Psyllid ID: psy9550

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MSYSTPPRRSSGRTTSRPRSLYSSSPSPQSRNLSSYSSGLSSSTPYLNSSYPSYGSTYGGTSSGYGGLTLPSSYSRPSQSSPRSYHAPPSSYRSSYAPTTTPLPPVRPRRSKSSTRSANYTPEGGGRMSRSGSTTSLNSLRSEAPSEGYESGGDNLSTSRSRVNSESGGSSRKLPNENGELDYKKLYEESQAELSRLRETLSKTEEELNQVKATYSKNSLSEQEKRERRTMERKLSEMEVELKELDQFKKENQRLKDENGALIRVISKLSK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
msystpprrssgrttsrprslyssspspqsrnlssyssglssstpylnssypsygstyggtssgyggltlpssysrpsqssprsyhappssyrssyaptttplppvrprrsksstrsanytpegggrmsrsgsttslnslrseapsegyesggdnlstsrsrvnsesggssrklpnengeldYKKLYEESQAELSRLRETLSKTEEELNQVKATysknslseQEKRERRTMERKLSEMEVELKELDQFKKENQRLKDENGALIRVISKLSK
msystpprrssgrttsrprslyssspspqsrnLSSYSSGLSSSTPYLNSSYPSYGSTYGGTSSGYGGLTLPSSYSRPSQSSPRSYhappssyrssyaptttplppvrprrsksstrsanytpegggrmsrsgstTSLNSLRseapsegyesggdnlstsrsrvnsesggssrklpnengeldYKKLYEESQAELSRLRETLSKTEEelnqvkatysknslseqekrerrtmerklsEMEVELKELDqfkkenqrlkdengalirvisklsk
MSYstpprrssgrttsrprslyssspspqsrnlssyssglssstpylnssypsygstyggtssgyggltlpssysrpsqssprsyhappssyrssyaptttplppvrprrSKSSTRSANYTPEgggrmsrsgsttsLNSLRSEAPSEGYESGGDNLSTSRSRVNSESGGSSRKLPNENGELDYKKLYEESQAELSRLRETLSKTEEELNQVKATYSKNSLSEQEKRERRTMERKLSEMEVELKELDQFKKENQRLKDENGALIRVISKLSK
*******************************************************************************************************************************************************************************************************************************************************************************
*******************************************************************************************************************************************************************************************************************************************************************GALIRVISKL**
********************************************PYLNSSYPSYGSTYGGTSSGYGGLTLPS*****************************************************************************************************LPNENGELDYKKLYEESQAELSRLRETLSKTEEELNQVKATY*****************RKLSEMEVELKELDQFKKENQRLKDENGALIRVISKLSK
***********************************************************************************************************************************************************************************ELDYKKLYEESQAELSRLRETLSKTEEELNQVKATYSKNSLSEQEKRERRTMERKLSEMEVELKELDQFKKENQRLKDENGALIRVISKLS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYSTPPRRSSGRTTSRPRSLYSSSPSPQSRNLSSYSSGLSSSTPYLNSSYPSYGSTYGGTSSGYGGLTLPSSYSRPSQSSPRSYHAPPSSYRSSYAPTTTPLPPVRPRRSKSSTRSANYTPEGGGRMSRSGSTTSLNSLRSEAPSEGYESGGDNLSTSRSRVNSESGGSSRKLPNENGELDYKKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxYSKNSLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISKLSK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query271 2.2.26 [Sep-21-2011]
Q6DRG71049 Protein phosphatase 1 reg yes N/A 0.332 0.085 0.58 3e-20
Q107281032 Protein phosphatase 1 reg yes N/A 0.332 0.087 0.56 6e-20
O149741030 Protein phosphatase 1 reg yes N/A 0.332 0.087 0.56 8e-20
Q8BG95976 Protein phosphatase 1 reg yes N/A 0.350 0.097 0.514 2e-19
O60237982 Protein phosphatase 1 reg no N/A 0.350 0.096 0.504 5e-19
Q9DBR71029 Protein phosphatase 1 reg yes N/A 0.332 0.087 0.55 5e-19
Q3UMT1782 Protein phosphatase 1 reg yes N/A 0.328 0.113 0.47 2e-15
Q9BZL4782 Protein phosphatase 1 reg no N/A 0.328 0.113 0.47 3e-15
>sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 Back     alignment and function desciption
 Score = 99.0 bits (245), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 68/100 (68%), Gaps = 10/100 (10%)

Query: 182  DYKKLYEESQAELSRLRETLSKTEEELNQVK-----AT-----YSKNSLSEQEKRERRTM 231
            DYKKLYE+  AE  +L+  L  TE EL+ +K     AT     ++  S  E EKRERR +
Sbjct: 950  DYKKLYEQILAENEKLKAQLRDTELELSDLKLQLEKATQRQERFADRSQLEMEKRERRAL 1009

Query: 232  ERKLSEMEVELKELDQFKKENQRLKDENGALIRVISKLSK 271
            ERK+SEME ELK L   K +NQRLKDENGALIRVISKLSK
Sbjct: 1010 ERKISEMEEELKMLPDLKADNQRLKDENGALIRVISKLSK 1049
Regulates myosin phosphatase activity.
Danio rerio (taxid: 7955)
>sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 Back     alignment and function description
>sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 Back     alignment and function description
>sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 Back     alignment and function description
>sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 Back     alignment and function description
>sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 Back     alignment and function description
>sp|Q3UMT1|PP12C_MOUSE Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 Back     alignment and function description
>sp|Q9BZL4|PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
383860351 1180 PREDICTED: uncharacterized protein LOC10 0.867 0.199 0.444 5e-34
340716515 1179 PREDICTED: hypothetical protein LOC10064 0.774 0.178 0.457 6e-34
383860353 1085 PREDICTED: uncharacterized protein LOC10 0.867 0.216 0.444 7e-34
340716517 1084 PREDICTED: hypothetical protein LOC10064 0.774 0.193 0.457 8e-34
380027701 1207 PREDICTED: uncharacterized protein LOC10 0.760 0.170 0.446 9e-33
328788764 1076 PREDICTED: hypothetical protein LOC72654 0.778 0.196 0.439 2e-32
345484761 1193 PREDICTED: hypothetical protein LOC10011 0.833 0.189 0.478 2e-30
270003919 880 hypothetical protein TcasGA2_TC003209 [T 0.402 0.123 0.603 2e-28
332025733 1227 Protein phosphatase 1 regulatory subunit 0.350 0.077 0.666 5e-28
307211463 1189 Protein phosphatase 1 regulatory subunit 0.350 0.079 0.676 1e-27
>gi|383860351|ref|XP_003705654.1| PREDICTED: uncharacterized protein LOC100879751 isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
 Score =  150 bits (379), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 123/277 (44%), Positives = 157/277 (56%), Gaps = 42/277 (15%)

Query: 11   SGRTTSRPRSLYSSSPSPQSRNLSSYSSGLSSSTPYLNSSYPSYGSTYGGTSSGYGGLTL 70
            +G +   P  L   S S  S   +SYS+  S      N SY +  +TYGGT+SGYG +TL
Sbjct: 930  NGNSIGVPNFLNKVSKSNDSFKKNSYSNSTS------NLSYQNPYTTYGGTTSGYGSITL 983

Query: 71   P---SSYSRPSQSSPRSYHAPP--SSYRSSYAPTTTPLPPVRPRRSKSSTRSANYTPEG- 124
            P   +S   PS ++       P  S  + + +   T + P     S+SS+  +  + EG 
Sbjct: 984  PLNINSLRLPSSTNYNYLSLNPNNSQVQRTESFNKTRIKPDFQIGSRSSSLQSLASSEGY 1043

Query: 125  ---GGRMSRSGSTTSLNSLRSEAPSEGYESGGDNLSTSRSRVNSESGGSSRKLPNENGEL 181
                 R  RS    S++SL SEAPS         +ST   R+ S +         ENGEL
Sbjct: 1044 ISGNDRSGRSNRLGSISSLSSEAPS---------MST---RIKSTTS--------ENGEL 1083

Query: 182  DYKKLYEESQAELSRLRETLSKTEEELNQVK-------ATYSKNSLSEQEKRERRTMERK 234
            DYKKLYEESQAE  RL+E L +++E+L +V+       +T +K  LSE EKRERR MERK
Sbjct: 1084 DYKKLYEESQAENERLKEKLRRSDEQLKEVRNLLDKAQSTQNKTVLSEAEKRERRAMERK 1143

Query: 235  LSEMEVELKELDQFKKENQRLKDENGALIRVISKLSK 271
            LSEME ELK +DQ K ENQRLKDENGALIRVISKLSK
Sbjct: 1144 LSEMEEELKVMDQLKCENQRLKDENGALIRVISKLSK 1180

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340716515|ref|XP_003396743.1| PREDICTED: hypothetical protein LOC100646538 isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383860353|ref|XP_003705655.1| PREDICTED: uncharacterized protein LOC100879751 isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340716517|ref|XP_003396744.1| PREDICTED: hypothetical protein LOC100646538 isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380027701|ref|XP_003697558.1| PREDICTED: uncharacterized protein LOC100872908 [Apis florea] Back     alignment and taxonomy information
>gi|328788764|ref|XP_001122270.2| PREDICTED: hypothetical protein LOC726541 [Apis mellifera] Back     alignment and taxonomy information
>gi|345484761|ref|XP_003425117.1| PREDICTED: hypothetical protein LOC100114433 isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|270003919|gb|EFA00367.1| hypothetical protein TcasGA2_TC003209 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332025733|gb|EGI65891.1| Protein phosphatase 1 regulatory subunit 12A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307211463|gb|EFN87569.1| Protein phosphatase 1 regulatory subunit 12A [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
FB|FBgn00055361144 Mbs "Myosin binding subunit" [ 0.424 0.100 0.536 5e-24
UNIPROTKB|F1NU91878 PPP1R12B "Uncharacterized prot 0.494 0.152 0.421 8.7e-21
ZFIN|ZDB-GENE-041011-31049 ppp1r12a "protein phosphatase 0.483 0.124 0.471 1.1e-19
UNIPROTKB|F1NA711029 PPP1R12A "Protein phosphatase 0.442 0.116 0.477 1.3e-19
UNIPROTKB|F8W8M3982 PPP1R12B "Protein phosphatase 0.416 0.115 0.495 3.3e-19
UNIPROTKB|O60237982 PPP1R12B "Protein phosphatase 0.416 0.115 0.495 3.3e-19
UNIPROTKB|E2RHS3983 PPP1R12B "Uncharacterized prot 0.416 0.114 0.495 3.3e-19
MGI|MGI:1916417976 Ppp1r12b "protein phosphatase 0.450 0.125 0.451 8.7e-19
UNIPROTKB|O149741030 PPP1R12A "Protein phosphatase 0.442 0.116 0.477 9.4e-19
RGD|6200131032 Ppp1r12a "protein phosphatase 0.468 0.123 0.464 2e-18
FB|FBgn0005536 Mbs "Myosin binding subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 288 (106.4 bits), Expect = 5.0e-24, P = 5.0e-24
 Identities = 66/123 (53%), Positives = 84/123 (68%)

Query:   157 STSRSRVNSESGGSSRKLPNENGE-LDYKKLYEESQAELSRLRETLSKTEEELNQVKATY 215
             ST+ +   SES  SS     ENG+ +DYK L+E  + E  +LR+ L + ++E  Q +AT 
Sbjct:  1022 STASTATTSESKSSSSNDKTENGDGIDYKALWEAEKLENDKLRQMLKQKDDEAVQTRATL 1081

Query:   216 -------SKNSLSEQEKRERRTMERKLSEMEVELKELDQFKKENQRLKDENGALIRVISK 268
                    +KNSLSE EKRERR MERKLSE+E ELK+LD +K +N RLK+EN ALIRVISK
Sbjct:  1082 ERFANATTKNSLSELEKRERRAMERKLSELEEELKQLDAYKSDNHRLKEENAALIRVISK 1141

Query:   269 LSK 271
             LSK
Sbjct:  1142 LSK 1144
GO:0048477 "oogenesis" evidence=IMP
GO:0017022 "myosin binding" evidence=ISS;NAS
GO:0017023 "myosin phosphatase complex" evidence=ISS;NAS
GO:0017018 "myosin phosphatase activity" evidence=ISS;IMP;NAS
GO:0007391 "dorsal closure" evidence=NAS;IMP
GO:0035317 "imaginal disc-derived wing hair organization" evidence=IMP
GO:0045314 "regulation of compound eye photoreceptor development" evidence=IMP
GO:0008544 "epidermis development" evidence=IMP
GO:0007560 "imaginal disc morphogenesis" evidence=IMP
GO:0043296 "apical junction complex" evidence=IDA
GO:0048675 "axon extension" evidence=IMP
GO:0030725 "germline ring canal formation" evidence=IMP
GO:0045179 "apical cortex" evidence=IDA
GO:0045177 "apical part of cell" evidence=IDA
UNIPROTKB|F1NU91 PPP1R12B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041011-3 ppp1r12a "protein phosphatase 1, regulatory (inhibitor) subunit 12A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NA71 PPP1R12A "Protein phosphatase 1 regulatory subunit 12A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F8W8M3 PPP1R12B "Protein phosphatase 1 regulatory subunit 12B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O60237 PPP1R12B "Protein phosphatase 1 regulatory subunit 12B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHS3 PPP1R12B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1916417 Ppp1r12b "protein phosphatase 1, regulatory (inhibitor) subunit 12B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O14974 PPP1R12A "Protein phosphatase 1 regulatory subunit 12A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|620013 Ppp1r12a "protein phosphatase 1, regulatory subunit 12A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
pfam03938157 pfam03938, OmpH, Outer membrane protein (OmpH-like 9e-06
smart00935140 smart00935, OmpH, Outer membrane protein (OmpH-lik 9e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-05
pfam13851201 pfam13851, GAS, Growth-arrest specific micro-tubul 2e-05
COG1579 239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 4e-05
pfam03961450 pfam03961, DUF342, Protein of unknown function (DU 5e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
pfam03105176 pfam03105, SPX, SPX domain 0.003
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.004
PRK00409 782 PRK00409, PRK00409, recombination and DNA strand e 0.004
>gnl|CDD|217803 pfam03938, OmpH, Outer membrane protein (OmpH-like) Back     alignment and domain information 
 Score = 44.5 bits (106), Expect = 9e-06
 Identities = 20/88 (22%), Positives = 44/88 (50%), Gaps = 7/88 (7%)

Query: 183 YKKLYEESQAELSRLRETLSKTEEELNQVKATYSKN--SLSEQEKRERRTMERKLSEMEV 240
            K   ++ + E  +L+  L K E+EL + +    K   +LSE+ ++ +   +++L + + 
Sbjct: 33  GKAAQKQLEKEFKKLQAELQKKEKELQKEEQKLQKQAATLSEEARKAK---QQELQQKQQ 89

Query: 241 ELKELDQFKKENQRLKDENGALIRVISK 268
           EL++  Q     Q L+ +   L++ I  
Sbjct: 90  ELQQKQQ--AAQQELQQKQQELLQPIYD 115

This family includes outer membrane proteins such as OmpH among others. Skp (OmpH) has been characterized as a molecular chaperone that interacts with unfolded proteins as they emerge in the periplasm from the Sec translocation machinery. Length = 157
>gnl|CDD|214922 smart00935, OmpH, Outer membrane protein (OmpH-like) Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|222417 pfam13851, GAS, Growth-arrest specific micro-tubule binding Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|217817 pfam03961, DUF342, Protein of unknown function (DUF342) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|217372 pfam03105, SPX, SPX domain Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 271
KOG0505|consensus527 99.66
PF13870177 DUF4201: Domain of unknown function (DUF4201) 95.44
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 95.43
PRK10884206 SH3 domain-containing protein; Provisional 95.26
COG2433 652 Uncharacterized conserved protein [Function unknow 95.24
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 95.05
KOG1853|consensus 333 94.63
PF08172 248 CASP_C: CASP C terminal; InterPro: IPR012955 This 94.49
PRK10884206 SH3 domain-containing protein; Provisional 94.22
PF00038312 Filament: Intermediate filament protein; InterPro: 93.97
PRK01885157 greB transcription elongation factor GreB; Reviewe 93.84
PF0344974 GreA_GreB_N: Transcription elongation factor, N-te 93.82
PF1518885 CCDC-167: Coiled-coil domain-containing protein 16 93.29
PF06428100 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IP 93.29
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 93.07
KOG0999|consensus 772 93.04
PF03938158 OmpH: Outer membrane protein (OmpH-like); InterPro 92.99
PF09738 302 DUF2051: Double stranded RNA binding protein (DUF2 92.91
PRK05892158 nucleoside diphosphate kinase regulator; Provision 92.53
TIGR01461156 greB transcription elongation factor GreB. The Gre 92.17
PRK09039 343 hypothetical protein; Validated 91.99
KOG0977|consensus 546 91.9
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 91.89
PF04420161 CHD5: CHD5-like protein; InterPro: IPR007514 Membe 91.82
KOG0995|consensus 581 91.81
PRK11637 428 AmiB activator; Provisional 91.8
PRK13922 276 rod shape-determining protein MreC; Provisional 91.76
PF13851201 GAS: Growth-arrest specific micro-tubule binding 91.37
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 91.15
TIGR01462151 greA transcription elongation factor GreA. In the 91.08
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 91.03
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 90.98
PF1045866 Val_tRNA-synt_C: Valyl tRNA synthetase tRNA bindin 90.96
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 90.69
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 90.55
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 90.5
PHA02562 562 46 endonuclease subunit; Provisional 89.33
PF07246264 Phlebovirus_NSM: Phlebovirus nonstructural protein 89.23
KOG0977|consensus 546 89.2
PRK10780165 periplasmic chaperone; Provisional 89.19
PF10226 195 DUF2216: Uncharacterized conserved proteins (DUF22 89.13
PTZ00419995 valyl-tRNA synthetase-like protein; Provisional 89.1
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 89.06
KOG0971|consensus 1243 88.99
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 88.94
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 88.89
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 88.79
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 88.67
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 88.36
PRK06342160 transcription elongation factor regulatory protein 88.33
KOG4657|consensus 246 88.22
COG4026290 Uncharacterized protein containing TOPRIM domain, 88.15
KOG0804|consensus493 88.11
PF00038312 Filament: Intermediate filament protein; InterPro: 88.02
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 87.96
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 87.96
PRK09039 343 hypothetical protein; Validated 87.9
PF00769 246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 87.7
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 87.67
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 87.58
PF13863126 DUF4200: Domain of unknown function (DUF4200) 87.45
COG4026290 Uncharacterized protein containing TOPRIM domain, 87.43
PF02388406 FemAB: FemAB family; InterPro: IPR003447 The femAB 87.32
PHA02562 562 46 endonuclease subunit; Provisional 87.2
PF08172 248 CASP_C: CASP C terminal; InterPro: IPR012955 This 86.92
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 86.67
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 86.55
KOG2391|consensus365 86.53
COG1792 284 MreC Cell shape-determining protein [Cell envelope 86.15
PF03961451 DUF342: Protein of unknown function (DUF342); Inte 86.13
PRK03918 880 chromosome segregation protein; Provisional 85.86
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 85.64
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 85.63
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 85.61
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 85.48
KOG4643|consensus 1195 85.31
PRK00226157 greA transcription elongation factor GreA; Reviewe 85.17
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 84.97
PF08657259 DASH_Spc34: DASH complex subunit Spc34 ; InterPro: 84.91
PRK12704 520 phosphodiesterase; Provisional 84.86
COG1579 239 Zn-ribbon protein, possibly nucleic acid-binding [ 84.54
PRK14900 1052 valS valyl-tRNA synthetase; Provisional 84.54
TIGR03495135 phage_LysB phage lysis regulatory protein, LysB fa 84.26
PRK05729874 valS valyl-tRNA synthetase; Reviewed 84.21
PRK14127109 cell division protein GpsB; Provisional 84.21
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 84.13
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 84.12
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 84.1
PF13094160 CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub 83.94
PLN023811066 valyl-tRNA synthetase 83.79
KOG3119|consensus269 83.65
PF09798 654 LCD1: DNA damage checkpoint protein; InterPro: IPR 83.65
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 83.52
PF10205102 KLRAQ: Predicted coiled-coil domain-containing pro 83.46
COG1792 284 MreC Cell shape-determining protein [Cell envelope 83.36
PRK13922 276 rod shape-determining protein MreC; Provisional 83.28
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 83.21
PF04782 312 DUF632: Protein of unknown function (DUF632); Inte 83.08
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 83.06
PF10226195 DUF2216: Uncharacterized conserved proteins (DUF22 82.93
COG1579 239 Zn-ribbon protein, possibly nucleic acid-binding [ 82.83
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 82.77
KOG0804|consensus493 82.63
PRK11020118 hypothetical protein; Provisional 82.39
PRK12704 520 phosphodiesterase; Provisional 82.38
COG0216 363 PrfA Protein chain release factor A [Translation, 82.33
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 82.2
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 82.19
PF08232134 Striatin: Striatin family; InterPro: IPR013258 Thi 82.09
KOG3564|consensus 604 81.79
PRK14720906 transcript cleavage factor/unknown domain fusion p 81.66
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 81.5
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 81.34
PRK11546143 zraP zinc resistance protein; Provisional 81.28
KOG4572|consensus 1424 81.11
COG4942 420 Membrane-bound metallopeptidase [Cell division and 81.1
KOG4005|consensus 292 81.08
PF05130143 FlgN: FlgN protein; InterPro: IPR007809 Flagella s 80.9
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 80.81
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 80.65
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 80.11
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 80.01
>KOG0505|consensus Back     alignment and domain information 
Probab=99.66  E-value=5e-17  Score=159.11  Aligned_cols=138  Identities=33%  Similarity=0.403  Sum_probs=103.0

Q ss_pred             cccCCCcccccccccCCCCCCccCCCCCCcccccccccCCC---CCCCCCCCCCCCcchHHHHHHHHHHHHHHHHHHHHH
Q psy9550         128 MSRSGSTTSLNSLRSEAPSEGYESGGDNLSTSRSRVNSESG---GSSRKLPNENGELDYKKLYEESQAELSRLRETLSKT  204 (271)
Q Consensus       128 ~SrS~St~sL~s~rs~t~se~y~Sg~drts~~~sr~~s~as---~~~~~~~~e~~~~DYKkLYE~~k~ENErLk~~L~e~  204 (271)
                      .+|=.+-...+|....+..+.-+-+ .++..+-.|++...+   .+.+...+++-..||+++||.+..|+.||+.+|++.
T Consensus       375 ~~r~~s~~~~~P~~~~~~~~~~~a~-~~r~~~~~~l~t~~s~~~~~~~~~~e~~~n~e~~~~~e~~l~~~qr~~~kl~~~  453 (527)
T KOG0505|consen  375 TLRDPSGGLSNPATRTTAPDRSGAG-PLREPRKKRLSTLVSYQEEPQRATTEEDLNHEYEKESERALKESQRLSAKLQSA  453 (527)
T ss_pred             ccCCCCcccCCCceeccCCCCCCCc-cccchhhcccccccccccccccCCCcccccccccchhhhhhhhhhhhhhccccc
Confidence            3333333334555444443333322 222233444443333   112334567778999999999999999999999999


Q ss_pred             HHHHHHHHHHhhh------------cchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcccccchhhhhh
Q psy9550         205 EEELNQVKATYSK------------NSLSEQEKRERRTMERKLSEMEVELKELDQFKKENQRLKDENGALIRVIS  267 (271)
Q Consensus       205 ~~El~qlk~~LEk------------~SLlE~EkrERRaLERKiSEmEEELK~L~~LRadNQRLKDENgALIRVIS  267 (271)
                      +.++++++..|++            .+++|+|++|+|+|||||+|||+|+|.|.+|+ +||+||+||+||||||+
T Consensus       454 ~~e~t~~~s~~~~~a~~~~e~~a~~~~~~e~e~~errslerk~s~~e~e~k~l~~l~-~n~~l~~en~al~rvi~  527 (527)
T KOG0505|consen  454 PLESTDLGSKLLRVAQQSQERTADRSSLLETEPRERRSLERKMSELEEELKLLKSLR-PNQRLKEENHALCRVIS  527 (527)
T ss_pred             chhhhhhhhhhhhccccccccccccccccccCcccccchhhHHHHHhcccchhhhcc-hhhhhhhhcCcceeecC
Confidence            9999999877652            36889999999999999999999999999999 99999999999999996

>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>KOG1853|consensus Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK01885 greB transcription elongation factor GreB; Reviewed Back     alignment and domain information
>PF03449 GreA_GreB_N: Transcription elongation factor, N-terminal; InterPro: IPR022691 Bacterial proteins greA and greB are necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites Back     alignment and domain information
>PF15188 CCDC-167: Coiled-coil domain-containing protein 167 Back     alignment and domain information
>PF06428 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IPR009449 In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion [] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG0999|consensus Back     alignment and domain information
>PF03938 OmpH: Outer membrane protein (OmpH-like); InterPro: IPR005632 This entry includes outer membrane proteins such as OmpH (Skp) among others Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PRK05892 nucleoside diphosphate kinase regulator; Provisional Back     alignment and domain information
>TIGR01461 greB transcription elongation factor GreB Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF04420 CHD5: CHD5-like protein; InterPro: IPR007514 Members of this family are probably coiled-coil proteins that are similar to the CHD5 (Congenital heart disease 5) protein Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR01462 greA transcription elongation factor GreA Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>PF10458 Val_tRNA-synt_C: Valyl tRNA synthetase tRNA binding arm; InterPro: IPR019499 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF07246 Phlebovirus_NSM: Phlebovirus nonstructural protein NS-M; InterPro: IPR009879 This entry consists of several Phlebovirus nonstructural NS-M proteins, which represent the N-terminal region of the M polyprotein precursor Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>PRK10780 periplasmic chaperone; Provisional Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>PTZ00419 valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PRK06342 transcription elongation factor regulatory protein; Validated Back     alignment and domain information
>KOG4657|consensus Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF02388 FemAB: FemAB family; InterPro: IPR003447 The femAB operon codes for two nearly identical approximately 50kDa proteins involved in the formation of the Staphylococcal pentaglycine interpeptide bridge in peptidoglycan [] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>KOG2391|consensus Back     alignment and domain information
>COG1792 MreC Cell shape-determining protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03961 DUF342: Protein of unknown function (DUF342); InterPro: IPR005646 This family of bacterial proteins has no known function Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>KOG4643|consensus Back     alignment and domain information
>PRK00226 greA transcription elongation factor GreA; Reviewed Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF08657 DASH_Spc34: DASH complex subunit Spc34 ; InterPro: IPR013966 The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis [] Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK14900 valS valyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK14127 cell division protein GpsB; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit Back     alignment and domain information
>PLN02381 valyl-tRNA synthetase Back     alignment and domain information
>KOG3119|consensus Back     alignment and domain information
>PF09798 LCD1: DNA damage checkpoint protein; InterPro: IPR018622 This is a family of proteins which regulate checkpoint kinases Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF10205 KLRAQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019343 This entry represents a N-terminal 100 residues long domain, which contains a conserved KLRAQ motif Back     alignment and domain information
>COG1792 MreC Cell shape-determining protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF04782 DUF632: Protein of unknown function (DUF632); InterPro: IPR006867 This conserved region contains a leucine zipper-like domain Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PRK11020 hypothetical protein; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>COG0216 PrfA Protein chain release factor A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin Back     alignment and domain information
>KOG3564|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK11546 zraP zinc resistance protein; Provisional Back     alignment and domain information
>KOG4572|consensus Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4005|consensus Back     alignment and domain information
>PF05130 FlgN: FlgN protein; InterPro: IPR007809 Flagella synthesis protein FlgN is an export chaperone involved in flagellar synthesis [] Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 1e-07
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-07
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 1e-06
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-06
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 3e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-07
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 4e-07
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-06
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-06
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 4e-06
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 3e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 6e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 7e-05
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 1e-04
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-04
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 8e-04
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
 Score = 51.6 bits (123), Expect = 1e-07
 Identities = 36/170 (21%), Positives = 58/170 (34%), Gaps = 10/170 (5%)

Query: 10   SSGRTTSRPRSLYSSSPSPQSRNLSSYSSGLSSSTPYLNSSYPSYGST---YGGTSSGYG 66
                         +   +P S      S G S ++P  + + P+Y  T   Y  TS  Y 
Sbjct: 1512 GGADYGEATSPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYS 1571

Query: 67   GLTLPSSYSRPSQSSPRSYHAPPSSYRSSYAPTTTPLPPVRPRRSKSSTRSANYTPEGGG 126
              +   S + PS S     ++P S   S  +P+ +P  P        S  S +Y+P    
Sbjct: 1572 PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSP------SYSPTSPSYSP-TSP 1624

Query: 127  RMSRSGSTTSLNSLRSEAPSEGYESGGDNLSTSRSRVNSESGGSSRKLPN 176
              S +  + S  S      S  Y     + S +    +  S   S   P+
Sbjct: 1625 SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPS 1674
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Length = 104 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 96.72
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 95.76
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.4
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 95.31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.77
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 94.55
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 94.33
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 94.31
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 93.8
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 93.66
1grj_A158 GREA protein; transcript elongation factor, transc 92.7
2f23_A156 Anti-cleavage anti-GREA transcription factor GFH1; 92.54
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 92.47
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 92.36
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 91.92
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 91.79
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 91.7
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 91.37
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 91.25
2p4v_A158 Transcription elongation factor GREB; transcript c 91.21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 90.53
2v4h_A110 NF-kappa-B essential modulator; transcription, met 90.36
4h22_A103 Leucine-rich repeat flightless-interacting protei; 90.31
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 90.21
1cii_A 602 Colicin IA; bacteriocin, ION channel formation, tr 89.94
1vcs_A102 Vesicle transport through interaction with T- snar 89.83
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 89.32
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 89.31
2j5u_A 255 MREC protein; bacterial cell shape determining pro 89.29
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 88.68
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 88.67
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 88.52
1c1g_A 284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 87.61
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 87.54
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 87.51
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 87.44
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 87.25
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 87.08
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 87.0
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 86.78
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 86.17
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 86.1
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 86.08
2j5u_A 255 MREC protein; bacterial cell shape determining pro 85.43
3cve_A72 Homer protein homolog 1; coiled coil, alternative 85.27
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 84.7
2zxx_A79 Geminin; coiled-coil, cell cycle, coiled coil, DNA 84.6
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 84.42
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 84.3
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 83.89
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 83.61
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 83.55
3bas_A89 Myosin heavy chain, striated muscle/general contro 83.53
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 83.45
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 83.41
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 83.36
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 83.33
2v4h_A110 NF-kappa-B essential modulator; transcription, met 83.21
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 83.12
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 83.02
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 82.69
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 82.22
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 81.97
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 81.62
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 81.2
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 81.14
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 80.58
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 80.26
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 80.19
1deb_A54 APC protein, adenomatous polyposis coli protein; c 80.03
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
Probab=96.72  E-value=0.007  Score=52.62  Aligned_cols=43  Identities=40%  Similarity=0.498  Sum_probs=28.2

Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhcccccch
Q psy9550         219 SLSEQEKRERRTMERKLSEMEVELKELDQFKKENQRLKDENGAL  262 (271)
Q Consensus       219 SLlE~EkrERRaLERKiSEmEEELK~L~~LRadNQRLKDENgAL  262 (271)
                      ++.++|.+--++|||. +=||.||..-+.|+.++||||||-.-|
T Consensus       131 SleD~e~kln~aiEr~-alLE~El~EKe~l~~~~QRLkdE~rDL  173 (189)
T 2v71_A          131 SLEDFEQRLNQAIERN-AFLESELDEKESLLVSVQRLKDEARDL  173 (189)
T ss_dssp             HHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHCCC----------
T ss_pred             hHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5778888888899875 458889999999999999999997654
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1grj_A GREA protein; transcript elongation factor, transcript cleavage factor, transcription regulation; 2.20A {Escherichia coli} SCOP: a.2.1.1 d.26.1.2 Back     alignment and structure
>2f23_A Anti-cleavage anti-GREA transcription factor GFH1; anti-GREA GFH1 thermus thermophilus; 1.60A {Thermus thermophilus} SCOP: a.2.1.1 d.26.1.2 PDB: 2eul_A 3aoh_X* 3aoi_X* 2etn_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2p4v_A Transcription elongation factor GREB; transcript cleavage, GRE-factors, RNA polymerase; 2.60A {Escherichia coli} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1cii_A Colicin IA; bacteriocin, ION channel formation, transmembrane protein; 3.00A {Escherichia coli} SCOP: f.1.1.1 h.4.3.1 Back     alignment and structure
>1vcs_A Vesicle transport through interaction with T- snares homolog 1A; HABC domain, VTI1, UP and DOWN three helix bundle, LEFT-handed twist; NMR {Mus musculus} SCOP: a.47.2.1 Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 271
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 2e-04
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

class: All alpha proteins
fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 40.1 bits (93), Expect = 2e-04
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 184 KKLYEESQAELSRLRETLSKTEEELNQVKATYSKNSLSEQEKRERRTMERKLSEMEVELK 243
            K+  E Q +  ++ E   ++ +E  +      +N   +  K + RT+  KL E E  LK
Sbjct: 220 AKMLHEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLK 279

Query: 244 ELDQFKKENQRLKDE 258
           E   F+KE++ +K+E
Sbjct: 280 E--GFQKESRIMKNE 292

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
d1grja178 GreA transcript cleavage protein, N-terminal domai 94.05
d2f23a175 GreA transcript cleavage protein, N-terminal domai 92.71
d1ivsa166 Valyl-tRNA synthetase (ValRS) C-terminal domain {T 88.44
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 80.07
>d1grja1 a.2.1.1 (A:2-79) GreA transcript cleavage protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: GreA transcript cleavage protein, N-terminal domain
family: GreA transcript cleavage protein, N-terminal domain
domain: GreA transcript cleavage protein, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=94.05  E-value=0.14  Score=37.03  Aligned_cols=59  Identities=14%  Similarity=0.223  Sum_probs=44.9

Q ss_pred             HHHHHHHHHHHHHH-HHHHHHHHHHHHHHH--hhhcchhHHHHHHHHHHHHHHHHHHHHHHH
Q psy9550         186 LYEESQAELSRLRE-TLSKTEEELNQVKAT--YSKNSLSEQEKRERRTMERKLSEMEVELKE  244 (271)
Q Consensus       186 LYE~~k~ENErLk~-~L~e~~~El~qlk~~--LEk~SLlE~EkrERRaLERKiSEmEEELK~  244 (271)
                      =|++++.|.+.|+. +.-+..+++.+++..  |.-++=-..-|.+...+|.||.+||..|+.
T Consensus         9 g~~~L~~EL~~L~~~~rpei~~~I~~Ar~~GDlsENaeY~aAKe~q~~~e~RI~eLe~~L~~   70 (78)
T d1grja1           9 GAEKLREELDFLKSVRRPEIIAAIAEAREHGDLKENAEYHAAREQQGFCEGRIKDIEAKLSN   70 (78)
T ss_dssp             HHHHHHHHHHHHHHTHHHHHHHHHHHHHTTCCGGGCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHccHHHHHHHHHHHHHcCChhhhHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            46777888888887 566777778877754  434454455589999999999999999874
>d2f23a1 a.2.1.1 (A:3-77) GreA transcript cleavage protein, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ivsa1 a.2.7.3 (A:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure