Psyllid ID: psy9565

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MNHQSQIIKSSTDSNSDLKVNNENECDDSNRLPSSESSRHLYFTDSNSDLKVNNENECDDSNRLPSSESSRHHISRHLSLSPISSCKSSNKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDVSTVTINNTLNPAGIILSNHQPVSTPLEPCRVAPYVNVPRLPTLPFSASTAAAFSAFDPTLLSAAHQYAAAAATVAALGNAPNGSIFSAASQYPSFSLATLAALHQDRLLSKNSSIADLRLKAKKHAEAIEMAAREKEKT
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHcccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc
cccHHccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHHccccccc
mnhqsqiiksstdsnsdlkvnnenecddsnrlpssessrhlyftdsnsdlkvnnenecddsnrlpssessrhhisrhlslspissckssnkqrrsrtnFTLEQLNELERlfdethypdaFMREELSQRLGLSEARVQNFSQVLNLLIDVSTVTinntlnpagiilsnhqpvstplepcrvapyvnvprlptlpfsastaaafsafdpTLLSAAHQYAAAAATVAAlgnapngsifsaasqypsfSLATLAALHQDRLLSKNSSIADLRLKAKKHAEAIEMAAREKEKT
mnhqsqiiksstdsnsdlkvnnenecddsnrlpssessrhlyftdsnsdlkvnnENECDDsnrlpssessrhhisrhlslspissckssnkqrrsrtnftleqlNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDVSTVTINNTLNPAGIILSNHQPVSTPLEPCRVAPYVNVPRLPTLPFSASTAAAFSAFDPTLLSAAHQYAAAAATVAALGNAPNGSIFSAASQYPSFSLATLAALHQDRLLSKNSSIADLRLKAKKHAEAIEMAAREKEKT
MNHQSQIIKSSTDSNSDLKVNNENECDDSNRLPSSESSRHLYFTDSNSDLKVNNENECDDSNRlpssessrhhisrhlslspissckssNKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDVSTVTINNTLNPAGIILSNHQPVSTPLEPCRVAPYVNVPRLptlpfsastaaafsafdptLLSaahqyaaaaatvaalgnaPNGSIFSAASQYPSFSLATLAALHQDRLLSKNSSIADLRLKAKKHAEAIEMAAREKEKT
*********************************************************************************************************ELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDVSTVTINNTLNPAGIILSNHQPVSTPLEPCRVAPYVNVPRLPTLPFSASTAAAFSAFDPTLLSAAHQYAAAAATVAALGNAPNGSIFSAASQYPSFSLATLAALHQDRL*******************************
*************************************************************************************************NFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNL**********************************************************************************************************************IADLRLKAKKHA*************
***************SDLKVNNENECDDSNRLPSSESSRHLYFTDSNSDLKVNNE**********************LSLSPIS************TNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDVSTVTINNTLNPAGIILSNHQPVSTPLEPCRVAPYVNVPRLPTLPFSASTAAAFSAFDPTLLSAAHQYAAAAATVAALGNAPNGSIFSAASQYPSFSLATLAALHQDRLLSKNSSIADLRLKAKKHAEAIEM********
***************************D*******************************************************************RTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDVSTVTINNTLNPAGIILSNHQPVSTPLEPCRVAPYVNVPRLPTLPFSASTAAAFSAFDPTLLSAAHQYAAAAATVAALGNAPNGSIFSAASQYPSFSLATLAA************IA*LRLKAKKHAEAIEMA*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHQSQIIKSSTDSNSDLKVNNENECDDSNRLPSSESSRHLYFTDSNSDLKVNNENECDDSNRLPSSESSRHHISRHLSLSPISSCKSSNKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDVSTVTINNTLNPAGIILSNHQPVSTPLEPCRVAPYVNVPRLPTLPFSASTAAAFSAFDPTLLSAAHQYAAAAATVAALGNAPNGSIFSAASQYPSFSLATLAALHQDRLLSKNSSxxxxxxxxxxxxxxxxxxxxxKEKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query288 2.2.26 [Sep-21-2011]
O35750237 Short stature homeobox pr yes N/A 0.607 0.738 0.471 5e-30
O60902331 Short stature homeobox pr yes N/A 0.625 0.543 0.463 4e-29
P70390331 Short stature homeobox pr yes N/A 0.625 0.543 0.463 5e-29
O15266292 Short stature homeobox pr no N/A 0.572 0.565 0.460 8e-29
Q9H161411 Homeobox protein aristale no N/A 0.604 0.423 0.331 6e-15
Q4LAL6397 Homeobox protein aristale no N/A 0.600 0.435 0.321 1e-14
O35137399 Homeobox protein aristale no N/A 0.600 0.433 0.321 1e-14
Q6SZ65360 Homeobox protein orthoped N/A N/A 0.177 0.141 0.647 2e-13
P56672 409 Homeobox protein orthoped no N/A 0.274 0.193 0.468 2e-13
P23760479 Paired box protein Pax-3 no N/A 0.170 0.102 0.693 2e-13
>sp|O35750|SHOX2_RAT Short stature homeobox protein 2 (Fragment) OS=Rattus norvegicus GN=Shox2 PE=2 SV=2 Back     alignment and function desciption
 Score =  131 bits (330), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 98/208 (47%), Positives = 114/208 (54%), Gaps = 33/208 (15%)

Query: 91  KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDVS 150
           KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQ + Q         
Sbjct: 45  KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRR----AK 100

Query: 151 TVTINNTLNPAGIILSNHQPVSTPLEPCRVAPYVNVPRLPTLPFSAS-----TAAAFSAF 205
                N L+  G+++      ++  E CRVAPYVNV  L  +PF        T  +F   
Sbjct: 101 CRKQENQLH-KGVLIG----AASQFEACRVAPYVNVGAL-RMPFQQDSHCNVTPLSFQVQ 154

Query: 206 DPTLLSAAHQYAAAAATVAALGNAPNGSIFSAASQYPSFS--LATL-----------AAL 252
               L +A + A          + P   +F A    P F   LATL           AA 
Sbjct: 155 AHVQLDSAVRAAHHHLHPHLAAHGPY-MMFPA----PPFGLPLATLAADSASAASVVAAA 209

Query: 253 HQDRLLSKNSSIADLRLKAKKHAEAIEM 280
              +  SKNSSIADLRLKAKKHA A+ +
Sbjct: 210 AAAKTTSKNSSIADLRLKAKKHAAALGL 237
May be a growth regulator and have a role in specifying neural systems involved in processing somatosensory information, as well as in face and body structure formation.
Rattus norvegicus (taxid: 10116)
>sp|O60902|SHOX2_HUMAN Short stature homeobox protein 2 OS=Homo sapiens GN=SHOX2 PE=2 SV=4 Back     alignment and function description
>sp|P70390|SHOX2_MOUSE Short stature homeobox protein 2 OS=Mus musculus GN=Shox2 PE=2 SV=1 Back     alignment and function description
>sp|O15266|SHOX_HUMAN Short stature homeobox protein OS=Homo sapiens GN=SHOX PE=1 SV=1 Back     alignment and function description
>sp|Q9H161|ALX4_HUMAN Homeobox protein aristaless-like 4 OS=Homo sapiens GN=ALX4 PE=1 SV=2 Back     alignment and function description
>sp|Q4LAL6|ALX4_BOVIN Homeobox protein aristaless-like 4 OS=Bos taurus GN=ALX4 PE=2 SV=1 Back     alignment and function description
>sp|O35137|ALX4_MOUSE Homeobox protein aristaless-like 4 OS=Mus musculus GN=Alx4 PE=1 SV=1 Back     alignment and function description
>sp|Q6SZ65|OTP_LYTVA Homeobox protein orthopedia OS=Lytechinus variegatus GN=Otp PE=2 SV=1 Back     alignment and function description
>sp|P56672|OTP_DROME Homeobox protein orthopedia OS=Drosophila melanogaster GN=otp PE=2 SV=2 Back     alignment and function description
>sp|P23760|PAX3_HUMAN Paired box protein Pax-3 OS=Homo sapiens GN=PAX3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
242013225218 Short stature homeobox protein, putative 0.652 0.862 0.608 8e-48
328714903330 PREDICTED: short stature homeobox protei 0.600 0.524 0.656 3e-46
189234030254 PREDICTED: similar to CG34367 CG34367-PC 0.649 0.736 0.549 1e-42
195473619 420 GE26064 [Drosophila yakuba] gi|194175191 0.684 0.469 0.430 6e-37
194761770387 GF14108 [Drosophila ananassae] gi|190616 0.611 0.454 0.460 1e-36
194859821 419 GG23943 [Drosophila erecta] gi|190661325 0.642 0.441 0.448 4e-36
161076856 420 CG34367, isoform C [Drosophila melanogas 0.642 0.440 0.422 2e-35
281364781297 CG34367, isoform B [Drosophila melanogas 0.642 0.622 0.422 4e-35
383863721374 PREDICTED: short stature homeobox protei 0.777 0.598 0.445 9e-35
340714415384 PREDICTED: short stature homeobox protei 0.777 0.583 0.451 5e-33
>gi|242013225|ref|XP_002427315.1| Short stature homeobox protein, putative [Pediculus humanus corporis] gi|212511656|gb|EEB14577.1| Short stature homeobox protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  196 bits (499), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 123/202 (60%), Positives = 141/202 (69%), Gaps = 14/202 (6%)

Query: 84  SSCKSSNKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVL 143
           SS K  NKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQ + Q  
Sbjct: 23  SSSKLQNKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNR 82

Query: 144 NLLIDVSTVTINNTLNPAGIILSNHQP--VSTPLEPCRVAPYVNVP--RLPTLPFSASTA 199
                 +    + +    G+I+S+H P  VST LEPCRVAPYVNVP  RL +      + 
Sbjct: 83  R-----AKCRKHESQMQKGMIVSSHTPATVSTTLEPCRVAPYVNVPSIRLTSSYNQMQSL 137

Query: 200 AAFSAFDPTLLSAAHQYAAAAATVAALGNAPNGSIFSAASQYPSFSLATLAALHQDRLLS 259
           + FS FDP L SAA Q  AAAA   +  ++P   +F    QYP   LA LAA+HQDRL S
Sbjct: 138 SGFSTFDPALFSAAAQQYAAAAAAFSSSSSP--LVF--CPQYP-LGLAALAAVHQDRLYS 192

Query: 260 KNSSIADLRLKAKKHAEAIEMA 281
           KNSSIADLR KAKKHAEA++M+
Sbjct: 193 KNSSIADLRFKAKKHAEALKMS 214

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328714903|ref|XP_001946558.2| PREDICTED: short stature homeobox protein 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189234030|ref|XP_967102.2| PREDICTED: similar to CG34367 CG34367-PC [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195473619|ref|XP_002089090.1| GE26064 [Drosophila yakuba] gi|194175191|gb|EDW88802.1| GE26064 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194761770|ref|XP_001963098.1| GF14108 [Drosophila ananassae] gi|190616795|gb|EDV32319.1| GF14108 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|194859821|ref|XP_001969458.1| GG23943 [Drosophila erecta] gi|190661325|gb|EDV58517.1| GG23943 [Drosophila erecta] Back     alignment and taxonomy information
>gi|161076856|ref|NP_001097140.1| CG34367, isoform C [Drosophila melanogaster] gi|157400139|gb|ABV53663.1| CG34367, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|281364781|ref|NP_001162934.1| CG34367, isoform B [Drosophila melanogaster] gi|124248424|gb|ABM92832.1| IP17602p [Drosophila melanogaster] gi|272406982|gb|AAF52920.2| CG34367, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|383863721|ref|XP_003707328.1| PREDICTED: short stature homeobox protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340714415|ref|XP_003395724.1| PREDICTED: short stature homeobox protein 2-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
FB|FBgn0085396420 CG34367 [Drosophila melanogast 0.329 0.226 0.626 8.1e-35
ZFIN|ZDB-GENE-040426-1457299 shox2 "short stature homeobox 0.312 0.301 0.636 1.1e-33
UNIPROTKB|E1BLB9331 E1BLB9 "Uncharacterized protei 0.312 0.271 0.636 7.7e-31
UNIPROTKB|E2QZN5334 SHOX2 "Uncharacterized protein 0.312 0.269 0.636 7.7e-31
UNIPROTKB|F6Y4K5319 SHOX2 "Uncharacterized protein 0.312 0.282 0.636 7.7e-31
UNIPROTKB|A6NLG4190 SHOX2 "cDNA FLJ38019 fis, clon 0.312 0.473 0.636 7.7e-31
UNIPROTKB|O60902331 SHOX2 "Short stature homeobox 0.312 0.271 0.636 7.7e-31
UNIPROTKB|I3L828321 SHOX2 "Uncharacterized protein 0.312 0.280 0.636 7.7e-31
MGI|MGI:1201673331 Shox2 "short stature homeobox 0.312 0.271 0.636 7.7e-31
RGD|3674237 Shox2 "short stature homeobox 0.312 0.379 0.636 7.7e-31
FB|FBgn0085396 CG34367 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 293 (108.2 bits), Expect = 8.1e-35, Sum P(2) = 8.1e-35
 Identities = 62/99 (62%), Positives = 73/99 (73%)

Query:    91 KQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDVS 150
             KQRRSRTNFTL+QLNELERLF+ETHYPDAFMREELSQRLGLSEARVQ + Q         
Sbjct:   191 KQRRSRTNFTLDQLNELERLFEETHYPDAFMREELSQRLGLSEARVQVWFQNRR----AK 246

Query:   151 TVTINNTLNPAGIILSNHQPVSTPLEPCRVAPYVNVPRL 189
                  N ++   ++ S   P++TPLEPCRVAPYV++  L
Sbjct:   247 CRKHENQMHKGFLVGSRSPPIATPLEPCRVAPYVSLAAL 285
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0000976 "transcription regulatory region sequence-specific DNA binding" evidence=IEA
ZFIN|ZDB-GENE-040426-1457 shox2 "short stature homeobox 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLB9 E1BLB9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZN5 SHOX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6Y4K5 SHOX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A6NLG4 SHOX2 "cDNA FLJ38019 fis, clone CTONG2012758, highly similar to Short stature homeobox protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O60902 SHOX2 "Short stature homeobox protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L828 SHOX2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1201673 Shox2 "short stature homeobox 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3674 Shox2 "short stature homeobox 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O35750SHOX2_RATNo assigned EC number0.47110.60760.7383yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
pfam0004657 pfam00046, Homeobox, Homeobox domain 6e-19
smart0038957 smart00389, HOX, Homeodomain 9e-16
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 7e-15
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 9e-05
pfam0382621 pfam03826, OAR, OAR domain 4e-04
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 78.3 bits (194), Expect = 6e-19
 Identities = 26/49 (53%), Positives = 36/49 (73%)

Query: 93  RRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQ 141
           RR RT FT EQL ELE+ F++  YP A  REEL+++LGL+E +V+ + Q
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQ 49

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|146451 pfam03826, OAR, OAR domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 288
KOG0486|consensus351 99.85
KOG0488|consensus309 99.85
KOG0484|consensus125 99.85
KOG0485|consensus268 99.82
KOG0842|consensus307 99.8
KOG0489|consensus261 99.8
KOG2251|consensus228 99.79
KOG0843|consensus197 99.78
KOG0487|consensus308 99.78
KOG0494|consensus332 99.78
KOG0850|consensus245 99.76
KOG0492|consensus246 99.73
KOG0848|consensus317 99.71
KOG0849|consensus354 99.69
KOG0844|consensus408 99.68
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.66
KOG0491|consensus194 99.66
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.65
KOG0493|consensus342 99.64
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.54
KOG0483|consensus198 99.5
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.49
COG5576156 Homeodomain-containing transcription factor [Trans 99.49
KOG3802|consensus398 99.48
KOG4577|consensus383 99.44
KOG0847|consensus288 99.42
KOG0490|consensus235 99.42
PF0382621 OAR: OAR domain; InterPro: IPR003654 This 14 amino 99.25
KOG1168|consensus385 98.96
KOG3862|consensus327 98.68
KOG0775|consensus304 98.62
KOG0774|consensus334 98.4
KOG0490|consensus235 98.3
KOG2252|consensus558 98.29
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.17
KOG1146|consensus 1406 97.67
PF00292125 PAX: 'Paired box' domain; InterPro: IPR001523 The 97.41
KOG3517|consensus334 97.29
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.67
KOG0773|consensus342 95.43
KOG3623|consensus 1007 94.74
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 94.49
KOG1924|consensus 1102 91.22
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 81.23
>KOG0486|consensus Back     alignment and domain information 
Probab=99.85  E-value=1.1e-21  Score=174.94  Aligned_cols=67  Identities=37%  Similarity=0.470  Sum_probs=61.4

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHhhhCCCCCHHhHHHHHHhcCCChhhhcccccchhccccchhhhhhhccCC
Q psy9565          89 SNKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDVSTVTINNTLNP  160 (288)
Q Consensus        89 ~~k~rr~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~La~~l~l~~~~v~vWFqnrR~k~k~~~~~~~~~~~~  160 (288)
                      ..|+||.||.||.+||.+||..|+++.|||+..|+|||..++|+|.+|+|||.|||+||     |++|+...
T Consensus       109 i~KqrrQrthFtSqqlqele~tF~rNrypdMstrEEIavwtNlTE~rvrvwfknrrakw-----rkrErN~~  175 (351)
T KOG0486|consen  109 ISKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKW-----RKRERNQQ  175 (351)
T ss_pred             hhhhhhhhhhhHHHHHHHHHHHHhhccCCccchhhHHHhhccccchhhhhhcccchhhh-----hhhhhhHH
Confidence            34788999999999999999999999999999999999999999999999999999999     65555544

>KOG0488|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF03826 OAR: OAR domain; InterPro: IPR003654 This 14 amino acid motif has been identified within the C-terminal region of several Paired-like homeodomain (HD) containing proteins [, ] Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG3862|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF00292 PAX: 'Paired box' domain; InterPro: IPR001523 The paired box is a conserved 124 amino acid N-terminal domain of unknown function that usually, but not always, precedes a homeobox domain (see IPR001356 from INTERPRO) [, ] Back     alignment and domain information
>KOG3517|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG1924|consensus Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 7e-12
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 1e-11
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 3e-11
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 1e-09
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 1e-09
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 1e-08
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 3e-08
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 5e-08
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 2e-06
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 6e-06
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 1e-05
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 2e-04
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure 
Iteration: 1

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 31/52 (59%), Positives = 39/52 (75%)
Query: 90  NKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQ 141
            KQRRSRT F+  QL+ELER F+ T YPD + REEL+QR  L+EAR+Q + Q
Sbjct: 16  RKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFQ 67
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-26
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 3e-26
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 5e-26
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 5e-26
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-25
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-24
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 3e-24
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 6e-24
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 8e-23
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-22
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-21
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-19
1uhs_A72 HOP, homeodomain only protein; structural genomics 5e-17
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 2e-16
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-15
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-15
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-14
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 7e-14
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 9e-14
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-13
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 5e-12
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-11
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-11
1e3o_C160 Octamer-binding transcription factor 1; transcript 6e-11
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 6e-11
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 7e-11
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-10
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 3e-10
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 4e-10
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 4e-10
1lfb_A99 Liver transcription factor (LFB1); transcription r 4e-10
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 4e-10
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 6e-10
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-09
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-09
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-09
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 4e-09
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-08
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 3e-08
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-08
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 5e-08
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-07
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 3e-07
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 5e-07
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 5e-07
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 5e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 7e-07
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 3e-05
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 5e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 6e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 1e-04
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 1e-04
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 2e-04
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-04
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
 Score = 98.2 bits (245), Expect = 1e-26
 Identities = 25/51 (49%), Positives = 33/51 (64%)

Query: 87  KSSNKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQ 137
            S +  RR RT FT EQL  LE LF ET YPD   RE+L++++ L E +V+
Sbjct: 2   SSGSSGRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVE 52
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.85
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.85
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.84
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.84
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.83
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.83
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.83
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.83
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.83
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.83
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.82
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.82
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.82
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.82
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.82
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.82
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.82
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.81
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.81
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.81
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.8
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.8
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.8
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.8
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.8
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.8
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.8
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.8
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.8
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.8
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.8
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.79
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.79
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.79
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.79
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.79
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.79
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.79
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.79
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.78
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.78
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.78
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.78
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.78
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.78
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.78
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.77
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.77
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.76
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.75
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.75
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.75
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.75
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.75
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.74
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.74
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.74
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.74
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.74
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.74
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.73
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.73
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.72
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.72
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.72
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.71
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.71
2e19_A64 Transcription factor 8; homeobox domain, structura 99.69
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.69
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.69
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.67
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.62
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.58
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.54
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.47
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.43
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.36
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.8
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.44
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 81.33
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 81.02
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.85  E-value=7.5e-22  Score=146.08  Aligned_cols=63  Identities=35%  Similarity=0.432  Sum_probs=58.9

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHhhhCCCCCHHhHHHHHHhcCCChhhhcccccchhccccc
Q psy9565          87 KSSNKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLIDV  149 (288)
Q Consensus        87 ~~~~k~rr~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~La~~l~l~~~~v~vWFqnrR~k~k~  149 (288)
                      ...++.+|.||.||.+|+.+||..|+.++||+..+|++||..|||++.||+|||||||+||||
T Consensus        12 ~~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~L~~~qV~vWFqNRR~k~kk   74 (80)
T 2dmt_A           12 TKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKK   74 (80)
T ss_dssp             CCCCCCCCSCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHSC
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCHHHeeeccHHHHHHhhc
Confidence            345667889999999999999999999999999999999999999999999999999999944
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 288
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-16
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 4e-16
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-15
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-14
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-14
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-14
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-14
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 5e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 8e-14
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 9e-14
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 4e-13
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 4e-13
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-12
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-12
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 2e-12
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 4e-12
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 8e-12
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 9e-12
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 9e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-11
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 1e-11
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-11
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-10
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-10
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-10
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-10
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 7e-10
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 7e-10
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 3e-09
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-08
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 6e-07
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 3e-05
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 71.0 bits (174), Expect = 1e-16
 Identities = 17/61 (27%), Positives = 31/61 (50%)

Query: 81  SPISSCKSSNKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFS 140
           +P ++   +   R+ R  +T  Q  ELE+ F    Y     R E+++ L L+E +V+ + 
Sbjct: 2   NPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWF 61

Query: 141 Q 141
           Q
Sbjct: 62  Q 62
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.87
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.87
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.86
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.86
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.85
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.85
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.85
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.85
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.84
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.84
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.83
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.83
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.82
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.82
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.82
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.82
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.81
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.8
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.8
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.79
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.78
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.78
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.77
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.75
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.71
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.69
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.68
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.67
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.63
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.6
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.56
d1k78a261 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 98.37
d6paxa265 Pax-6 {Human (Homo sapiens) [TaxId: 9606]} 98.26
d1pdnc_123 Paired protein (prd) {Fruit fly (Drosophila melano 93.19
d1hlva166 DNA-binding domain of centromere binding protein B 88.37
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 83.32
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.87  E-value=2.4e-23  Score=142.56  Aligned_cols=56  Identities=25%  Similarity=0.323  Sum_probs=54.4

Q ss_pred             CCCCCCCCHHHHHHHHHHhhhCCCCCHHhHHHHHHhcCCChhhhcccccchhcccc
Q psy9565          93 RRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQNFSQVLNLLID  148 (288)
Q Consensus        93 rr~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~La~~l~l~~~~v~vWFqnrR~k~k  148 (288)
                      ||.||.||.+|+.+||.+|+.++||+..+|++||..|||++.||+|||||||+|+|
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~k   57 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEK   57 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTT
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhcc
Confidence            67899999999999999999999999999999999999999999999999999994
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k78a2 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure