
|---|
| >1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 337 | ||||
| d1ijqa1 | 266 | b.68.5.1 (A:377-642) Low density lipoprotein (LDL) | 3e-10 | |
| d1ijqa1 | 266 | b.68.5.1 (A:377-642) Low density lipoprotein (LDL) | 2e-04 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 5e-10 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 1e-09 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 2e-08 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 2e-04 | |
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 5e-10 | |
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 3e-09 | |
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 4e-08 | |
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 0.001 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 5e-10 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 1e-09 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 2e-08 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 7e-04 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 5e-10 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 1e-09 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 1e-08 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 0.001 | |
| d1npea_ | 263 | b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId | 9e-10 | |
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-09 | |
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 3e-09 | |
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 6e-09 | |
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 8e-04 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 3e-09 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 2e-08 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 4e-08 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 0.002 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 6e-09 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-08 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-07 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 0.001 | |
| d1xfea2 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 2e-08 | |
| d1xfea2 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 2e-08 | |
| d1xfea2 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 3e-06 | |
| d1xfea2 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 3e-05 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 8e-08 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 2e-07 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 1e-06 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 4e-04 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 1e-07 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 2e-07 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 4e-06 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 5e-04 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 1e-07 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-07 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 4e-06 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-04 | |
| d1k7ba_ | 42 | g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai | 5e-07 | |
| d1k7ba_ | 42 | g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai | 7e-07 | |
| d1k7ba_ | 42 | g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai | 4e-05 | |
| d1k7ba_ | 42 | g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai | 9e-05 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 5e-07 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 1e-06 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 1e-05 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 7e-04 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 7e-07 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 1e-06 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 4e-05 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 0.001 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 2e-06 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 2e-06 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 3e-05 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 0.002 | |
| d2bz6l1 | 53 | g.3.11.1 (L:90-142) Coagulation factor VIIa {Human | 2e-04 | |
| d1rfnb_ | 57 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 3e-04 |
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 6-bladed beta-propeller superfamily: YWTD domain family: YWTD domain domain: Low density lipoprotein (LDL) receptor species: Human (Homo sapiens) [TaxId: 9606]
Score = 57.6 bits (138), Expect = 3e-10
Identities = 14/55 (25%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
Query: 17 YPFAITVHRNYIYWTDLQLRGVYRAEKHTGANMIEMVKRLEDSPRDIHVYSADSQ 71
+PF++ V + ++WTD+ ++ A + TG+++ + + L SP D+ ++ +Q
Sbjct: 210 HPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENL-LSPEDMVLFHNLTQ 263
|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Length = 263 | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 337 | |||
| d2fcwb2 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.37 | |
| d1d2la_ | 45 | Ligand-binding domain of low-density lipoprotein r | 99.36 | |
| d2fcwb1 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.35 | |
| d1f5ya1 | 44 | Ligand-binding domain of low-density lipoprotein r | 99.34 | |
| d2fcwb1 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.32 | |
| d1f8za_ | 39 | Ligand-binding domain of low-density lipoprotein r | 99.31 | |
| d1j8ea_ | 44 | Ligand-binding domain of low-density lipoprotein r | 99.3 | |
| d1xfea2 | 44 | Ligand-binding domain of low-density lipoprotein r | 99.29 | |
| d1ajja_ | 37 | Ligand-binding domain of low-density lipoprotein r | 99.29 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 99.29 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 99.28 | |
| d1f5ya2 | 41 | Ligand-binding domain of low-density lipoprotein r | 99.28 | |
| d1f8za_ | 39 | Ligand-binding domain of low-density lipoprotein r | 99.27 | |
| d1ajja_ | 37 | Ligand-binding domain of low-density lipoprotein r | 99.27 | |
| d1cr8a_ | 42 | Ligand-binding domain of low-density lipoprotein r | 99.23 | |
| d2gtln2 | 41 | Extracellular hemoglobin linker l2 subunit {Common | 99.23 | |
| d1f5ya2 | 41 | Ligand-binding domain of low-density lipoprotein r | 99.22 | |
| d2gtlm2 | 42 | Hemoglobin linker chain l1 {Common earthworm (Lumb | 99.22 | |
| d2gtlo2 | 41 | Extracellular hemoglobin linker l3 subunit {Common | 99.2 | |
| d1cr8a_ | 42 | Ligand-binding domain of low-density lipoprotein r | 99.2 | |
| d1f5ya1 | 44 | Ligand-binding domain of low-density lipoprotein r | 99.19 | |
| d1v9u5_ | 39 | Very low-density lipoprotein receptor {Human (Homo | 99.19 | |
| d2gtlo2 | 41 | Extracellular hemoglobin linker l3 subunit {Common | 99.18 | |
| d1v9u5_ | 39 | Very low-density lipoprotein receptor {Human (Homo | 99.13 | |
| d2fcwb2 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.11 | |
| d1k7ba_ | 42 | soluble Tva ectodomain, sTva47 {Quail (Coturnix co | 99.11 | |
| d1d2la_ | 45 | Ligand-binding domain of low-density lipoprotein r | 99.1 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 99.09 | |
| d1j8ea_ | 44 | Ligand-binding domain of low-density lipoprotein r | 99.07 | |
| d1k7ba_ | 42 | soluble Tva ectodomain, sTva47 {Quail (Coturnix co | 99.06 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 99.06 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 99.05 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 99.0 | |
| d1xfea2 | 44 | Ligand-binding domain of low-density lipoprotein r | 98.96 | |
| d2gtln2 | 41 | Extracellular hemoglobin linker l2 subunit {Common | 98.95 | |
| d2gtlm2 | 42 | Hemoglobin linker chain l1 {Common earthworm (Lumb | 98.94 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 98.94 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 98.93 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 98.84 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 98.63 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.55 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 98.44 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 98.39 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.03 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 97.9 | |
| d1npea_ | 263 | Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | 97.89 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.75 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.67 | |
| d1ijqa1 | 266 | Low density lipoprotein (LDL) receptor {Human (Hom | 97.61 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.5 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.42 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.14 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 95.82 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 94.46 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 93.73 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 93.01 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 91.7 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 91.41 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 91.34 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 91.21 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 90.53 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 90.22 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 89.72 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 89.7 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 89.08 | |
| d1rwia_ | 260 | Serine/threonine-protein kinase PknD {Mycobacteriu | 87.86 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 87.46 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 85.97 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 84.75 | |
| d1dx5i2 | 35 | Thrombomodulin, different EGF-like domains {Human | 84.48 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 81.72 |
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: LDL receptor-like module superfamily: LDL receptor-like module family: LDL receptor-like module domain: Ligand-binding domain of low-density lipoprotein receptor species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.37 E-value=4.1e-14 Score=88.59 Aligned_cols=37 Identities=46% Similarity=1.077 Sum_probs=34.3
Q ss_pred CCCCCccccCCCceeCCccccCCCCCCCCCCCCCCCc
Q psy954 120 TCDGSKFFCRNGKCISRMWSCDGDDDCGDNSDEDPNY 156 (337)
Q Consensus 120 ~C~~~~f~C~~g~CI~~~~~CDG~~DC~DgsDE~~~~ 156 (337)
+|.+++|+|.+|+||+..|+|||++||+|||||.+..
T Consensus 2 tC~~~~f~C~~g~CI~~~~~CDg~~DC~DgsDE~~~~ 38 (39)
T d2fcwb2 2 TCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQR 38 (39)
T ss_dssp HCCTTEEECTTSCEEEGGGTTSSSCCSTTCGGGCGGG
T ss_pred ccCCCceEcCCCCeEChhhcCCCCCCCCCCCcCCCCc
Confidence 5889999999999999999999999999999998643
|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i2 g.3.11.1 (I:388-422) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|