Psyllid ID: psy9583

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860------
MALIEVKIPKLSESISEATLLNWHKKEGELVVRNENLIDIETDKVILELPAPQDGIINKIIITDGSIVTSNQVIALIDTDISKLSSKTEIKNKKDIKNLNTIVMPSAKKILSDNNLEISKINNGTGKDGRIIKEDVLKVLSSIKNINEEKQEKYKPYLDSISIKNNSRLEECVPMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQYPIINASVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIADIEKKINEFINKAQDNKLLPEEMSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAIKKRVIVENNNVVIRPINYFALSYDHRIIDGREAVLSLMSFIMNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKALLQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHGHAIFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEMINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGLNIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIGLKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNALPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSDEILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSINY
cccEEEEccccccccccEEEEEEEcccccEEEcccEEEEEEcccEEEEEcccccccEEEEEcccccEEEEccEEEEEEccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEccccccccHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEccEEEEEccccccccccccccccccHHHHHHHHHHcccccEEEEccccHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEcccccccHHHHHHHHHHHHHHHHcHHHHHHHcccEEEEEEEEEEEEcccccEEEEEEccccEEEEEccEEEEEccccccccccccccccEEEcccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEEcccccccEEEEEEEcEEEEEccccccccccccccccccccccccEEcccccccccccEEEEccccccccccccccHHHHHHHHHHccccccccccccccEEEcccccccccccHHHHHHcccccEEEEccccccHHHHHcccccccEEEEEEcccccEEEEEEEcccHHHHHHHHHHHHHHcccHHHHHHcccccccHHHHHHHHHHccccccccc
ccEEEEEcccccccccEEEEEEccccccccEccccEEEEEEccEEEEEEEccccccccccEEccccEEEcccEEEEEEccccccccccccccccccccccccccHHHHHHHcccccccccEEcccccccEEEEHHHHEcccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEEcHHHHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHHHHHcccEccEEccccEEEcccccEEEcEEEccEEEccEEccHHHccHHHHHHHHHHHHHHHHcccccHHHHccccEEEEEccccccccccccccccccEEEEEcccEEEEEEccccEEEEEEEEEEEEEEcccccHHHHHHHccccHEcccccEEEEcccHHHHHHHHHHHHHcccEEEEEccEcccccEcccHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHcEEccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcEEEEEccccEEEEEEEccccccEEEEEEEEEEcccEEEcccccccccccccccHHHHHcccccccEEEEEcccHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHHHHccEEEEEcEEEEEEEEEccccEEEEEEEEcccccEEEEEEEcEEEEcccEEEcccccccccccccEcccccEccccccEcccccEEEcHHHccccccHHHHHHHHHHHHHHHHHcccccccccccEEEccccEEEEEEccHHHHHHccccEEEEEEEHHHcHHHHHHcccccEEEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHHccEHHHHHcccccccccHHHHHHHHHHHccccccc
MALIEVKIPKLSESISEATLLNWHKKEGELvvrnenlidietdkvilelpapqdgiinkiiitdgsivtsNQVIALIDTDisklsskteiknkkdiknlntivmpsakkilsdnnleiskinngtgkdgriIKEDVLKVLSSIKNINeekqekykpyLDSIsiknnsrleecvpmSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQypiinasvdgnniiyhkYYDIGIaisssrglvvpilrnadtmsIADIEKKINEFINKaqdnkllpeemsggtftisnggvfgsmlstpiinppqsailgvHAIKKRVIVEnnnvvirpiNYFALSYDHRIIDGREAVLSLMSFIMNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEwkdneenfalggtctnvgcipskallqtshsfenVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHGHAIFTGKIQNNFHEIQIINKTKETITAKYIIIATgskarsfpgvkfdenlilsnKGALEMINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGLNiilntkihdikinkENVLinysnkstnvkTEIITSIFDKLLIAIgripntnnlnidkiglkvnenNFIIVndncetnipniyaigdvvrgpmlahkaeEEGIMVAEHIsgqkhsinfnalpfviytfpeiasvgkteQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSdmksdeilgihiigPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSINY
malievkipklsesiseATLLNWHKKEGELVVRNENLIDIETDKVILELPAPQDGIINKIIITDGSIVTSNQVIALIDtdisklsskteiknkkdiknlntivmpsakkilsdnnleiskinngtgkdgriiKEDVLKVLSSIKnineekqekykpyldSISIKNNSRLEECVPMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQYPIINASVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIADIEKKINEFINKAQDNKLLPEEMSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAIKKRVIVENNNVVIRPINYFALSYDHRIIDGREAVLSLMSFIMNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKALLQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHGHAIFTGKIQNNFHEIQIINKTKETITAKYIIIAtgskarsfpgvKFDENLILSNKGALEMINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGLNIILNTKIHDIKINKENVLInysnkstnvkTEIITSIFDKLLIAIGRIPNTNNLNIDKIGLKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNALPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSDEILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSienrsiny
MALIEVKIPKLSESISEATLLNWHKKEGELVVRNENLIDIETDKVILELPAPQDGIINKIIITDGSIVTSNQVIALIDTDISKLSSKTEIKNKKDIKNLNTIVMPSAKKILSDNNLEISKINNGTGKDGRIIKEDVLKVLSSIKNINEEKQEKYKPYLDSISIKNNSRLEECVPMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQYPIINASVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIADIEKKINEFINKAQDNKLLPEEMSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAikkrvivennnvvirpinYFALSYDHRIIDGREAVLSLMSFIMNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKALLQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERknniikknnSGilflfkknkikffHGHAIFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEMINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGLNIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIGLKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNALPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSDEILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSINY
**************ISEATLLNWHKKEGELVVRNENLIDIETDKVILELPAPQDGIINKIIITDGSIVTSNQVIALIDTDISKL***********IKNLNTIVMPSAKKILSDNNLEISKINNGTGKDGRIIKEDVLKVLSSIKNIN******YKPYLDSISIKNNSRLEECVPMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQYPIINASVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIADIEKKINEFINKAQDNKLL***MSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAIKKRVIVENNNVVIRPINYFALSYDHRIIDGREAVLSLMSFIMNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKALLQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHGHAIFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEMINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGLNIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIGLKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNALPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSDEILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVH*********************
**LIEVKIPKLSESISEATLLNWHKKEGELVVRNENLIDIETDKVILELPAPQDGIINKIIITDGSIVTSNQVIAL*********************************ILSDNNLEISKINNGTGKDGRIIKEDVL************************************PMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQYPIINASVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIADIEKKINEFINKAQDNKLLPEEMSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAIKKRVIVENNNVVIRPINYFA*SY*****DGREAVLSLMSFIMNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKALLQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHGHAIFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEMINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGLNIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIGLKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNALPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSDEILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSINY
MALIEVKIPKLSESISEATLLNWHKKEGELVVRNENLIDIETDKVILELPAPQDGIINKIIITDGSIVTSNQVIALIDTDISKLSSKTEIKNKKDIKNLNTIVMPSAKKILSDNNLEISKINNGTGKDGRIIKEDVLKVLSSIKNINEEKQEKYKPYLDSISIKNNSRLEECVPMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQYPIINASVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIADIEKKINEFINKAQDNKLLPEEMSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAIKKRVIVENNNVVIRPINYFALSYDHRIIDGREAVLSLMSFIMNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKALLQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHGHAIFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEMINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGLNIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIGLKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNALPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSDEILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSINY
*ALIEVKIPKLSESISEATLLNWHKKEGELVVRNENLIDIETDKVILELPAPQDGIINKIIITDGSIVTSNQVIALIDTDI**********************MPSAKKILSDNNLEISKINNGTGKDGRIIKEDVLKVLSSI*****************************VP*SRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQYPIINASVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIADIEKKINEFINKAQDNKLLPEEMSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAIKKRVIVENNNVVIRPINYFALSYDHRIIDGREAVLSLMSFIMNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKALLQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHGHAIFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEMINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGLNIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIGLKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNALPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSDEILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSI**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALIEVKIPKLSESISEATLLNWHKKEGELVVRNENLIDIETDKVILELPAPQDGIINKIIITDGSIVTSNQVIALIDTDISKLSSKTEIKNKKDIKNLNTIVMPSAKKILSDNNLEISKINNGTGKDGRIIKEDVLKVLSSIKNINEEKQEKYKPYLDSISIKNNSRLEECVPMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQYPIINASVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIADIEKKINEFINKAQDNKLLPEEMSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAIKKRVIVENNNVVIRPINYFALSYDHRIIDGREAVLSLMSFIMNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKALLQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHGHAIFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEMINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGLNIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIGLKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNALPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSDEILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSINY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query866 2.2.26 [Sep-21-2011]
P52992474 Dihydrolipoyl dehydrogena yes N/A 0.543 0.993 0.517 1e-152
P14218478 Dihydrolipoyl dehydrogena yes N/A 0.542 0.983 0.475 1e-134
Q9I3D1478 Dihydrolipoamide dehydrog yes N/A 0.542 0.983 0.475 1e-134
P18925477 Dihydrolipoyl dehydrogena yes N/A 0.542 0.985 0.460 1e-132
P31052478 Dihydrolipoamide dehydrog yes N/A 0.542 0.983 0.479 1e-131
P52993416 Dihydrolipoyllysine-resid no N/A 0.443 0.923 0.565 1e-124
O00087511 Dihydrolipoyl dehydrogena yes N/A 0.528 0.896 0.469 1e-124
Q9M5K3507 Dihydrolipoyl dehydrogena yes N/A 0.543 0.928 0.462 1e-123
Q9M5K2507 Dihydrolipoyl dehydrogena no N/A 0.543 0.928 0.452 1e-122
P09623509 Dihydrolipoyl dehydrogena yes N/A 0.534 0.909 0.486 1e-122
>sp|P52992|DLDH_CUPNH Dihydrolipoyl dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=odhL PE=3 SV=2 Back     alignment and function desciption
 Score =  538 bits (1386), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 249/481 (51%), Positives = 340/481 (70%), Gaps = 10/481 (2%)

Query: 387 MNKNFDVIVIGAGPGGYVASIRLAQLGFKTACID--EWKDNEENFALGGTCTNVGCIPSK 444
           M+K FDV+VIGAGPGGY+A+IR  QLG   AC +   + D +    LGGTC NVGCIPSK
Sbjct: 1   MSKQFDVLVIGAGPGGYIAAIRAGQLGLNVACCEGNPYDDPKGEARLGGTCLNVGCIPSK 60

Query: 445 ALLQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFF 504
           ALL +S  FENV++   ++GI   +V +++ KML+RK++I+ K   GI FLF+KNK+   
Sbjct: 61  ALLASSEEFENVQHHLGDHGITVGDVKVDVAKMLKRKDDIVGKMTKGIEFLFRKNKVTLL 120

Query: 505 HGHAIFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGAL 564
            G+  F GK    F     ++   E +TAK +IIATGSKAR  PG+K D +L+  N+GAL
Sbjct: 121 KGYGKFVGKSAEGFQ----VDVAGEVVTAKQVIIATGSKARHLPGIKVDNDLVSDNEGAL 176

Query: 565 EMINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQ 624
           +   VPKKL +IGAGVIGLE+GS+WRRLGS+VT+LE    FL   DE +AK+A   L KQ
Sbjct: 177 KFPAVPKKLGVIGAGVIGLELGSVWRRLGSDVTVLEALPAFLGAADEGVAKEAQKQLTKQ 236

Query: 625 GLNIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDK 684
           GL   L   ++++   K  V + Y++K    +T  +    D+L++++GR+PNT+NL +D 
Sbjct: 237 GLKFSLGVNVNEVTTGKNGVTVKYTDKDGKAQTLEV----DRLIVSVGRVPNTDNLGLDA 292

Query: 685 IGLKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINF 744
           +GL  ++  FI V+D+C T +P ++AIGDVVRGPMLAHKAE+EG+ VAE I+GQK  I++
Sbjct: 293 VGLAADQRGFIEVDDHCATKVPGLWAIGDVVRGPMLAHKAEDEGVAVAERIAGQKPHIDY 352

Query: 745 NALPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMK 804
           N +P+VIYTFPEIA VGKTE  LK     Y  G FPF+AN RA  +G   G VK+L+D K
Sbjct: 353 NCVPWVIYTFPEIAWVGKTEAQLKAEGREYKAGQFPFMANGRALGMGHADGFVKMLADAK 412

Query: 805 SDEILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSI 864
           +DEILG+HI+   AS+LIAEAV+A+EF+A+SEDI R+CH HPS+SE M+EAA++++ R +
Sbjct: 413 TDEILGVHIVAANASDLIAEAVVAMEFKAASEDIGRVCHPHPSMSEVMREAALAVDKRQL 472

Query: 865 N 865
           N
Sbjct: 473 N 473
The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).
Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (taxid: 381666)
EC: 1EC: .EC: 8EC: .EC: 1EC: .EC: 4
>sp|P14218|DLDH_PSEFL Dihydrolipoyl dehydrogenase OS=Pseudomonas fluorescens GN=lpd PE=1 SV=3 Back     alignment and function description
>sp|Q9I3D1|DLDH2_PSEAE Dihydrolipoamide dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpdG PE=3 SV=1 Back     alignment and function description
>sp|P18925|DLDH_AZOVI Dihydrolipoyl dehydrogenase OS=Azotobacter vinelandii PE=1 SV=1 Back     alignment and function description
>sp|P31052|DLDH2_PSEPU Dihydrolipoamide dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4 Back     alignment and function description
>sp|P52993|ODO2_CUPNH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sucB PE=3 SV=1 Back     alignment and function description
>sp|O00087|DLDH_SCHPO Dihydrolipoyl dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dld1 PE=2 SV=2 Back     alignment and function description
>sp|Q9M5K3|DLDH1_ARATH Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=LPD1 PE=1 SV=2 Back     alignment and function description
>sp|Q9M5K2|DLDH2_ARATH Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=LPD2 PE=1 SV=1 Back     alignment and function description
>sp|P09623|DLDH_PIG Dihydrolipoyl dehydrogenase, mitochondrial OS=Sus scrofa GN=DLD PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query866
152980382475 dihydrolipoamide dehydrogenase [Janthino 0.548 1.0 0.595 1e-176
445498352476 dihydrolipoamide dehydrogenase LpdA [Jan 0.549 1.0 0.610 1e-175
399018027475 dihydrolipoamide dehydrogenase [Herbaspi 0.548 1.0 0.614 1e-174
409406693475 2-oxoglutarate dehydrogenase E3 componen 0.548 1.0 0.625 1e-174
300312271475 2-oxoglutarate dehydrogenase E3 componen 0.548 1.0 0.620 1e-174
415949076475 Dihydrolipoamide dehydrogenase [Herbaspi 0.548 1.0 0.620 1e-172
89901097475 dihydrolipoamide dehydrogenase [Rhodofer 0.548 1.0 0.570 1e-171
398836177475 dihydrolipoamide dehydrogenase [Herbaspi 0.548 1.0 0.608 1e-171
121594191475 dihydrolipoamide dehydrogenase [Acidovor 0.548 1.0 0.587 1e-170
222111097475 dihydrolipoamide dehydrogenase [Acidovor 0.548 1.0 0.587 1e-170
>gi|152980382|ref|YP_001353204.1| dihydrolipoamide dehydrogenase [Janthinobacterium sp. Marseille] gi|151280459|gb|ABR88869.1| dihydrolipoamide dehydrogenase [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
 Score =  625 bits (1611), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 286/480 (59%), Positives = 373/480 (77%), Gaps = 5/480 (1%)

Query: 387 MNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKAL 446
           M+KNFDV+VIGAGPGGYVA+IR AQLGF  ACIDEWK+ +   A GGTCTNVGCIPSKA+
Sbjct: 1   MSKNFDVVVIGAGPGGYVAAIRAAQLGFTVACIDEWKNEKGGPAPGGTCTNVGCIPSKAM 60

Query: 447 LQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHG 506
           LQ+S ++ +  ++F E+GI  + ++LN++KM+ RK+ ++K+NN GIL+LFKKNK+ FFHG
Sbjct: 61  LQSSENYHHAGHAFAEHGIEVKGLSLNVKKMVARKDTVVKQNNDGILYLFKKNKVTFFHG 120

Query: 507 HAIFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEM 566
              F  K  +  HEI+I   T+E I AK++++ATGS  R+ PG  FDE LILSN GALE+
Sbjct: 121 RGSFV-KAADGGHEIKIAGATEENIFAKHVVVATGSNPRALPGAAFDEKLILSNTGALEI 179

Query: 567 INVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGL 626
             VPK+L +IGAGVIGLE+GS+WRRLGSEVT+LE    FL  VD+ +AK+AF    KQGL
Sbjct: 180 TEVPKRLGVIGAGVIGLEMGSVWRRLGSEVTVLEALPAFLGAVDDAVAKEAFKQFTKQGL 239

Query: 627 NIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIG 686
            I L  +I  I   K +V +NY +     K     ++FDKL+++IGR+PNT  LN + +G
Sbjct: 240 AISLGVQIGAITAGKNDVTVNYVDD----KGAAQKAVFDKLIVSIGRVPNTIGLNAEAVG 295

Query: 687 LKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNA 746
           LK++E  FI V+ +C+T++PN++A+GDVVRGPMLAHK+EEEG+ VAE I+GQ   +NFN 
Sbjct: 296 LKLDERGFIAVDADCKTSLPNVWAVGDVVRGPMLAHKSEEEGVAVAERIAGQHGHVNFNT 355

Query: 747 LPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSD 806
           +P+VIYT PEIA VGKTEQ LK   I+Y  G FPFLAN RAR LG+T+G VK L+D K+D
Sbjct: 356 IPWVIYTSPEIAWVGKTEQQLKAEKIAYKAGSFPFLANGRARALGDTTGFVKFLADAKTD 415

Query: 807 EILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSINY 866
           EILG+HIIGPMASELI+EAV+A+EFRASSEDIARICH HPSLSEA+KEAA++++ R++N+
Sbjct: 416 EILGVHIIGPMASELISEAVVAMEFRASSEDIARICHAHPSLSEAVKEAALAVDGRALNF 475

Source: Janthinobacterium sp. Marseille

Species: Janthinobacterium sp. Marseille

Genus: Janthinobacterium

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|445498352|ref|ZP_21465207.1| dihydrolipoamide dehydrogenase LpdA [Janthinobacterium sp. HH01] gi|444788347|gb|ELX09895.1| dihydrolipoamide dehydrogenase LpdA [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|399018027|ref|ZP_10720213.1| dihydrolipoamide dehydrogenase [Herbaspirillum sp. CF444] gi|398101992|gb|EJL92184.1| dihydrolipoamide dehydrogenase [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|409406693|ref|ZP_11255155.1| 2-oxoglutarate dehydrogenase E3 component lipoamide dehydrogenase [Herbaspirillum sp. GW103] gi|386435242|gb|EIJ48067.1| 2-oxoglutarate dehydrogenase E3 component lipoamide dehydrogenase [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|300312271|ref|YP_003776363.1| 2-oxoglutarate dehydrogenase E3 component lipoamide dehydrogenase [Herbaspirillum seropedicae SmR1] gi|300075056|gb|ADJ64455.1| 2-oxoglutarate dehydrogenase, E3 component, lipoamide dehydrogenase protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|415949076|ref|ZP_11556837.1| Dihydrolipoamide dehydrogenase [Herbaspirillum frisingense GSF30] gi|407757803|gb|EKF67722.1| Dihydrolipoamide dehydrogenase [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|89901097|ref|YP_523568.1| dihydrolipoamide dehydrogenase [Rhodoferax ferrireducens T118] gi|89345834|gb|ABD70037.1| dihydrolipoamide dehydrogenase [Rhodoferax ferrireducens T118] Back     alignment and taxonomy information
>gi|398836177|ref|ZP_10593523.1| dihydrolipoamide dehydrogenase [Herbaspirillum sp. YR522] gi|398213181|gb|EJM99775.1| dihydrolipoamide dehydrogenase [Herbaspirillum sp. YR522] Back     alignment and taxonomy information
>gi|121594191|ref|YP_986087.1| dihydrolipoamide dehydrogenase [Acidovorax sp. JS42] gi|120606271|gb|ABM42011.1| dihydrolipoamide dehydrogenase [Acidovorax sp. JS42] Back     alignment and taxonomy information
>gi|222111097|ref|YP_002553361.1| dihydrolipoamide dehydrogenase [Acidovorax ebreus TPSY] gi|221730541|gb|ACM33361.1| dihydrolipoamide dehydrogenase [Acidovorax ebreus TPSY] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query866
UNIPROTKB|Q48K69478 lpdA "Dihydrolipoyl dehydrogen 0.542 0.983 0.460 2.9e-112
UNIPROTKB|P31023501 LPD "Dihydrolipoyl dehydrogena 0.533 0.922 0.447 1.9e-108
TAIR|locus:2023782507 mtLPD1 "mitochondrial lipoamid 0.533 0.911 0.451 1.9e-108
UNIPROTKB|Q4KK19484 lpdA_2 "Dihydrolipoyl dehydrog 0.542 0.971 0.443 6.3e-108
TAIR|locus:2089030507 mtLPD2 "lipoamide dehydrogenas 0.533 0.911 0.445 1e-107
UNIPROTKB|P09623509 DLD "Dihydrolipoyl dehydrogena 0.534 0.909 0.469 5.1e-106
UNIPROTKB|F1PAR0509 DLD "Dihydrolipoyl dehydrogena 0.560 0.952 0.448 8.3e-106
UNIPROTKB|F1SAF0509 DLD "Dihydrolipoyl dehydrogena 0.534 0.909 0.469 8.3e-106
FB|FBgn0036762504 CG7430 [Drosophila melanogaste 0.533 0.916 0.440 1.1e-105
UNIPROTKB|F1N206509 DLD "Dihydrolipoyl dehydrogena 0.534 0.909 0.467 1.4e-105
UNIPROTKB|Q48K69 lpdA "Dihydrolipoyl dehydrogenase" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
 Score = 1108 (395.1 bits), Expect = 2.9e-112, P = 2.9e-112
 Identities = 221/480 (46%), Positives = 310/480 (64%)

Query:   387 MNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKAL 446
             M++ FDV+VIGAGPGGYVA+I+ AQLG KTACI++++D E   ALGGTC NVGCIPSKAL
Sbjct:     1 MSQKFDVVVIGAGPGGYVAAIKAAQLGLKTACIEKYQDKEGKLALGGTCLNVGCIPSKAL 60

Query:   447 LQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERXXXXXXXXXSGXXXXXXXXXXXXXHG 506
             L +S  F   KN F  +GI+T  V +++  M+ R          G              G
Sbjct:    61 LDSSWKFYEAKNGFSVHGISTSEVNIDVPAMIGRKSTIVKGLTGGVASLFKANGVTTLQG 120

Query:   507 HA-IFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALE 565
             H  +  GK      E+   + T E I A ++I+A+GS+    P    D+ +I+ + GALE
Sbjct:   121 HGKLLAGKKV----ELTAADGTVEIIEADHVILASGSRPIDIPPAPVDQKVIVDSTGALE 176

Query:   566 MINVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQG 625
                VP++L +IGAGVIGLE+GS+W RLG++VT+LE    F+   DE ++K+A     KQG
Sbjct:   177 FQQVPQRLGVIGAGVIGLELGSVWARLGAQVTVLEALDKFIPAADEAVSKEALKTFTKQG 236

Query:   626 LNIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKI 685
             L+I L  ++   K+  E V+++Y++ +     + IT  FD+L++A+GR P T +L     
Sbjct:   237 LDIKLGARVTGSKVEGEEVVVSYTDAAGE---QSIT--FDRLIVAVGRRPVTTDLLASDS 291

Query:   686 GLKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFN 745
             G+ ++E  FI V+D C T++P +YAIGDVVRG MLAHKA EEGIMV E I G K  +N+N
Sbjct:   292 GVDLDERGFIYVDDYCTTSVPGVYAIGDVVRGLMLAHKASEEGIMVVERIKGHKAQMNYN 351

Query:   746 ALPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKS 805
              +P VIYT PEIA VGKTEQ LK   +  NVG FPF A+ RA    +T G VKI++D K+
Sbjct:   352 LIPSVIYTHPEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTGGFVKIIADAKT 411

Query:   806 DEILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSIN 865
             D +LG+H+IGP A+EL+ +  IA+EF +S+EDI  +   HP+LSEA+ EAA+++   +I+
Sbjct:   412 DRVLGVHVIGPSAAELVQQGAIAMEFGSSAEDIGMMVFSHPTLSEALHEAALAVNGGAIH 471
GO:0004591 "oxoglutarate dehydrogenase (succinyl-transferring) activity" evidence=ISS
GO:0006099 "tricarboxylic acid cycle" evidence=ISS
GO:0045248 "cytosolic oxoglutarate dehydrogenase complex" evidence=ISS
UNIPROTKB|P31023 LPD "Dihydrolipoyl dehydrogenase, mitochondrial" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms
TAIR|locus:2023782 mtLPD1 "mitochondrial lipoamide dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KK19 lpdA_2 "Dihydrolipoyl dehydrogenase" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
TAIR|locus:2089030 mtLPD2 "lipoamide dehydrogenase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P09623 DLD "Dihydrolipoyl dehydrogenase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAR0 DLD "Dihydrolipoyl dehydrogenase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAF0 DLD "Dihydrolipoyl dehydrogenase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0036762 CG7430 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1N206 DLD "Dihydrolipoyl dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P52992DLDH_CUPNH1, ., 8, ., 1, ., 40.51760.54380.9936yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.8.1.40.737
3rd Layer2.3.10.691
3rd Layer1.8.10.691
3rd Layer2.3.1.61LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query866
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase 0.0
PRK05704407 PRK05704, PRK05704, dihydrolipoamide succinyltrans 0.0
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas 0.0
TIGR01350460 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrog 0.0
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase 0.0
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase 1e-173
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase 1e-171
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase 1e-157
TIGR01347403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp 1e-154
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase 1e-147
COG0508404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogena 1e-124
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltrans 1e-121
PRK11856411 PRK11856, PRK11856, branched-chain alpha-keto acid 1e-119
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase 1e-113
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Va 1e-110
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 1e-102
TIGR02053463 TIGR02053, MerA, mercuric reductase 1e-100
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide tr 8e-97
PLN02226463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E 6e-92
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 4e-86
pfam00198212 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases 9e-80
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validat 5e-73
TIGR02927579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 1e-71
PTZ00153659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provi 9e-69
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 6e-66
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 5e-64
TIGR01349436 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase 4e-63
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide re 4e-61
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide 3e-60
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide re 1e-59
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reduct 2e-57
PRK14694468 PRK14694, PRK14694, putative mercuric reductase; P 4e-56
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; P 5e-54
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 4e-53
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; P 5e-51
PRK11857306 PRK11857, PRK11857, dihydrolipoamide acetyltransfe 3e-50
PLN02744539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 4e-49
PLN02528416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase 5e-49
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 1e-48
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide 2e-48
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reducta 4e-47
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisi 9e-47
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide 1e-46
PRK14843347 PRK14843, PRK14843, dihydrolipoamide acetyltransfe 2e-46
PLN02507499 PLN02507, PLN02507, glutathione reductase 4e-46
TIGR01348546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 4e-46
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisi 4e-43
pfam02852110 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disu 8e-41
PLN02546558 PLN02546, PLN02546, glutathione reductase 2e-37
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 8e-25
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihyd 6e-24
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 2e-22
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent 2e-21
TIGR01292299 TIGR01292, TRX_reduct, thioredoxin-disulfide reduc 3e-20
PRK13512438 PRK13512, PRK13512, coenzyme A disulfide reductase 7e-20
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-18
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase 2e-18
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphi 3e-16
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 1e-13
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase sub 5e-13
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy p 3e-12
PRK098531019 PRK09853, PRK09853, putative selenate reductase su 8e-12
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransfe 1e-11
PRK11892464 PRK11892, PRK11892, pyruvate dehydrogenase subunit 2e-11
PRK14875371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 3e-11
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoredu 8e-11
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_ 1e-10
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase f 2e-10
TIGR02927579 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena 3e-10
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD( 3e-10
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, larg 4e-10
PRK12770352 PRK12770, PRK12770, putative glutamate synthase su 4e-09
pfam0281739 pfam02817, E3_binding, e3 binding domain 5e-09
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protei 7e-09
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 1e-08
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing s 2e-08
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homot 9e-08
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, Y 3e-07
TIGR03143 555 TIGR03143, AhpF_homolog, putative alkyl hydroperox 5e-07
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 6e-07
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 7e-07
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase 9e-07
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl h 1e-06
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenas 2e-06
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipo 4e-06
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase 8e-06
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synth 3e-05
TIGR01348546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase 4e-05
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 6e-05
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 7e-05
pfam01134391 pfam01134, GIDA, Glucose inhibited division protei 1e-04
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or b 1e-04
PRK12831464 PRK12831, PRK12831, putative oxidoreductase; Provi 1e-04
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 2e-04
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 2e-04
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 2e-04
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 3e-04
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Li 3e-04
PLN00128 635 PLN00128, PLN00128, Succinate dehydrogenase [ubiqu 5e-04
PRK09078 598 PRK09078, sdhA, succinate dehydrogenase flavoprote 6e-04
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; R 6e-04
PTZ00139 617 PTZ00139, PTZ00139, Succinate dehydrogenase [ubiqu 7e-04
COG1635262 COG1635, THI4, Ribulose 1,5-bisphosphate synthetas 7e-04
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disu 8e-04
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polypr 0.001
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate 0.001
COG2081408 COG2081, COG2081, Predicted flavoproteins [General 0.001
PRK12834549 PRK12834, PRK12834, putative FAD-binding dehydroge 0.002
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (N 0.002
COG0686371 COG0686, Ald, Alanine dehydrogenase [Amino acid tr 0.002
TIGR03378419 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate d 0.002
PRK05641153 PRK05641, PRK05641, putative acetyl-CoA carboxylas 0.003
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 0.003
PRK06183500 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr 0.003
PRK12779 944 PRK12779, PRK12779, putative bifunctional glutamat 0.004
>gnl|CDD|235779 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information 
 Score =  740 bits (1913), Expect = 0.0
 Identities = 270/479 (56%), Positives = 350/479 (73%), Gaps = 5/479 (1%)

Query: 387 MNKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKAL 446
           M+K FDV+VIGAGPGGYVA+IR AQLG K ACI+ WK+ +   ALGGTC NVGCIPSKAL
Sbjct: 1   MSKQFDVVVIGAGPGGYVAAIRAAQLGLKVACIEAWKNPKGKPALGGTCLNVGCIPSKAL 60

Query: 447 LQTSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHG 506
           L +S  FEN  + F ++GI+   V +++ KM+ RK+ ++KK   GI  LFKKNKI    G
Sbjct: 61  LASSEEFENAGHHFADHGIHVDGVKIDVAKMIARKDKVVKKMTGGIEGLFKKNKITVLKG 120

Query: 507 HAIFTGKIQNNFHEIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEM 566
              F GK  +  +EI++  + +  ITAK++IIATGS+ R  PGV FD  +IL N GAL  
Sbjct: 121 RGSFVGK-TDAGYEIKVTGEDETVITAKHVIIATGSEPRHLPGVPFDNKIILDNTGALNF 179

Query: 567 INVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGL 626
             VPKKL +IGAGVIGLE+GS+WRRLG+EVTILE    FL   DE++AK+A     KQGL
Sbjct: 180 TEVPKKLAVIGAGVIGLELGSVWRRLGAEVTILEALPAFLAAADEQVAKEAAKAFTKQGL 239

Query: 627 NIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIG 686
           +I L  KI +IK   + V + Y++     +T       DKL+++IGR+PNT+ L ++ +G
Sbjct: 240 DIHLGVKIGEIKTGGKGVSVAYTDADGEAQTLE----VDKLIVSIGRVPNTDGLGLEAVG 295

Query: 687 LKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNA 746
           LK++E  FI V+D+C TN+PN+YAIGDVVRGPMLAHKAEEEG+ VAE I+GQK  I++N 
Sbjct: 296 LKLDERGFIPVDDHCRTNVPNVYAIGDVVRGPMLAHKAEEEGVAVAERIAGQKGHIDYNT 355

Query: 747 LPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSD 806
           +P+VIYT PEIA VGKTEQ LK   + Y  G FPF+AN RA  +GE  G VKI++D K+D
Sbjct: 356 IPWVIYTSPEIAWVGKTEQQLKAEGVEYKAGKFPFMANGRALAMGEPDGFVKIIADAKTD 415

Query: 807 EILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSIN 865
           EILG+H+IGP ASELIAEAV+A+EF+ASSEDIARICH HP+LSE   EAA++++ R ++
Sbjct: 416 EILGVHVIGPNASELIAEAVVAMEFKASSEDIARICHAHPTLSEVWHEAALAVDKRPLH 474

Length = 475
>gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233368 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235798 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|235774 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235660 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|223582 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|237001 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|236106 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235787 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|233700 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|215782 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) Back     alignment and domain information
>gnl|CDD|235701 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|233367 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|213618 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|233412 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|237790 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|237806 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|237002 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|215289 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|200098 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|236112 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215281 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|217252 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain Back     alignment and domain information
>gnl|CDD|215301 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|215691 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|201182 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|234119 TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F Back     alignment and domain information
>gnl|CDD|224171 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|226160 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|202412 pfam02817, E3_binding, e3 binding domain Back     alignment and domain information
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|224172 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|236999 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|237942 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216319 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|223585 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|177739 PLN00128, PLN00128, Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>gnl|CDD|236375 PRK09078, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|240286 PTZ00139, PTZ00139, Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|234134 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|223758 COG0686, Ald, Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213807 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>gnl|CDD|235540 PRK05641, PRK05641, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 866
PRK05704407 dihydrolipoamide succinyltransferase; Validated 100.0
TIGR01347403 sucB 2-oxoglutarate dehydrogenase complex dihydrol 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
PLN02744539 dihydrolipoyllysine-residue acetyltransferase comp 100.0
TIGR02927590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 100.0
KOG1335|consensus506 100.0
TIGR01349435 PDHac_trf_mito pyruvate dehydrogenase complex dihy 100.0
PLN02528416 2-oxoisovalerate dehydrogenase E2 component 100.0
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex 100.0
TIGR01348546 PDHac_trf_long pyruvate dehydrogenase complex dihy 100.0
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 100.0
PLN02226463 2-oxoglutarate dehydrogenase E2 component 100.0
PTZ00144418 dihydrolipoamide succinyltransferase; Provisional 100.0
KOG0557|consensus470 100.0
PRK11854633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06370463 mercuric reductase; Validated 100.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK07846451 mycothione reductase; Reviewed 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 100.0
PRK06116450 glutathione reductase; Validated 100.0
PRK11855547 dihydrolipoamide acetyltransferase; Reviewed 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 100.0
PRK07845466 flavoprotein disulfide reductase; Reviewed 100.0
PRK05976472 dihydrolipoamide dehydrogenase; Validated 100.0
KOG0558|consensus474 100.0
PLN02507499 glutathione reductase 100.0
PLN02546558 glutathione reductase 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PTZ00153659 lipoamide dehydrogenase; Provisional 100.0
TIGR02053463 MerA mercuric reductase. This model represents the 100.0
PRK14727479 putative mercuric reductase; Provisional 100.0
PRK11856411 branched-chain alpha-keto acid dehydrogenase subun 100.0
PRK14694468 putative mercuric reductase; Provisional 100.0
PTZ00058561 glutathione reductase; Provisional 100.0
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
KOG0559|consensus457 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 100.0
PTZ00052499 thioredoxin reductase; Provisional 100.0
KOG0405|consensus478 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK14843347 dihydrolipoamide acetyltransferase; Provisional 100.0
PRK11857306 dihydrolipoamide acetyltransferase; Reviewed 100.0
KOG4716|consensus503 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
PRK09564444 coenzyme A disulfide reductase; Reviewed 100.0
PF00198231 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransfe 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 100.0
PRK12270 1228 kgd alpha-ketoglutarate decarboxylase; Reviewed 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 100.0
PRK12831464 putative oxidoreductase; Provisional 99.98
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.98
KOG1336|consensus478 99.97
PRK098531019 putative selenate reductase subunit YgfK; Provisio 99.97
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.97
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.97
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.97
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 99.97
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.97
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.97
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.96
PRK12814652 putative NADPH-dependent glutamate synthase small 99.96
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.96
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.95
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.95
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.95
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.94
KOG2495|consensus491 99.94
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.94
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.94
PRK13984604 putative oxidoreductase; Provisional 99.94
PLN02852491 ferredoxin-NADP+ reductase 99.93
KOG1346|consensus659 99.92
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.92
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.92
KOG0404|consensus322 99.92
PF02852110 Pyr_redox_dim: Pyridine nucleotide-disulphide oxid 99.89
PLN02172461 flavin-containing monooxygenase FMO GS-OX 99.89
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.82
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 99.8
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.76
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.76
PF0036474 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: 99.72
KOG0399|consensus2142 99.72
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.71
KOG2755|consensus334 99.7
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.7
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.7
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.69
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.69
PRK0674883 hypothetical protein; Validated 99.65
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 99.64
KOG1399|consensus448 99.6
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 99.59
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 99.58
PTZ00188506 adrenodoxin reductase; Provisional 99.57
KOG1800|consensus468 99.5
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl ca 99.49
KOG3851|consensus446 99.48
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains ar 99.44
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.37
PRK11854633 aceF pyruvate dehydrogenase dihydrolipoyltransacet 99.36
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.36
TIGR02927590 SucB_Actino 2-oxoglutarate dehydrogenase, E2 compo 99.35
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 99.34
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabo 99.31
PF00302206 CAT: Chloramphenicol acetyltransferase; InterPro: 99.3
PRK0705180 hypothetical protein; Validated 99.3
PRK13757219 chloramphenicol acetyltransferase; Provisional 99.25
PRK06549130 acetyl-CoA carboxylase biotin carboxyl carrier pro 99.25
COG2081408 Predicted flavoproteins [General function predicti 99.23
PRK08401466 L-aspartate oxidase; Provisional 99.23
PRK11855547 dihydrolipoamide acetyltransferase; Reviewed 99.22
PRK05641153 putative acetyl-CoA carboxylase biotin carboxyl ca 99.19
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.18
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 99.17
PF0281739 E3_binding: e3 binding domain; InterPro: IPR004167 99.15
TIGR01348546 PDHac_trf_long pyruvate dehydrogenase complex dihy 99.14
PRK08275554 putative oxidoreductase; Provisional 99.14
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.13
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.13
PLN02983274 biotin carboxyl carrier protein of acetyl-CoA carb 99.13
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.12
cd0685067 biotinyl_domain The biotinyl-domain or biotin carb 99.11
PRK07804541 L-aspartate oxidase; Provisional 99.11
PRK12842 574 putative succinate dehydrogenase; Reviewed 99.09
PRK06175433 L-aspartate oxidase; Provisional 99.08
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 99.08
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 99.07
PRK09231582 fumarate reductase flavoprotein subunit; Validated 99.07
PRK09077536 L-aspartate oxidase; Provisional 99.05
TIGR00531156 BCCP acetyl-CoA carboxylase, biotin carboxyl carri 99.04
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 99.03
PRK09897534 hypothetical protein; Provisional 99.02
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl a 99.02
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 99.01
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.01
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.0
PRK08071510 L-aspartate oxidase; Provisional 99.0
PRK07395553 L-aspartate oxidase; Provisional 98.99
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier pro 98.99
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.99
PLN02815594 L-aspartate oxidase 98.98
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 98.97
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.97
PRK14042596 pyruvate carboxylase subunit B; Provisional 98.97
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.96
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.95
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.95
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 98.95
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.94
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 98.93
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.93
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.92
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.89
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.88
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.85
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.84
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.83
PRK07512513 L-aspartate oxidase; Provisional 98.82
TIGR027121201 urea_carbox urea carboxylase. Members of this fami 98.82
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 98.77
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.76
PRK14040593 oxaloacetate decarboxylase; Provisional 98.76
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.75
TIGR012351143 pyruv_carbox pyruvate carboxylase. This enzyme pla 98.71
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.67
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.66
PRK09282592 pyruvate carboxylase subunit B; Validated 98.61
COG4845219 Chloramphenicol O-acetyltransferase [Defense mecha 98.6
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.58
PRK10157428 putative oxidoreductase FixC; Provisional 98.55
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.54
PRK06847375 hypothetical protein; Provisional 98.54
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.53
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.52
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 98.52
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.51
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.5
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.49
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.47
PLN02661357 Putative thiazole synthesis 98.47
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.47
PRK10015429 oxidoreductase; Provisional 98.47
PRK129991146 pyruvate carboxylase; Reviewed 98.46
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.45
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.45
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.45
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.44
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.44
PRK06834488 hypothetical protein; Provisional 98.43
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.41
PRK08274466 tricarballylate dehydrogenase; Validated 98.4
PLN02463447 lycopene beta cyclase 98.4
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.37
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.36
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.36
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.33
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.32
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.32
PRK11728393 hydroxyglutarate oxidase; Provisional 98.32
PRK08244493 hypothetical protein; Provisional 98.32
PRK08163396 salicylate hydroxylase; Provisional 98.31
PRK13977576 myosin-cross-reactive antigen; Provisional 98.31
COG10381149 PycA Pyruvate carboxylase [Energy production and c 98.3
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.29
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.27
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.27
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 98.26
PRK07121492 hypothetical protein; Validated 98.25
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.25
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.25
PRK07190487 hypothetical protein; Provisional 98.24
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.24
KOG2820|consensus399 98.24
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.23
PRK06184502 hypothetical protein; Provisional 98.22
PRK08013400 oxidoreductase; Provisional 98.21
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.2
PRK09126392 hypothetical protein; Provisional 98.2
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.2
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.19
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.19
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.18
PLN02697529 lycopene epsilon cyclase 98.17
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.17
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.17
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.17
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.16
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.16
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.15
COG2081408 Predicted flavoproteins [General function predicti 98.15
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.15
KOG0369|consensus1176 98.14
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.14
PRK11445351 putative oxidoreductase; Provisional 98.14
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.13
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.13
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.13
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage 98.12
COG0579429 Predicted dehydrogenase [General function predicti 98.11
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.09
PRK12839572 hypothetical protein; Provisional 98.09
PRK07045388 putative monooxygenase; Reviewed 98.08
PRK06185407 hypothetical protein; Provisional 98.08
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.07
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.07
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.06
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.06
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.05
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.05
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.04
PRK06753373 hypothetical protein; Provisional 98.04
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.02
PRK07236386 hypothetical protein; Provisional 98.01
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.0
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.0
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 97.98
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.98
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.98
PRK07588391 hypothetical protein; Provisional 97.97
PTZ00383497 malate:quinone oxidoreductase; Provisional 97.97
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 97.96
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.95
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.94
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.94
KOG1335|consensus506 97.93
PRK06996398 hypothetical protein; Provisional 97.93
PRK09564 444 coenzyme A disulfide reductase; Reviewed 97.91
PRK06126545 hypothetical protein; Provisional 97.91
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.9
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.9
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 97.9
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.89
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.89
PRK08132547 FAD-dependent oxidoreductase; Provisional 97.88
PRK06847375 hypothetical protein; Provisional 97.88
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 97.87
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 97.87
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.87
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.86
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.86
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 97.86
KOG2415|consensus621 97.85
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.85
PRK05868372 hypothetical protein; Validated 97.84
PRK07846451 mycothione reductase; Reviewed 97.82
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.81
TIGR03077110 not_gcvH glycine cleavage protein H-like protein, 97.81
PLN02985514 squalene monooxygenase 97.81
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.8
PRK14694468 putative mercuric reductase; Provisional 97.79
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 97.77
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 97.76
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 97.76
PRK13339497 malate:quinone oxidoreductase; Reviewed 97.76
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.74
PRK13512 438 coenzyme A disulfide reductase; Provisional 97.73
PRK07236386 hypothetical protein; Provisional 97.73
COG1233487 Phytoene dehydrogenase and related proteins [Secon 97.73
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.72
KOG0368|consensus 2196 97.72
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.71
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.7
PRK07208479 hypothetical protein; Provisional 97.7
PRK00624114 glycine cleavage system protein H; Provisional 97.69
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.69
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.68
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.68
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.67
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.66
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.66
PRK06475400 salicylate hydroxylase; Provisional 97.64
KOG0238|consensus670 97.64
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.63
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.63
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.62
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.62
PRK13380144 glycine cleavage system protein H; Provisional 97.61
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.6
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.6
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 97.58
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.58
PTZ00367567 squalene epoxidase; Provisional 97.57
PRK08244 493 hypothetical protein; Provisional 97.56
PRK10262321 thioredoxin reductase; Provisional 97.55
PRK08294 634 phenol 2-monooxygenase; Provisional 97.55
PRK07538413 hypothetical protein; Provisional 97.55
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 97.55
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.53
PRK06834 488 hypothetical protein; Provisional 97.53
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 97.52
KOG0399|consensus2142 97.51
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 97.51
KOG0029|consensus501 97.51
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.5
PRK05257494 malate:quinone oxidoreductase; Validated 97.5
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.5
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.49
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 97.49
PRK06370463 mercuric reductase; Validated 97.48
KOG1336|consensus478 97.48
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.48
PRK06116450 glutathione reductase; Validated 97.47
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.47
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.46
PLN02507499 glutathione reductase 97.45
TIGR02053463 MerA mercuric reductase. This model represents the 97.45
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.45
PLN02661357 Putative thiazole synthesis 97.45
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.44
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.43
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.43
PTZ00153659 lipoamide dehydrogenase; Provisional 97.42
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.42
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.41
COG3349485 Uncharacterized conserved protein [Function unknow 97.41
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.39
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.39
PRK08132 547 FAD-dependent oxidoreductase; Provisional 97.38
PLN02463447 lycopene beta cyclase 97.38
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.38
PRK06184 502 hypothetical protein; Provisional 97.37
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.36
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.35
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.35
PRK08163396 salicylate hydroxylase; Provisional 97.35
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.35
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.35
PLN02576496 protoporphyrinogen oxidase 97.35
PRK07233434 hypothetical protein; Provisional 97.34
PLN02568539 polyamine oxidase 97.34
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.34
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.34
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.33
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.33
PRK01202127 glycine cleavage system protein H; Provisional 97.32
COG0578 532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 97.32
PRK07588391 hypothetical protein; Provisional 97.31
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.3
PRK09783409 copper/silver efflux system membrane fusion protei 97.3
PTZ00052499 thioredoxin reductase; Provisional 97.29
PLN02268435 probable polyamine oxidase 97.28
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.28
KOG2614|consensus420 97.28
PLN02852 491 ferredoxin-NADP+ reductase 97.26
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.25
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.25
PRK05868372 hypothetical protein; Validated 97.24
PRK06475400 salicylate hydroxylase; Provisional 97.24
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 97.23
PRK12831464 putative oxidoreductase; Provisional 97.23
KOG2495|consensus491 97.21
PRK14727479 putative mercuric reductase; Provisional 97.2
PRK13748561 putative mercuric reductase; Provisional 97.2
KOG2311|consensus 679 97.19
KOG1399|consensus 448 97.18
PTZ00058561 glutathione reductase; Provisional 97.18
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.18
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisi 97.18
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 97.18
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.17
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.17
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.16
PTZ00188 506 adrenodoxin reductase; Provisional 97.16
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 97.15
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.15
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.15
PRK09126392 hypothetical protein; Provisional 97.14
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.13
PRK07190 487 hypothetical protein; Provisional 97.12
PRK07045388 putative monooxygenase; Reviewed 97.11
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.11
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 97.1
PF01134392 GIDA: Glucose inhibited division protein A; InterP 97.09
TIGR00527127 gcvH glycine cleavage system H protein. The genome 97.08
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 97.08
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.08
PRK12416463 protoporphyrinogen oxidase; Provisional 97.07
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 97.07
PRK10157428 putative oxidoreductase FixC; Provisional 97.07
PRK06753373 hypothetical protein; Provisional 97.06
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.05
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.05
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.05
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.05
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.03
PRK08013400 oxidoreductase; Provisional 97.02
TIGR01730322 RND_mfp RND family efflux transporter, MFP subunit 97.01
PLN02546558 glutathione reductase 96.99
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 96.95
PRK12814 652 putative NADPH-dependent glutamate synthase small 96.93
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 96.93
PRK1278484 hypothetical protein; Provisional 96.93
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.92
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.92
PLN02529 738 lysine-specific histone demethylase 1 96.91
PRK10476346 multidrug resistance protein MdtN; Provisional 96.89
PLN02676487 polyamine oxidase 96.89
PRK09897 534 hypothetical protein; Provisional 96.85
PRK06996398 hypothetical protein; Provisional 96.85
PRK06126 545 hypothetical protein; Provisional 96.84
PLN02697529 lycopene epsilon cyclase 96.83
PF1353350 Biotin_lipoyl_2: Biotin-lipoyl like 96.82
KOG2404|consensus477 96.82
PRK06185407 hypothetical protein; Provisional 96.81
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.81
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 96.81
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.8
KOG1298|consensus509 96.79
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 96.78
PLN02464627 glycerol-3-phosphate dehydrogenase 96.78
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 96.77
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 96.77
PRK15136390 multidrug efflux system protein EmrA; Provisional 96.76
KOG2852|consensus380 96.75
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 96.75
TIGR00275400 flavoprotein, HI0933 family. The model when search 96.75
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.73
PRK10015429 oxidoreductase; Provisional 96.71
KOG2853|consensus509 96.7
KOG0685|consensus498 96.69
PF01597122 GCV_H: Glycine cleavage H-protein; InterPro: IPR00 96.68
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.68
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 96.67
PRK09578385 periplasmic multidrug efflux lipoprotein precursor 96.67
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 96.66
PRK03598331 putative efflux pump membrane fusion protein; Prov 96.65
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 96.64
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 96.63
PLN02487569 zeta-carotene desaturase 96.61
PLN02328808 lysine-specific histone demethylase 1 homolog 96.61
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 96.6
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 96.6
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 96.59
PRK11728393 hydroxyglutarate oxidase; Provisional 96.55
PRK11445351 putative oxidoreductase; Provisional 96.55
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 96.55
PRK07538413 hypothetical protein; Provisional 96.54
PRK13984604 putative oxidoreductase; Provisional 96.52
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information 
Probab=100.00  E-value=4.7e-83  Score=700.94  Aligned_cols=379  Identities=54%  Similarity=0.875  Sum_probs=327.8

Q ss_pred             CccEEEecCCCCCCCCeEEEEEEEeCCCCeeeCCCeEEEEEecceeeEEecCCCeEEEEEeecCCCEEecCCEEEEEecC
Q psy9583           1 MALIEVKIPKLSESISEATLLNWHKKEGELVVRNENLIDIETDKVILELPAPQDGIINKIIITDGSIVTSNQVIALIDTD   80 (866)
Q Consensus         1 m~~~~~~~p~~g~~~~~g~i~~w~~~~G~~v~~g~~l~~ve~~k~~~~i~~~~~G~~~~~~~~~g~~v~~g~~l~~~~~~   80 (866)
                      |+ ++|+||+||++|+||+|++|+|++||.|++||+|++|||||+++||+||++|+|.++++++|+.|++|++|++++.+
T Consensus         1 m~-~~i~~P~lg~~~~eg~i~~w~v~~Gd~V~~Gd~l~~vEtdK~~~ei~a~~~G~v~~i~v~~G~~V~~G~~l~~i~~~   79 (407)
T PRK05704          1 MM-VEIKVPTLPESVTEATIATWHKKPGDAVKRDEVLVEIETDKVVLEVPAPAAGVLSEILAEEGDTVTVGQVLGRIDEG   79 (407)
T ss_pred             CC-eeEecCCCCCCCceEEEEEEEeCCcCEeCCCCEEEEEEecCceeEEecCCCEEEEEEEeCCCCEeCCCCEEEEEecC
Confidence            44 59999999999999999999999999999999999999999999999999999999999999999999999999865


Q ss_pred             Cccccc---c-ccc-c---ccc----c-ccccccccchhHHHhhhhCCCCcccccCCCCCCCceeehhHHhhhhhccccc
Q psy9583          81 ISKLSS---K-TEI-K---NKK----D-IKNLNTIVMPSAKKILSDNNLEISKINNGTGKDGRIIKEDVLKVLSSIKNIN  147 (866)
Q Consensus        81 ~~~~~~---~-~~~-~---~~~----~-~~~~~~~~~p~~r~~a~~~~~d~~~v~~gtg~~g~i~~~Dv~~~~~~~~~~~  147 (866)
                      ++..+.   + .++ +   +++    + .......+||+||+||+|+||||++| +|||++|||+++||++|+...+..+
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~asP~aR~lA~e~gidl~~v-~gtG~~GrI~~~DV~~~~~~~~~~~  158 (407)
T PRK05704         80 AAAGAAAAAAAAAAAAAAAPAQAQAAAAAEQSNDALSPAARKLAAENGLDASAV-KGTGKGGRVTKEDVLAALAAAAAAP  158 (407)
T ss_pred             CcccccCCCCCCCCCCCCCCCCCCCCccCCCccccCCchhhhHHhhcCCChhhC-CCCCCCCcccHHHHHHHhhcccccC
Confidence            432110   0 000 0   000    0 00112468999999999999999999 8999999999999999974321111


Q ss_pred             cccccccCCCccccccccCCCccccccCchhHHHHHHHHHHhccccceEEEEeeeechHHHHHHHHhhhHHHhhccCccC
Q psy9583         148 EEKQEKYKPYLDSISIKNNSRLEECVPMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLG  227 (866)
Q Consensus       148 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~ia~~m~~s~~~~p~~~~~~~~d~t~l~~~r~~~~~~~~~~~~~~~t  227 (866)
                      .++.  ..+. ...+........+.+||++|||+||++|++||+++||||++.++|+|+|+++|+++++.+.++.|.|+|
T Consensus       159 ~~~~--~~~~-~~~~~~~~~~~~~~vpls~~rk~ia~~m~~S~~~iPh~~~~~evd~~~l~~~r~~~~~~~~~~~~~kls  235 (407)
T PRK05704        159 AAPA--AAAP-AAAPAPLGARPEERVPMTRLRKTIAERLLEAQNTTAMLTTFNEVDMTPVMDLRKQYKDAFEKKHGVKLG  235 (407)
T ss_pred             CCCC--CCCC-cCCCccccCCcceEeeChHHHHHHHHHHHHHhhcCCeEEEEEEEeHHHHHHHHHHHHhhhHhhcCCCcC
Confidence            0000  0000 000000001123568999999999999999999999999999999999999999999877666689999


Q ss_pred             HHHHHHHHHHHHHHhCCccceEEeCCeeEEccceeEEEEEecCCceEEeEEecCCCCCHHHHHHHHHHHHHHHhcCCCCc
Q psy9583         228 FMSFFVKAVVSALKQYPIINASVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIADIEKKINEFINKAQDNKLLP  307 (866)
Q Consensus       228 ~~~~~~ka~~~al~~~P~~n~~~~~~~~~~~~~~~i~~av~~~~gl~~pvi~~~~~~~~~~i~~~~~~~~~~~~~~~l~~  307 (866)
                      +++||+||+++||++||.||++|+++++++++++||||||++++||+||||||+|++|+.||++++++|.+|+|+|+|++
T Consensus       236 ~~~~likA~a~AL~~~P~~Na~~~~~~i~~~~~~nIgiAv~~~~GLivPVI~~a~~~sl~eIa~~~~~l~~~ar~g~L~~  315 (407)
T PRK05704        236 FMSFFVKAVVEALKRYPEVNASIDGDDIVYHNYYDIGIAVGTPRGLVVPVLRDADQLSFAEIEKKIAELAKKARDGKLSI  315 (407)
T ss_pred             HHHHHHHHHHHHHHhCcHhhcEEcCCeEEEcCCCCeEEEEECCCceEeCcCCCcccCCHHHHHHHHHHHHHHHHcCCCCh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCceEEEEcCCCcCccccccccCCCceEEEEeccceeeEEEeCCeeEeeeeeeeeecccccccccchhhhhhhh
Q psy9583         308 EEMSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAIKKRVIVENNNVVIRPINYFALSYDHRIIDGREAVLSLMS  384 (866)
Q Consensus       308 ~~~~~gt~tisn~g~~g~~~~~~ii~~p~~~il~vg~~~~~~~~~~~~~~ir~~~~~~l~~dhr~~dg~~a~~~~~~  384 (866)
                      +|++||||||||+|++|+.+|+|||||||+||||+|++.++|++.+|++++|++|+++|+||||++||+++++|+..
T Consensus       316 ~d~~ggTfTiSNlG~~G~~~~tpiIn~pq~aILgvG~i~~~pv~~~g~i~~r~~~~lsls~DHRviDGa~aa~Fl~~  392 (407)
T PRK05704        316 EELTGGTFTITNGGVFGSLMSTPIINPPQSAILGMHKIKERPVAVNGQIVIRPMMYLALSYDHRIIDGKEAVGFLVT  392 (407)
T ss_pred             HHcCCceEEEecCCcccccceeccccCCcEEEEEcccceEEeEEECCEEEEEEEEEEEEEechhhhCcHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988764

>TIGR01347 sucB 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02744 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PLN02528 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02226 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>KOG0557|consensus Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0558|consensus Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0559|consensus Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14843 dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>PRK11857 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PF00198 2-oxoacid_dh: 2-oxoacid dehydrogenases acyltransferase (catalytic domain); InterPro: IPR001078 This domain is found in the lipoamide acyltransferase component of the branched-chain alpha-keto acid dehydrogenase complex 2 Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PF02852 Pyr_redox_dim: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; InterPro: IPR004099 This entry represents a dimerisation domain that is usually found at the C-terminal of both class I and class II oxidoreductases, as well as in NADH oxidases and peroxidases [, , ] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PF00364 Biotin_lipoyl: Biotin-requiring enzyme; InterPro: IPR000089 The biotin / lipoyl attachment domain has a conserved lysine residue that binds biotin or lipoic acid Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK11854 aceF pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PF00302 CAT: Chloramphenicol acetyltransferase; InterPro: IPR001707 Chloramphenicol acetyltransferase (CAT) (2 Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK13757 chloramphenicol acetyltransferase; Provisional Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PF02817 E3_binding: e3 binding domain; InterPro: IPR004167 A small domain of the E2 subunit of 2-oxo-acid dehydrogenases that is responsible for the binding of the E3 subunit Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02983 biotin carboxyl carrier protein of acetyl-CoA carboxylase Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>COG4845 Chloramphenicol O-acetyltransferase [Defense mechanisms] Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H-like protein, Chlamydial Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>KOG0368|consensus Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG0238|consensus Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01730 RND_mfp RND family efflux transporter, MFP subunit Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PF13533 Biotin_lipoyl_2: Biotin-lipoyl like Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>PF01597 GCV_H: Glycine cleavage H-protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query866
1lpf_A477 Three-Dimensional Structure Of Lipoamide Dehydrogen 1e-126
3lad_A476 Refined Crystal Structure Of Lipoamide Dehydrogenas 1e-125
1zmc_A474 Crystal Structure Of Human Dihydrolipoamide Dehydro 1e-115
1dxl_A470 Dihydrolipoamide Dehydrogenase Of Glycine Decarboxy 1e-114
1zy8_A474 The Crystal Structure Of Dihydrolipoamide Dehydroge 1e-114
3rnm_A495 The Crystal Structure Of The Subunit Binding Of Hum 1e-114
2qae_A468 Crystal Structure Analysis Of Trypanosoma Cruzi Lip 1e-106
2eq7_A455 Crystal Structure Of Lipoamide Dehydrogenase From T 1e-102
1jeh_A478 Crystal Structure Of Yeast E3, Lipoamide Dehydrogen 1e-101
3urh_A491 Crystal Structure Of A Dihydrolipoamide Dehydrogena 7e-98
1ebd_A455 Dihydrolipoamide Dehydrogenase Complexed With The B 1e-86
2eq6_A464 Crystal Structure Of Lipoamide Dehydrogenase From T 7e-81
1c4t_A233 Catalytic Domain From Trimeric Dihydrolipoamide Suc 2e-71
3ii4_A466 Structure Of Mycobacterial Lipoamide Dehydrogenase 2e-62
1lvl_A458 The Refined Structure Of Pseudomonas Putida Lipoami 1e-61
2a8x_A464 Crystal Structure Of Lipoamide Dehydrogenase From M 1e-61
1ojt_A482 Structure Of Dihydrolipoamide Dehydrogenase Length 2e-49
1bhy_A482 Low Temperature Middle Resolution Structure Of P64k 3e-49
3duf_I428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 5e-49
2r9z_A463 Glutathione Amide Reductase From Chromatium Gracile 1e-43
2grt_A461 Human Glutathione Reductase A34e, R37w Mutant, Oxid 4e-42
1grt_A478 Human Glutathione Reductase A34eR37W MUTANT Length 5e-42
1zk7_A467 Crystal Structure Of Tn501 Mera Length = 467 5e-40
1typ_A487 Substrate Interactions Between Trypanothione Reduct 2e-38
3djg_X477 Catalytic Cycle Of Human Glutathione Reductase Near 2e-38
1bwc_A478 Structure Of Human Glutathione Reductase Complexed 2e-38
1tyt_A487 Crystal And Molecular Structure Of Crithidia Fascic 2e-38
2aaq_A479 Crystal Structure Analysis Of The Human Glutahione 2e-38
1xan_A461 Human Glutathione Reductase In Complex With A Xanth 3e-38
2wba_A492 Properties Of Trypanothione Reductase From T. Bruce 9e-38
2woi_A495 Trypanothione Reductase From Trypanosoma Brucei Len 1e-37
2x50_A510 Crystal Structure Of Trypanothione Reductase From L 1e-37
2jk6_A511 Structure Of Trypanothione Reductase From Leishmani 1e-37
2tpr_A490 X-ray Structure Of Trypanothione Reductase From Cri 2e-37
1k4q_A463 Human Glutathione Reductase Inactivated By Peroxyni 3e-37
3dgz_A488 Crystal Structure Of Mouse Mitochondrial Thioredoxi 4e-37
1gsn_A478 Human Glutathione Reductase Modified By Dinitrosogl 4e-37
1fea_A490 Unliganded Crithidia Fasciculata Trypanothione Redu 5e-37
1zdl_A517 Crystal Structure Of Mouse Thioredoxin Reductase Ty 5e-37
1grg_A478 Substrate Binding And Catalysis By Glutathione Redu 6e-37
1dnc_A478 Human Glutathione Reductase Modified By Diglutathio 6e-37
1ges_A450 Anatomy Of An Engineered Nad-Binding Site Length = 4e-36
2hqm_A479 Crystal Structure Of Glutathione Reductase Glr1 Fro 5e-35
3h4k_A598 Crystal Structure Of The Wild Type Thioredoxin Glut 1e-34
4b1b_A542 Crystal Structure Of Plasmodium Falciparum Oxidised 1e-34
2v6o_A596 Structure Of Schistosoma Mansoni Thioredoxin-Glutat 1e-34
2x8c_A598 Thioredoxin Glutathione Reductase From Schistosoma 1e-34
1h6v_A499 Mammalian Thioredoxin Reductase Length = 499 6e-34
3o0h_A484 Crystal Structure Of Glutathione Reductase From Bar 9e-34
1b5s_A242 Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt 1e-33
3ean_A499 Crystal Structure Of Recombinant Rat Selenoprotein 3e-33
1ger_A450 The Structure Of Glutathione Reductase From Escheri 3e-33
2nvk_X488 Crystal Structure Of Thioredoxin Reductase From Dro 4e-32
3dgh_A483 Crystal Structure Of Drosophila Thioredoxin Reducta 5e-32
3dh9_A482 Crystal Structure Of Drosophila Thioredoxin Reducta 5e-32
3mae_A256 Crystal Structure Of Probable Dihydrolipamide Acety 3e-31
3l8k_A466 Crystal Structure Of A Dihydrolipoyl Dehydrogenase 6e-31
3ic9_A492 The Structure Of Dihydrolipoamide Dehydrogenase Fro 8e-31
1xdi_A499 Crystal Structure Of Lpda (Rv3303c) From Mycobacter 9e-31
2cfy_A521 Crystal Structure Of Human Thioredoxin Reductase 1 5e-30
2zz0_A513 Crystal Structure Of Human Thioredoxin Reductase I 5e-30
3qfa_A519 Crystal Structure Of The Human Thioredoxin Reductas 6e-30
2j3n_A519 X-Ray Structure Of Human Thioredoxin Reductase 1 Le 6e-30
1onf_A500 Crystal Structure Of Plasmodium Falciparum Glutathi 6e-30
1nda_A491 The Structure Of Trypanosoma Cruzi Trypanothione Re 2e-27
1gxf_A492 Crystal Structure Of Trypanosoma Cruzi Trypanothion 2e-27
3rqc_A224 Crystal Structure Of The Catalytic Core Of The 2-Ox 2e-27
1bzl_A486 Crystal Structure Of Trypanosoma Cruzi Trypanothion 2e-27
1aog_A485 Trypanosoma Cruzi Trypanothione Reductase (Oxidized 1e-26
4dna_A463 Crystal Structure Of Putative Glutathione Reductase 2e-26
1dpc_A243 Crystallographic And Enzymatic Investigations On Th 1e-22
1eaa_A243 Atomic Structure Of The Cubic Core Of The Pyruvate 7e-22
1dpd_A243 Crystallographic And Enzymatic Investigations On Th 1e-21
2ihw_A262 Crystal Structure Of A Cubic Core Of The Dihydrolip 5e-21
3b8k_A239 Structure Of The Truncated Human Dihydrolipoyl Acet 5e-21
1dpb_A243 Crystallographic And Enzymatic Investigations On Th 1e-20
1mo9_A523 Nadph Dependent 2-Ketopropyl Coenzyme M Oxidoreduct 2e-17
3l60_A250 Crystal Structure Of Branched-Chain Alpha-Keto Acid 7e-16
1pmr_A80 Lipoyl Domain From The Dihydrolipoyl Succinyltransf 1e-15
3ntd_A565 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 8e-13
1ghj_A79 Solution Structure Of The Lipoyl Domain Of The 2- O 3e-12
4eqx_A437 Crystal Structure Of The C43s Mutant Of Staphylococ 5e-12
4emw_A436 Crystal Structure Of Staphylococcus Aureus Bound Wi 5e-12
4em3_A437 Crystal Structure Of Staphylococcus Aureus Bound Wi 5e-12
1yqz_A438 Structure Of Coenzyme A-Disulfide Reductase From St 6e-12
4eqs_A437 Crystal Structure Of The Y419f Mutant Of Staphyloco 6e-12
4eqr_A437 Crystal Structure Of The Y361f Mutant Of Staphyloco 6e-12
4eqw_A437 Crystal Structure Of The Y361f, Y419f Mutant Of Sta 6e-12
2xt6_A 1113 Crystal Structure Of Mycobacterium Smegmatis Alpha- 6e-12
3nta_A 574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 9e-11
3nt6_A 574 Structure Of The Shewanella Loihica Pv-4 Nadh-Depen 9e-11
3ef6_A410 Crystal Structure Of Toluene 2,3-Dioxygenase Reduct 1e-10
2l5t_A77 Solution Nmr Structure Of E2 Lipoyl Domain From The 8e-10
1zy8_L229 The Crystal Structure Of Dihydrolipoamide Dehydroge 8e-10
3icr_A 588 Crystal Structure Of Oxidized Bacillus Anthracis Co 1e-09
3cgc_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 9e-09
2dnc_A98 Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain 2e-08
3cty_A319 Crystal Structure Of T. Acidophilum Thioredoxin Red 3e-08
3iwa_A472 Crystal Structure Of A Fad-Dependent Pyridine Nucle 6e-08
1q1r_A431 Crystal Structure Of Putidaredoxin Reductase From P 7e-08
3lb8_A436 Crystal Structure Of The Covalent Putidaredoxin Red 7e-08
3cgb_A480 Pyridine Nucleotide Complexes With Bacillus Anthrac 1e-07
1hyu_A521 Crystal Structure Of Intact Ahpf Length = 521 1e-07
2q7v_A325 Crystal Structure Of Deinococcus Radiodurans Thiore 1e-07
1lab_A80 Three-Dimensional Structure Of The Lipoyl Domain Fr 2e-07
1fl2_A310 Catalytic Core Component Of The Alkylhydroperoxide 2e-07
2bc0_A490 Structural Analysis Of Streptococcus Pyogenes Nadh 5e-07
2bc1_A490 Structural Analysis Of Streptococcus Pyogenes Nadh 5e-07
2gr3_A408 Crystal Structure Of Ferredoxin Reductase, Bpha4 (O 5e-07
1d7y_A408 Crystal Structure Of Nadh-Dependent Ferredoxin Redu 9e-07
4a5l_A314 Crystal Structure Of The Thioredoxin Reductase From 1e-06
1xhc_A367 Nadh Oxidase /nitrite Reductase From Pyrococcus Fur 2e-05
3lxd_A415 Crystal Structure Of Ferredoxin Reductase Arr From 5e-05
3f8d_A323 Structure Of Sulfolobus Solfataricus Thioredoxin Re 9e-05
3f8p_A323 Structure Of Sulfolobus Solfataricus Trxr-B3 Length 1e-04
1y8n_B128 Crystal Structure Of The Pdk3-L2 Complex Length = 1 1e-04
1fyc_A106 Inner Lipoyl Domain From Human Pyruvate Dehydrogena 1e-04
3fg2_P404 Crystal Structure Of Ferredoxin Reductase For The C 2e-04
2coo_A70 Solution Structure Of The E3_binding Domain Of Dihy 4e-04
4gcm_A312 Crystal Structure Of A Thioredoxine Reductase (Trxb 4e-04
3crk_C87 Crystal Structure Of The Pdhk2-L2 Complex. Length = 6e-04
1zwv_A58 Solution Structure Of The Subunit Binding Domain (H 7e-04
>pdb|1LPF|A Chain A, Three-Dimensional Structure Of Lipoamide Dehydrogenase From Pseudomonas Fluorescens At 2.8 Angstroms Resolution. Analysis Of Redox And Thermostability Properties Length = 477 Back     alignment and structure 
Iteration: 1

 Score =  451 bits (1159), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/479 (45%), Positives = 313/479 (65%), Gaps = 10/479 (2%)
Query: 388 NKNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKALL 447
           ++ FDV+VIGAGPGGYVA+IR AQLG KTACI+++   E   ALGGTC NVGCIPSKALL
Sbjct: 1   SQKFDVVVIGAGPGGYVAAIRAAQLGLKTACIEKYIGKEGKVALGGTCLNVGCIPSKALL 60
Query: 448 QTSHSFENVKNSFFEYGINTQNVTLNLQKMLERXXXXXXXXXSGXXXXXXXXXXXXXHGH 507
            +S+ +   K +F  +GI  + VT+++  M+ R          G              GH
Sbjct: 61  DSSYKYHEAKEAFKVHGIEAKGVTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEGH 120
Query: 508 AIFTGKIQNNFH-EIQIINKTKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEM 566
               GK+  N   E+  ++   + + A+ +IIA+GS+    P     +++I+ + GALE 
Sbjct: 121 ----GKLLANKQVEVTGLDGKTQVLEAENVIIASGSRPVEIPPAPLSDDIIVDSTGALEF 176
Query: 567 INVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGL 626
             VPKKL +IGAGVIGLE+GS+W RLG+EVT+LE    FL   DE+IAK+A  +L KQGL
Sbjct: 177 QAVPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGL 236
Query: 627 NIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIG 686
           NI L  ++   ++ K+ V + +++ +   K       FDKL++A+GR P T +L     G
Sbjct: 237 NIRLGARVTASEVKKKQVTVTFTDANGEQK-----ETFDKLIVAVGRRPVTTDLLAADSG 291
Query: 687 LKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNA 746
           + ++E  FI V+D+C+T++P ++AIGDVVRG MLAHKA EEG+MVAE I+G K  +N++ 
Sbjct: 292 VTLDERGFIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEGVMVAERIAGHKAQMNYDL 351
Query: 747 LPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSD 806
           +P VIYT PEIA VGKTEQ LK   +  NVG FPF A+ RA    +T+G+VK+++D K+D
Sbjct: 352 IPSVIYTHPEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTD 411
Query: 807 EILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSIN 865
            +LG+H+IGP A+EL+ +  I +EF  S+ED+  +   HP+LSEA+ EAA+++   +I+
Sbjct: 412 RVLGVHVIGPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGHAIH 470
>pdb|3LAD|A Chain A, Refined Crystal Structure Of Lipoamide Dehydrogenase From Azotobacter Vinelandii At 2.2 Angstroms Resolution. A Comparison With The Structure Of Glutathione Reductase Length = 476 Back     alignment and structure
>pdb|1ZMC|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase Complexed To Nad+ Length = 474 Back     alignment and structure
>pdb|1DXL|A Chain A, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase From Pisum Sativum Length = 470 Back     alignment and structure
>pdb|1ZY8|A Chain A, The Crystal Structure Of Dihydrolipoamide Dehydrogenase And Dihydrolipoamide Dehydrogenase-Binding Protein (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase Complex. Length = 474 Back     alignment and structure
>pdb|3RNM|A Chain A, The Crystal Structure Of The Subunit Binding Of Human Dihydrolipoamide Transacylase (E2b) Bound To Human Dihydrolipoamide Dehydrogenase (E3) Length = 495 Back     alignment and structure
>pdb|2QAE|A Chain A, Crystal Structure Analysis Of Trypanosoma Cruzi Lipoamide Dehydrogenase Length = 468 Back     alignment and structure
>pdb|2EQ7|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 With Psbdo Length = 455 Back     alignment and structure
>pdb|1JEH|A Chain A, Crystal Structure Of Yeast E3, Lipoamide Dehydrogenase Length = 478 Back     alignment and structure
>pdb|3URH|A Chain A, Crystal Structure Of A Dihydrolipoamide Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 491 Back     alignment and structure
>pdb|1EBD|A Chain A, Dihydrolipoamide Dehydrogenase Complexed With The Binding Domain Of The Dihydrolipoamide Acetylase Length = 455 Back     alignment and structure
>pdb|2EQ6|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Thermus Thermophilus Hb8 Length = 464 Back     alignment and structure
>pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 Back     alignment and structure
>pdb|3II4|A Chain A, Structure Of Mycobacterial Lipoamide Dehydrogenase Bound To A Triazaspirodimethoxybenzoyl Inhibitor Length = 466 Back     alignment and structure
>pdb|1LVL|A Chain A, The Refined Structure Of Pseudomonas Putida Lipoamide Dehydrogenase Complexed With Nad+ At 2.45 Angstroms Resolution Length = 458 Back     alignment and structure
>pdb|2A8X|A Chain A, Crystal Structure Of Lipoamide Dehydrogenase From Mycobacterium Tuberculosis Length = 464 Back     alignment and structure
>pdb|1OJT|A Chain A, Structure Of Dihydrolipoamide Dehydrogenase Length = 482 Back     alignment and structure
>pdb|1BHY|A Chain A, Low Temperature Middle Resolution Structure Of P64k From Masc Data Length = 482 Back     alignment and structure
>pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 Back     alignment and structure
>pdb|2R9Z|A Chain A, Glutathione Amide Reductase From Chromatium Gracile Length = 463 Back     alignment and structure
>pdb|2GRT|A Chain A, Human Glutathione Reductase A34e, R37w Mutant, Oxidized Glutathione Complex Length = 461 Back     alignment and structure
>pdb|1GRT|A Chain A, Human Glutathione Reductase A34eR37W MUTANT Length = 478 Back     alignment and structure
>pdb|1ZK7|A Chain A, Crystal Structure Of Tn501 Mera Length = 467 Back     alignment and structure
>pdb|1TYP|A Chain A, Substrate Interactions Between Trypanothione Reductase And N1-Glutathionylspermidine Disulphide At 0.28-Nm Resolution Length = 487 Back     alignment and structure
>pdb|3DJG|X Chain X, Catalytic Cycle Of Human Glutathione Reductase Near 1 A Resolution Length = 477 Back     alignment and structure
>pdb|1BWC|A Chain A, Structure Of Human Glutathione Reductase Complexed With Ajoene Inhibitor And Subversive Substrate Length = 478 Back     alignment and structure
>pdb|1TYT|A Chain A, Crystal And Molecular Structure Of Crithidia Fasciculata Trypanothione Reductase At 2.6 Angstroms Resolution Length = 487 Back     alignment and structure
>pdb|2AAQ|A Chain A, Crystal Structure Analysis Of The Human Glutahione Reductase, Complexed With Gopi Length = 479 Back     alignment and structure
>pdb|1XAN|A Chain A, Human Glutathione Reductase In Complex With A Xanthene Inhibitor Length = 461 Back     alignment and structure
>pdb|2WBA|A Chain A, Properties Of Trypanothione Reductase From T. Brucei Length = 492 Back     alignment and structure
>pdb|2WOI|A Chain A, Trypanothione Reductase From Trypanosoma Brucei Length = 495 Back     alignment and structure
>pdb|2X50|A Chain A, Crystal Structure Of Trypanothione Reductase From Leishmania Infantum In Complex With Nadph And Silver Length = 510 Back     alignment and structure
>pdb|2JK6|A Chain A, Structure Of Trypanothione Reductase From Leishmania Infantum Length = 511 Back     alignment and structure
>pdb|2TPR|A Chain A, X-ray Structure Of Trypanothione Reductase From Crithidia Fasciculata At 2.4 Angstroms Resolution Length = 490 Back     alignment and structure
>pdb|3DGZ|A Chain A, Crystal Structure Of Mouse Mitochondrial Thioredoxin Reductase, C- Terminal 3-Residue Truncation Length = 488 Back     alignment and structure
>pdb|1GSN|A Chain A, Human Glutathione Reductase Modified By Dinitrosoglutathione Length = 478 Back     alignment and structure
>pdb|1FEA|A Chain A, Unliganded Crithidia Fasciculata Trypanothione Reductase At 2.2 Angstrom Resolution Length = 490 Back     alignment and structure
>pdb|1ZDL|A Chain A, Crystal Structure Of Mouse Thioredoxin Reductase Type 2 Length = 517 Back     alignment and structure
>pdb|1GRG|A Chain A, Substrate Binding And Catalysis By Glutathione Reductase As Derived From Refined Enzyme: Substrate Crystal Structures At 2 Angstroms Resolution Length = 478 Back     alignment and structure
>pdb|1DNC|A Chain A, Human Glutathione Reductase Modified By Diglutathione-Dinitroso-Iron Length = 478 Back     alignment and structure
>pdb|1GES|A Chain A, Anatomy Of An Engineered Nad-Binding Site Length = 450 Back     alignment and structure
>pdb|2HQM|A Chain A, Crystal Structure Of Glutathione Reductase Glr1 From The Yeast Saccharomyces Cerevisiae Length = 479 Back     alignment and structure
>pdb|3H4K|A Chain A, Crystal Structure Of The Wild Type Thioredoxin Glutatione Reductase From Schistosoma Mansoni In Complex With Auranofin Length = 598 Back     alignment and structure
>pdb|4B1B|A Chain A, Crystal Structure Of Plasmodium Falciparum Oxidised Thioredoxin Reductase At 2.9 Angstrom Length = 542 Back     alignment and structure
>pdb|2V6O|A Chain A, Structure Of Schistosoma Mansoni Thioredoxin-Glutathione Reductase (Smtgr) Length = 596 Back     alignment and structure
>pdb|2X8C|A Chain A, Thioredoxin Glutathione Reductase From Schistosoma Mansoni With The Reduced C-Terminal End Length = 598 Back     alignment and structure
>pdb|1H6V|A Chain A, Mammalian Thioredoxin Reductase Length = 499 Back     alignment and structure
>pdb|3O0H|A Chain A, Crystal Structure Of Glutathione Reductase From Bartonella Henselae Length = 484 Back     alignment and structure
>pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 Back     alignment and structure
>pdb|3EAN|A Chain A, Crystal Structure Of Recombinant Rat Selenoprotein Thioredoxin Reductase 1 With Reduced C-Terminal Tail Length = 499 Back     alignment and structure
>pdb|1GER|A Chain A, The Structure Of Glutathione Reductase From Escherichia Coli At 1.86 Angstroms Resolution: Comparison With The Enzyme From Human Erythrocytes Length = 450 Back     alignment and structure
>pdb|2NVK|X Chain X, Crystal Structure Of Thioredoxin Reductase From Drosophila Melanogaster Length = 488 Back     alignment and structure
>pdb|3DGH|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, C-Terminal 8- Residue Truncation Length = 483 Back     alignment and structure
>pdb|3DH9|A Chain A, Crystal Structure Of Drosophila Thioredoxin Reductase, Wild-Type Length = 482 Back     alignment and structure
>pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 Back     alignment and structure
>pdb|3L8K|A Chain A, Crystal Structure Of A Dihydrolipoyl Dehydrogenase From Sulfolobus Solfataricus Length = 466 Back     alignment and structure
>pdb|3IC9|A Chain A, The Structure Of Dihydrolipoamide Dehydrogenase From Colwellia Psychrerythraea 34h. Length = 492 Back     alignment and structure
>pdb|1XDI|A Chain A, Crystal Structure Of Lpda (Rv3303c) From Mycobacterium Tuberculosis Length = 499 Back     alignment and structure
>pdb|2CFY|A Chain A, Crystal Structure Of Human Thioredoxin Reductase 1 Length = 521 Back     alignment and structure
>pdb|2ZZ0|A Chain A, Crystal Structure Of Human Thioredoxin Reductase I (Secys 498 Cys) Length = 513 Back     alignment and structure
>pdb|3QFA|A Chain A, Crystal Structure Of The Human Thioredoxin Reductase-Thioredoxin Complex Length = 519 Back     alignment and structure
>pdb|2J3N|A Chain A, X-Ray Structure Of Human Thioredoxin Reductase 1 Length = 519 Back     alignment and structure
>pdb|1ONF|A Chain A, Crystal Structure Of Plasmodium Falciparum Glutathione Reductase Length = 500 Back     alignment and structure
>pdb|1NDA|A Chain A, The Structure Of Trypanosoma Cruzi Trypanothione Reductase In The Oxidized And Nadph Reduced State Length = 491 Back     alignment and structure
>pdb|1GXF|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With The Inhibitor Quinacrine Mustard Length = 492 Back     alignment and structure
>pdb|3RQC|A Chain A, Crystal Structure Of The Catalytic Core Of The 2-Oxoacid Dehydrogenase Multienzyme Complex From Thermoplasma Acidophilum Length = 224 Back     alignment and structure
>pdb|1BZL|A Chain A, Crystal Structure Of Trypanosoma Cruzi Trypanothione Reductase In Complex With Trypanothione, And The Structure- Based Discovery Of New Natural Product Inhibitors Length = 486 Back     alignment and structure
>pdb|1AOG|A Chain A, Trypanosoma Cruzi Trypanothione Reductase (Oxidized Form) Length = 485 Back     alignment and structure
>pdb|4DNA|A Chain A, Crystal Structure Of Putative Glutathione Reductase From Sinorhizobium Meliloti 1021 Length = 463 Back     alignment and structure
>pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 Back     alignment and structure
>pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 Back     alignment and structure
>pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 Back     alignment and structure
>pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>pdb|1MO9|A Chain A, Nadph Dependent 2-Ketopropyl Coenzyme M OxidoreductaseCARBOXYLASE Complexed With 2-Ketopropyl Coenzyme M Length = 523 Back     alignment and structure
>pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 Back     alignment and structure
>pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 Back     alignment and structure
>pdb|3NTD|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C531s Mutant Length = 565 Back     alignment and structure
>pdb|1GHJ|A Chain A, Solution Structure Of The Lipoyl Domain Of The 2- Oxoglutarate Dehydrogenase Complex From Azotobacter Vineland Ii, Nmr, Minimized Average Structure Length = 79 Back     alignment and structure
>pdb|4EQX|A Chain A, Crystal Structure Of The C43s Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EMW|A Chain A, Crystal Structure Of Staphylococcus Aureus Bound With The Covalent Inhibitor Etvc-Coa Length = 436 Back     alignment and structure
>pdb|4EM3|A Chain A, Crystal Structure Of Staphylococcus Aureus Bound With The Covalent Inhibitor Mevs-Coa Length = 437 Back     alignment and structure
>pdb|1YQZ|A Chain A, Structure Of Coenzyme A-Disulfide Reductase From Staphylococcus Aureus Refined At 1.54 Angstrom Resolution Length = 438 Back     alignment and structure
>pdb|4EQS|A Chain A, Crystal Structure Of The Y419f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EQR|A Chain A, Crystal Structure Of The Y361f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|4EQW|A Chain A, Crystal Structure Of The Y361f, Y419f Mutant Of Staphylococcus Aureus Coadr Length = 437 Back     alignment and structure
>pdb|2XT6|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Alpha-Ketoglutarate Decarboxylase Homodimer (Orthorhombic Form) Length = 1113 Back     alignment and structure
>pdb|3NTA|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase Length = 574 Back     alignment and structure
>pdb|3NT6|A Chain A, Structure Of The Shewanella Loihica Pv-4 Nadh-Dependent Persulfide Reductase C43sC531S DOUBLE MUTANT Length = 574 Back     alignment and structure
>pdb|3EF6|A Chain A, Crystal Structure Of Toluene 2,3-Dioxygenase Reductase Length = 410 Back     alignment and structure
>pdb|2L5T|A Chain A, Solution Nmr Structure Of E2 Lipoyl Domain From Thermoplasma Acidophilum Length = 77 Back     alignment and structure
>pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 Back     alignment and structure
>pdb|3CGC|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(p)h Specificity Length = 480 Back     alignment and structure
>pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 Back     alignment and structure
>pdb|3CTY|A Chain A, Crystal Structure Of T. Acidophilum Thioredoxin Reductase Length = 319 Back     alignment and structure
>pdb|3IWA|A Chain A, Crystal Structure Of A Fad-Dependent Pyridine Nucleotide-Disulphide Oxidoreductase From Desulfovibrio Vulgaris Length = 472 Back     alignment and structure
>pdb|1Q1R|A Chain A, Crystal Structure Of Putidaredoxin Reductase From Pseudomonas Putida Length = 431 Back     alignment and structure
>pdb|3LB8|A Chain A, Crystal Structure Of The Covalent Putidaredoxin Reductase- Putidaredoxin Complex Length = 436 Back     alignment and structure
>pdb|3CGB|A Chain A, Pyridine Nucleotide Complexes With Bacillus Anthracis Coenzyme A- Disulfide Reductase: A Structural Analysis Of Dual Nad(P)h Specificity Length = 480 Back     alignment and structure
>pdb|1HYU|A Chain A, Crystal Structure Of Intact Ahpf Length = 521 Back     alignment and structure
>pdb|2Q7V|A Chain A, Crystal Structure Of Deinococcus Radiodurans Thioredoxin Reductase Length = 325 Back     alignment and structure
>pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 Back     alignment and structure
>pdb|1FL2|A Chain A, Catalytic Core Component Of The Alkylhydroperoxide Reductase Ahpf From E.Coli Length = 310 Back     alignment and structure
>pdb|2BC0|A Chain A, Structural Analysis Of Streptococcus Pyogenes Nadh Oxidase: Wild-Type Nox Length = 490 Back     alignment and structure
>pdb|2BC1|A Chain A, Structural Analysis Of Streptococcus Pyogenes Nadh Oxidase: C44s Nox Length = 490 Back     alignment and structure
>pdb|2GR3|A Chain A, Crystal Structure Of Ferredoxin Reductase, Bpha4 (Oxidized Form) Length = 408 Back     alignment and structure
>pdb|1D7Y|A Chain A, Crystal Structure Of Nadh-Dependent Ferredoxin Reductase, Bpha4 Length = 408 Back     alignment and structure
>pdb|4A5L|A Chain A, Crystal Structure Of The Thioredoxin Reductase From Entamoeba Histolytica Length = 314 Back     alignment and structure
>pdb|1XHC|A Chain A, Nadh Oxidase /nitrite Reductase From Pyrococcus Furiosus Pfu-1140779- 001 Length = 367 Back     alignment and structure
>pdb|3LXD|A Chain A, Crystal Structure Of Ferredoxin Reductase Arr From Novosphingobium Aromaticivorans Length = 415 Back     alignment and structure
>pdb|3F8D|A Chain A, Structure Of Sulfolobus Solfataricus Thioredoxin Reductase Mutant C147a Length = 323 Back     alignment and structure
>pdb|3F8P|A Chain A, Structure Of Sulfolobus Solfataricus Trxr-B3 Length = 323 Back     alignment and structure
>pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 Back     alignment and structure
>pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 Back     alignment and structure
>pdb|3FG2|P Chain P, Crystal Structure Of Ferredoxin Reductase For The Cyp199a2 System From Rhodopseudomonas Palustris Length = 404 Back     alignment and structure
>pdb|2COO|A Chain A, Solution Structure Of The E3_binding Domain Of Dihydrolipoamide Branched Chaintransacylase Length = 70 Back     alignment and structure
>pdb|4GCM|A Chain A, Crystal Structure Of A Thioredoxine Reductase (Trxb) From Staphylococcus Aureus Subsp. Aureus Mu50 At 1.80 A Resolution Length = 312 Back     alignment and structure
>pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 Back     alignment and structure
>pdb|1ZWV|A Chain A, Solution Structure Of The Subunit Binding Domain (Hbsbd) Of The Human Mitochondrial Branched-Chain Alpha-Ketoacid Dehydrogenase Length = 58 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query866
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 0.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 0.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 0.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 0.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 0.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 0.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 0.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 0.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 0.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 0.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 0.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 0.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 0.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 0.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 0.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 0.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 0.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 1e-161
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 1e-158
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 1e-141
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 1e-138
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 1e-138
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-depe 1e-136
4dna_A463 Probable glutathione reductase; structural genomic 1e-135
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 1e-135
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 1e-133
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 1e-133
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 1e-133
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 1e-133
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 1e-130
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 1e-130
1fec_A490 Trypanothione reductase; redox-active center, oxid 1e-128
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihyd 1e-127
3rqc_A224 Probable lipoamide acyltransferase; alpha beta fol 1e-110
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; stru 1e-105
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide ace 2e-89
2ii3_A262 Lipoamide acyltransferase component of branched-C 3e-89
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransfer 3e-81
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 3e-36
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 1e-35
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 5e-35
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 2e-34
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 2e-34
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 2e-34
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 6e-34
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 1e-33
1yqz_A438 Coenzyme A disulfide reductase; oxidoreductase; HE 4e-33
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 5e-33
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 9e-33
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 2e-31
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 4e-31
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 1e-24
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 3e-24
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 5e-24
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 3e-23
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, 3e-23
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 5e-23
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 8e-23
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 4e-22
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 2e-21
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 4e-21
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 7e-21
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 2e-19
3cla_A213 Type III chloramphenicol acetyltransferase; transf 6e-19
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 6e-19
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 7e-18
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 3e-17
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 1e-16
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 1e-16
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 2e-16
4fk1_A304 Putative thioredoxin reductase; structural genomic 2e-16
4fk1_A304 Putative thioredoxin reductase; structural genomic 3e-04
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 8e-16
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 9e-16
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 3e-15
2i9d_A217 Chloramphenicol acetyltransferase; structural geno 7e-15
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 8e-15
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 9e-15
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 3e-13
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 2e-12
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 1e-11
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 1e-10
3r9u_A315 Thioredoxin reductase; structural genomics, center 3e-10
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein 2e-09
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 2e-09
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 2e-09
3rnm_E58 Lipoamide acyltransferase component of branched-C 2e-09
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 3e-09
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; 3e-09
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 2e-08
2gqf_A401 Hypothetical protein HI0933; structural genomics, 3e-08
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 4e-08
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 5e-08
2coo_A70 Lipoamide acyltransferase component of branched- c 6e-08
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 7e-08
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 4e-07
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 9e-07
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 1e-06
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 1e-06
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 1e-06
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 1e-06
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 1e-06
3atr_A453 Conserved archaeal protein; saturating double bond 1e-06
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 2e-06
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 2e-06
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 2e-06
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 2e-04
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 2e-06
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase comp 4e-06
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral 4e-06
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 4e-06
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 6e-06
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 1e-05
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 1e-05
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 1e-05
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 2e-05
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 2e-05
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 4e-05
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 7e-05
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 9e-05
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 1e-04
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 1e-04
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 2e-04
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 2e-04
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 2e-04
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 2e-04
2f60_K64 Pyruvate dehydrogenase protein X component; protei 2e-04
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 3e-04
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 3e-04
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 3e-04
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 3e-04
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 3e-04
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 3e-04
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 3e-04
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 5e-04
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 5e-04
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 6e-04
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 7e-04
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 8e-04
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Length = 476 Back     alignment and structure
 Score =  726 bits (1876), Expect = 0.0
 Identities = 217/479 (45%), Positives = 316/479 (65%), Gaps = 12/479 (2%)

Query: 389 KNFDVIVIGAGPGGYVASIRLAQLGFKTACIDEWKDNEENFALGGTCTNVGCIPSKALLQ 448
           + FDVIVIGAGPGGYVA+I+ AQLG KTA I+++K  E   ALGGTC NVGCIPSKALL 
Sbjct: 2   QKFDVIVIGAGPGGYVAAIKSAQLGLKTALIEKYKGKEGKTALGGTCLNVGCIPSKALLD 61

Query: 449 TSHSFENVKNSFFEYGINTQNVTLNLQKMLERKNNIIKKNNSGILFLFKKNKIKFFHGHA 508
           +S+ F     SF  +GI+T  V +++  M+ RK+ I++    G+  L K N +  F GH 
Sbjct: 62  SSYKFHEAHESFKLHGISTGEVAIDVPTMIARKDQIVRNLTGGVASLIKANGVTLFEGHG 121

Query: 509 IFTGKIQNNFHEIQIINK--TKETITAKYIIIATGSKARSFPGVKFDENLILSNKGALEM 566
                      ++++     + + +  + +I+A+GSK    P    D+++I+ + GAL+ 
Sbjct: 122 KLLAG-----KKVEVTAADGSSQVLDTENVILASGSKPVEIPPAPVDQDVIVDSTGALDF 176

Query: 567 INVPKKLCIIGAGVIGLEIGSIWRRLGSEVTILEMSSNFLNTVDEEIAKKAFHLLNKQGL 626
            NVP KL +IGAGVIGLE+GS+W RLG+EVT+LE    FL  VDE++AK+A  +L KQGL
Sbjct: 177 QNVPGKLGVIGAGVIGLELGSVWARLGAEVTVLEAMDKFLPAVDEQVAKEAQKILTKQGL 236

Query: 627 NIILNTKIHDIKINKENVLINYSNKSTNVKTEIITSIFDKLLIAIGRIPNTNNLNIDKIG 686
            I+L  ++   ++  + V + + +             FDKL++A+GR P T +L     G
Sbjct: 237 KILLGARVTGTEVKNKQVTVKFVDAEGEKSQA-----FDKLIVAVGRRPVTTDLLAADSG 291

Query: 687 LKVNENNFIIVNDNCETNIPNIYAIGDVVRGPMLAHKAEEEGIMVAEHISGQKHSINFNA 746
           + ++E  FI V+D C T++P +YAIGDVVRG MLAHKA EEG++VAE I+G K  +N++ 
Sbjct: 292 VTLDERGFIYVDDYCATSVPGVYAIGDVVRGAMLAHKASEEGVVVAERIAGHKAQMNYDL 351

Query: 747 LPFVIYTFPEIASVGKTEQYLKKHNISYNVGIFPFLANSRARILGETSGMVKILSDMKSD 806
           +P VIYT PEIA VGKTEQ LK   ++ NVG+FPF A+ RA    +T+G VK+++D K+D
Sbjct: 352 IPAVIYTHPEIAGVGKTEQALKAEGVAINVGVFPFAASGRAMAANDTAGFVKVIADAKTD 411

Query: 807 EILGIHIIGPMASELIAEAVIAIEFRASSEDIARICHVHPSLSEAMKEAAMSIENRSIN 865
            +LG+H+IGP A+EL+ +  IA+EF  S+ED+  +   HP+LSEA+ EAA+++   +I+
Sbjct: 412 RVLGVHVIGPSAAELVQQGAIAMEFGTSAEDLGMMVFAHPALSEALHEAALAVSGHAIH 470
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Length = 478 Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 470 Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Length = 491 Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Length = 455 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Length = 468 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Length = 474 Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Length = 482 Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 455 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Length = 464 Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 458 Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Length = 464 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Length = 499 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Length = 492 Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Length = 466 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Length = 523 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Length = 467 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 500 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Length = 488 Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Length = 484 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Length = 450 Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Length = 463 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Length = 478 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Length = 483 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Length = 519 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Length = 479 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Length = 463 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Length = 495 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Length = 490 Back     alignment and structure
>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 Back     alignment and structure
>3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Length = 224 Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 Back     alignment and structure
>2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Length = 480 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Length = 452 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Length = 447 Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Length = 452 Back     alignment and structure
>1yqz_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.54A {Staphylococcus aureus} Length = 438 Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Length = 449 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Length = 490 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Length = 415 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Length = 404 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} Length = 410 Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Length = 219 Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Length = 77 Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Length = 1113 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Length = 310 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Length = 217 Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Length = 311 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Length = 315 Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Length = 40 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Length = 325 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} PDB: 1zwv_A Length = 58 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Length = 51 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Length = 333 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Length = 338 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Length = 335 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 493 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Length = 320 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Length = 549 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
>2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Length = 64 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Length = 660 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query866
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase comp 100.0
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 100.0
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
1ojt_A482 Surface protein; redox-active center, glycolysis, 100.0
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 100.0
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 100.0
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 100.0
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 100.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 100.0
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 100.0
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 100.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 100.0
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
4dna_A463 Probable glutathione reductase; structural genomic 100.0
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 100.0
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 100.0
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 100.0
1fec_A490 Trypanothione reductase; redox-active center, oxid 100.0
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 100.0
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 100.0
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 100.0
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 100.0
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 100.0
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 100.0
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 100.0
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 100.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 100.0
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 100.0
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 100.0
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 100.0
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 100.0
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 100.0
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihyd 100.0
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-depe 100.0
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 100.0
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 100.0
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; stru 100.0
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide ace 100.0
2ii3_A262 Lipoamide acyltransferase component of branched-C 100.0
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransfer 100.0
3rqc_A224 Probable lipoamide acyltransferase; alpha beta fol 100.0
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
2xt6_A 1113 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, 100.0
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
3cla_A213 Type III chloramphenicol acetyltransferase; transf 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
4fk1_A304 Putative thioredoxin reductase; structural genomic 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
2i9d_A217 Chloramphenicol acetyltransferase; structural geno 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 99.97
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.97
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.97
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.97
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.97
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 99.96
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.96
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.96
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.96
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.96
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.96
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.95
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.95
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.95
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.95
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.95
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.95
1zy8_K229 Pyruvate dehydrogenase protein X component, mitoch 99.94
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.94
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.94
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 99.93
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 99.91
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 99.9
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 99.89
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.85
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.77
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.76
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 99.73
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 99.72
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 99.72
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase COM 99.72
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase comp 99.71
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.68
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 99.66
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 99.62
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate 99.62
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 99.61
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.6
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component 99.56
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl dom 99.53
2cul_A232 Glucose-inhibited division protein A-related PROT 99.47
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.46
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.42
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase comp 99.38
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.34
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 99.26
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.25
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 99.24
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 99.24
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 99.19
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.17
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.15
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 99.14
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 99.13
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 99.11
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 99.1
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 99.09
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.04
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.0
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein 98.93
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.92
3rnm_E58 Lipoamide acyltransferase component of branched-C 98.92
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide a 98.91
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 98.89
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide a 98.87
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein 98.87
3va7_A1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 98.86
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 98.81
3u9t_A675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 98.8
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; 98.8
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase comp 98.76
3dme_A369 Conserved exported protein; structural genomics, P 98.75
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.74
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.73
2cul_A232 Glucose-inhibited division protein A-related PROT 98.7
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral 98.67
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.64
2f60_K64 Pyruvate dehydrogenase protein X component; protei 98.64
2coo_A70 Lipoamide acyltransferase component of branched- c 98.64
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.61
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.59
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.58
1zko_A136 Glycine cleavage system H protein; TM0212, structu 98.57
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 98.55
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 98.55
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.55
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.54
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.53
2bry_A497 NEDD9 interacting protein with calponin homology a 98.53
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.52
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.51
2bry_A497 NEDD9 interacting protein with calponin homology a 98.5
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.48
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.47
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.47
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.46
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.46
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.45
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi- 98.45
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.45
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.43
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.4
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.39
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.39
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.38
3atr_A453 Conserved archaeal protein; saturating double bond 98.38
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.38
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.37
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.37
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.37
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.36
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.35
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.35
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.34
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 98.33
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.33
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.31
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.3
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.29
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.29
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.29
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.28
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.26
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.26
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.25
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.24
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.22
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.21
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.2
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.18
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.18
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.17
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.17
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.16
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.13
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.13
1hpc_A131 H protein of the glycine cleavage system; transit 98.12
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.11
3a7l_A128 H-protein, glycine cleavage system H protein; lipo 98.1
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.1
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.09
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.08
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.08
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.06
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.06
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.03
1onl_A128 Glycine cleavage system H protein; hybrid barrel-s 98.03
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 98.01
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.99
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.98
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.96
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 97.95
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.95
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.94
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.94
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.93
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 97.93
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.92
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.92
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.91
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.9
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.9
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.89
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.89
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 97.89
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 97.88
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 97.88
2gqf_A401 Hypothetical protein HI0933; structural genomics, 97.88
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.88
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 97.88
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.88
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.87
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.87
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.85
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.83
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.82
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.81
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.81
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.79
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.77
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.77
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.76
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.76
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.74
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.74
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.73
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.73
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.72
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.72
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.72
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.69
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.69
1q1r_A 431 Putidaredoxin reductase; glutathione reductase fol 97.67
3ef6_A 410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.66
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.66
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.65
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.64
3atr_A453 Conserved archaeal protein; saturating double bond 97.64
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.63
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.63
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 97.63
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.63
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.62
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 97.62
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.6
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.6
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 97.6
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.59
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 97.58
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 97.58
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.58
3dme_A369 Conserved exported protein; structural genomics, P 97.58
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.57
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.57
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.56
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.56
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.55
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 97.55
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.55
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.54
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.54
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.52
3klr_A125 Glycine cleavage system H protein; antiparallel be 97.51
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.5
3fg2_P 404 Putative rubredoxin reductase; ferredoxin reductas 97.5
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.5
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.49
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.49
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.49
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 97.48
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 97.48
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.47
3lxd_A 415 FAD-dependent pyridine nucleotide-disulphide oxido 97.47
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.47
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 97.47
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.47
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 97.47
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.47
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 97.46
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.46
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.45
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.45
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.45
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 97.44
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.44
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.43
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.43
2gqw_A 408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.42
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.41
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.41
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.39
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.39
3mxu_A143 Glycine cleavage system H protein; seattle structu 97.39
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.39
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 97.39
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 97.38
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.38
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.38
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 97.37
3ne5_B413 Cation efflux system protein CUSB; transmembrane h 97.37
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.37
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.36
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 97.36
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.35
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.35
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 97.35
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 97.34
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.34
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.34
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.33
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.33
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.32
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.32
3tzu_A137 GCVH, glycine cleavage system H protein 1; ssgcid, 97.32
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.31
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.29
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 97.27
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.27
3lnn_A359 Membrane fusion protein (MFP) heavy metal cation Z 97.26
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 97.26
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 97.26
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.26
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.23
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 97.22
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.21
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 97.2
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.2
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric 97.18
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.18
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.18
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.15
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.15
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.15
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 97.13
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 97.12
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.09
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.09
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.09
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.06
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, 97.06
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 97.05
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.04
4dna_A463 Probable glutathione reductase; structural genomic 97.04
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.02
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 96.99
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 96.97
4hb9_A412 Similarities with probable monooxygenase; flavin, 96.97
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 96.95
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 96.94
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 96.91
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.91
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 96.89
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.87
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 96.86
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 96.85
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, 96.84
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 96.83
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 96.8
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 96.78
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 96.75
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 96.75
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 96.72
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.71
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 96.7
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.67
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 96.66
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 96.66
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 96.6
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 96.52
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 96.5
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.49
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 96.49
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.45
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.43
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 96.38
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 96.3
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.29
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.22
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 96.18
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 96.07
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.05
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 96.0
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 95.98
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 95.88
4dk0_A369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 95.82
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 95.82
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 95.78
1vg0_A650 RAB proteins geranylgeranyltransferase component A 95.69
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 95.66
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, 95.65
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 95.59
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 95.57
3na6_A331 Succinylglutamate desuccinylase/aspartoacylase; st 95.54
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 95.44
3axb_A 448 Putative oxidoreductase; dinucleotide-binding fold 95.42
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; str 95.38
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 95.37
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 95.3
3fmc_A368 Putative succinylglutamate desuccinylase / aspart; 95.23
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 95.21
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 95.1
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 95.0
1z6h_A72 Biotin/lipoyl attachment protein; solution structu 94.99
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 94.95
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 94.86
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 94.79
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; bioti 94.66
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta s 94.62
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 94.39
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 94.36
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 94.19
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, 93.93
1f3z_A161 EIIA-GLC, glucose-specific phosphocarrier; phospho 93.15
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 93.04
2qj8_A332 MLR6093 protein; structural genomics, joint center 92.43
2gpr_A154 Glucose-permease IIA component; phosphotransferase 92.07
1lss_A140 TRK system potassium uptake protein TRKA homolog; 91.79
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; bio 91.77
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transfera 91.64
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondri 91.47
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 91.44
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 91.32
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 91.27
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 91.04
1ax3_A162 Iiaglc, glucose permease IIA domain; phosphotransf 90.86
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 90.8
2f1m_A277 Acriflavine resistance protein A; helical hairpin, 90.78
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.73
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 90.6
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 90.29
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 90.25
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 89.92
2l5t_A77 Lipoamide acyltransferase; E2 lipoyl domain; NMR { 89.77
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 89.71
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 89.59
2xha_A193 NUSG, transcription antitermination protein NUSG; 89.34
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 88.92
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 88.83
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 88.77
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 88.67
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 88.56
3lnn_A359 Membrane fusion protein (MFP) heavy metal cation Z 88.52
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase COM 88.38
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 88.27
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 88.23
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase c 88.18
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, 88.13
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 88.01
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric 87.8
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 87.68
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 87.54
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 87.53
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 87.49
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic 87.39
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 87.19
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 87.19
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 87.19
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 87.1
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehy 87.01
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Back     alignment and structure
Probab=100.00  E-value=5.6e-82  Score=699.97  Aligned_cols=382  Identities=34%  Similarity=0.585  Sum_probs=38.8

Q ss_pred             CccEEEecCCCCCCCCeEEEEEEEeCCCCeeeCCCeEEEEEecceeeEEecCCCeEEEEEeecCCCEEecCCEEEEEecC
Q psy9583           1 MALIEVKIPKLSESISEATLLNWHKKEGELVVRNENLIDIETDKVILELPAPQDGIINKIIITDGSIVTSNQVIALIDTD   80 (866)
Q Consensus         1 m~~~~~~~p~~g~~~~~g~i~~w~~~~G~~v~~g~~l~~ve~~k~~~~i~~~~~G~~~~~~~~~g~~v~~g~~l~~~~~~   80 (866)
                      |+ ++|+||+||++|+||+|++|+|++||.|++||+||+|||||++++|+||++|+|.++++++|+.|++|++|+.|+.+
T Consensus         1 M~-~~i~mP~lg~~~~eg~i~~w~v~~Gd~V~~gd~l~~vEt~K~~~~i~ap~~G~v~~i~v~~G~~V~~G~~l~~i~~~   79 (428)
T 3dva_I            1 MA-FEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAP   79 (428)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CC-eeEEcCCCCCCCccEEEEEEEcCCCCEECCCCEEEEEEeCCeeEEEecCCCeEEEEEEeCCCCEeCCCCEEEEEecC
Confidence            44 78999999999999999999999999999999999999999999999999999999999999999999999999864


Q ss_pred             Cccccc--------c---cc---cc-cc-----ccc---------cccccccchhHHHhhhhCCCCcccccCCCCCCCce
Q psy9583          81 ISKLSS--------K---TE---IK-NK-----KDI---------KNLNTIVMPSAKKILSDNNLEISKINNGTGKDGRI  131 (866)
Q Consensus        81 ~~~~~~--------~---~~---~~-~~-----~~~---------~~~~~~~~p~~r~~a~~~~~d~~~v~~gtg~~g~i  131 (866)
                      ++..++        .   +.   .+ +.     ++.         ...+..+||+||+||+|+||||+.| +||||+|||
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~asP~~R~lA~e~gvdl~~v-~gtG~~GrI  158 (428)
T 3dva_I           80 GYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAEAEAGPNRRVIAMPSVRKYAREKGVDIRLV-QGTGKNGRV  158 (428)
T ss_dssp             ------------------------------------------------CCCCCHHHHHHHHHTTCCGGGS-CCCSTTSCC
T ss_pred             CccccccccccccccccCCCcccCCccccccCCCccccccccccccccccccCHHHHHHHHHcCCCHHHC-CCCCCCCce
Confidence            432100        0   00   00 00     000         0123578999999999999999999 899999999


Q ss_pred             eehhHHhhhhhccccccccc-cccCCCccccccccCCCccccccCchhHHHHHHHHHHhccccceEEEEeeeechHHHHH
Q psy9583         132 IKEDVLKVLSSIKNINEEKQ-EKYKPYLDSISIKNNSRLEECVPMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDL  210 (866)
Q Consensus       132 ~~~Dv~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~ia~~m~~s~~~~p~~~~~~~~d~t~l~~~  210 (866)
                      +++||++|+........... ....+..............+++||++|||+||++|++||+++||||++.++|+|+|+++
T Consensus       159 ~k~DV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~s~~Rk~ia~~m~~S~~~~P~~~~~~evDvt~l~~~  238 (428)
T 3dva_I          159 LKEDIDAFLAGGAKPAPAAAEEKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAH  238 (428)
T ss_dssp             CTTTTTTTSCC---------------------------------------------------------------------
T ss_pred             eHHHHHHHhhccccccccccccccccCCCCccccccCCccccccCcHHHHHHHHHHHHhcccCCeEEEEEEEeHHHHHHH
Confidence            99999999754221110000 00000000000001112357899999999999999999999999999999999999999


Q ss_pred             HHHhhhHHHhhccCccCHHHHHHHHHHHHHHhCCccceEEeC--CeeEEccceeEEEEEecCCceEEeEEecCCCCCHHH
Q psy9583         211 RLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQYPIINASVDG--NNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIAD  288 (866)
Q Consensus       211 r~~~~~~~~~~~~~~~t~~~~~~ka~~~al~~~P~~n~~~~~--~~~~~~~~~~i~~av~~~~gl~~pvi~~~~~~~~~~  288 (866)
                      |+++++.++ +.|.|+||++||+||+++||++||+||++|++  +++++++++|||+||++++||++|||++++++|+.+
T Consensus       239 rk~~~~~~~-~~g~kls~~~~~ikAva~Al~~~P~~Na~~~~~~~~i~~~~~v~igiAV~t~~GL~vPvi~~a~~~sl~e  317 (428)
T 3dva_I          239 RKKFKAIAA-EKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTDRGLLVPVIKHADRKPIFA  317 (428)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHhhhhHh-hcCCCcCHHHHHHHHHHHHHHhCHHhhheEecCCCeEEEcCccCeEEEEEcCCceEEeeeccCCCCCHHH
Confidence            999987543 45899999999999999999999999999988  899999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCCCccccCCceEEEEcCCCcCccccccccCCCceEEEEeccceeeEEEeCCeeEeeeeeeeeecc
Q psy9583         289 IEKKINEFINKAQDNKLLPEEMSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAIKKRVIVENNNVVIRPINYFALSY  368 (866)
Q Consensus       289 i~~~~~~~~~~~~~~~l~~~~~~~gt~tisn~g~~g~~~~~~ii~~p~~~il~vg~~~~~~~~~~~~~~ir~~~~~~l~~  368 (866)
                      |+++++++.+++|+|+|.++|++||||||||+||+|+++|+|||||||+|||++|++.++|++.+|++++|++|+++|++
T Consensus       318 ia~~~~~l~~~ar~gkL~~~e~~ggtftISnlG~~G~~~ftpIin~pq~aIl~vG~i~~~pv~~~g~i~~r~~m~lsls~  397 (428)
T 3dva_I          318 LAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSF  397 (428)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHHHHHcCCCCccccCCCEEEEEcCCCCCccceEeecCCCCceEEEccccEEEEEEECCEEEEeeeEEEEEEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccchhhhhhhhh
Q psy9583         369 DHRIIDGREAVLSLMSF  385 (866)
Q Consensus       369 dhr~~dg~~a~~~~~~~  385 (866)
                      |||++||.++++|+...
T Consensus       398 DHRviDG~~aa~Fl~~l  414 (428)
T 3dva_I          398 DHRMIDGATAQKALNHI  414 (428)
T ss_dssp             -----------------
T ss_pred             cccccchHHHHHHHHHH
Confidence            99999999999887643
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 L mixed beta-sheeet of 6 strands; 2.20A {Escherichia coli} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: c.43.1.0 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Back     alignment and structure
>2ii3_A Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Back     alignment and structure
>3rqc_A Probable lipoamide acyltransferase; alpha beta fold; 4.01A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2xt6_A 2-oxoglutarate decarboxylase; lyase, KDH, KGD; HET: TPP; 2.74A {Mycobacterium smegmatis} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* 3u9b_A 3u9f_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- protein structure initiative, midwest center for structural genomics; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3rnm_E Lipoamide acyltransferase component of branched-C alpha-keto acid dehydrogenase complex,...; protein-protein interaction, redox protein; HET: FAD NHE; 2.40A {Homo sapiens} SCOP: a.9.1.0 PDB: 1zwv_A Back     alignment and structure
>2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus} Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase; HET: FAD NAD; 1.80A {Thermus thermophilus} Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2wxc_A 2btg_A 2bth_A 2cyu_A Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1zko_A Glycine cleavage system H protein; TM0212, structural genomi center for structural genomics, JCSG, protein structure INI PSI; HET: MSE; 1.65A {Thermotoga maritima} PDB: 2ka7_A Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1hpc_A H protein of the glycine cleavage system; transit peptide; HET: LPA; 2.00A {Pisum sativum} SCOP: b.84.1.1 PDB: 1dxm_A* 1htp_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3a7l_A H-protein, glycine cleavage system H protein; lipoic acid, lipoyl, transport protein; 1.30A {Escherichia coli} PDB: 3a7a_B 3ab9_A* 3a8i_E* 3a8j_E* 3a8k_E* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1onl_A Glycine cleavage system H protein; hybrid barrel-sandwich structure, structural genomics, riken structural genomics/proteomics initiative; 2.50A {Thermus thermophilus} SCOP: b.84.1.1 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3klr_A Glycine cleavage system H protein; antiparallel beta sheet, beta sandwich, oxidoreductase; HET: GOL; 0.88A {Bos taurus} SCOP: b.84.1.0 PDB: 2edg_A Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3mxu_A Glycine cleavage system H protein; seattle structural genomics center for infectious disease, S CAT-scratch disease, bacteremia; HET: CIT; 1.80A {Bartonella henselae} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ne5_B Cation efflux system protein CUSB; transmembrane helix, metal transport; 2.90A {Escherichia coli} PDB: 3ooc_A 3opo_A 3ow7_A 4dnt_B 4dop_B 3h9i_A 3h94_A 3h9t_B 3t53_B 3t51_B 3t56_B Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3tzu_A GCVH, glycine cleavage system H protein 1; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Mycobacterium marinum} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3hgb_A Glycine cleavage system H protein; ssgcid, niaid, decode, UW, SBRI, lipoyl; 1.75A {Mycobacterium tuberculosis} PDB: 3ift_A Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1vf7_A Multidrug resistance protein MEXA; alpha hairpin, beta barrel, membrane protein; 2.40A {Pseudomonas aeruginosa} SCOP: f.46.1.1 PDB: 2v4d_A 1t5e_A Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, BCCP, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii} PDB: 2ejf_C* 2ejg_C* 2evb_A Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin, transferase; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2k32_A A; NMR {Campylobacter jejuni} PDB: 2k33_A* Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Back     alignment and structure
>1f3z_A EIIA-GLC, glucose-specific phosphocarrier; phosphotransferase, signal transduction, sugar transport; 1.98A {Escherichia coli} SCOP: b.84.3.1 PDB: 1f3g_A 1ggr_A 1gla_F 1glb_F* 1glc_F* 1gld_F* 1gle_F* 1o2f_A 2f3g_A Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>2gpr_A Glucose-permease IIA component; phosphotransferase, enzyme IIA; 2.50A {Mycoplasma capricolum} SCOP: b.84.3.1 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hamme structure, selenomethionine, ligase, transferase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, disease mutation, nucleotide-binding, mitochondrion; HET: PG4; 1.50A {Homo sapiens} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1ax3_A Iiaglc, glucose permease IIA domain; phosphotransferase system, sugar transport, transferase, phosphorylation, transmembrane; NMR {Bacillus subtilis} SCOP: b.84.3.1 PDB: 1gpr_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2f1m_A Acriflavine resistance protein A; helical hairpin, lipoyl domain, beta barrel, transport prote; 2.71A {Escherichia coli} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2l5t_A Lipoamide acyltransferase; E2 lipoyl domain; NMR {Thermoplasma acidophilum} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2xha_A NUSG, transcription antitermination protein NUSG; 1.91A {Thermotoga maritima} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3lnn_A Membrane fusion protein (MFP) heavy metal cation ZNEB (CZCB-LIKE); structural genomics, PSI-2, protein structure initiative; 2.80A {Cupriavidus metallidurans} Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase COM pyruvate dehydrogenase complex,...; pyruvate dehydrogenase kinase isozyme 2, glucos metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 866
d1scza_233 c.43.1.1 (A:) Dihydrolipoamide succinyltransferase 9e-70
d1b5sa_242 c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { 6e-51
d3lada3124 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenas 4e-43
d1v59a3123 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenas 2e-42
d1dxla3123 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenas 6e-42
d3claa_213 c.43.1.1 (A:) Chloramphenicol acetyltransferase, C 2e-41
d1q23a_214 c.43.1.1 (A:) Chloramphenicol acetyltransferase, C 9e-41
d1dpba_243 c.43.1.1 (A:) Dihydrolipoamide acetyltransferase { 4e-39
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 6e-36
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 4e-21
d1ojta3128 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenas 4e-35
d1ebda3115 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenas 1e-34
d1lvla3123 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenas 3e-33
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 4e-33
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 1e-18
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 1e-32
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 6e-30
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-32
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 2e-22
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 7e-32
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 4e-29
d1xdia2118 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenas 2e-31
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 2e-30
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 4e-21
d1mo9a3140 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl c 6e-30
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 2e-28
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 1e-25
d1feca3128 d.87.1.1 (A:358-485) Trypanothione reductase {Crit 1e-27
d1h6va3133 d.87.1.1 (A:367-499) Mammalian thioredoxin reducta 1e-27
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 2e-27
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 8e-25
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 2e-26
d1gesa3115 d.87.1.1 (A:336-450) Glutathione reductase {Escher 2e-26
d1onfa3119 d.87.1.1 (A:377-495) Glutathione reductase {Plasmo 4e-26
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 3e-25
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 2e-21
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 4e-25
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 6e-21
d3grsa3115 d.87.1.1 (A:364-478) Glutathione reductase {Human 2e-24
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 9e-24
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 2e-17
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 2e-23
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 4e-23
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 3e-21
d1nhpa3126 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus 1e-22
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 1e-21
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 1e-21
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 2e-21
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 1e-20
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 2e-16
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 4e-20
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 4e-15
d1laba_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 9e-20
d1y8ob1102 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoa 9e-20
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 1e-19
d1dxla2123 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase 4e-19
d1k8ma_87 b.84.1.1 (A:) Lipoyl domain of the mitochondrial b 4e-19
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 1e-18
d1pmra_80 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 3e-18
d1ojta2125 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase 7e-18
d3lada2119 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase 1e-17
d1ghja_79 b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate 1e-17
d1v59a2122 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase 1e-16
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 2e-16
d1fcda1186 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf 4e-16
d1h6va2122 c.3.1.5 (A:171-292) Mammalian thioredoxin reductas 4e-16
d1djqa2156 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, 3e-15
d1gjxa_81 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 9e-15
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 2e-14
d1qjoa_80 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 2e-13
d3grsa2125 c.3.1.5 (A:166-290) Glutathione reductase {Human ( 3e-13
d1ebda2117 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase 9e-13
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 1e-12
d1onfa2117 c.3.1.5 (A:154-270) Glutathione reductase {Plasmod 7e-12
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 1e-11
d1iyua_79 b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide ac 1e-11
d1gesa2116 c.3.1.5 (A:147-262) Glutathione reductase {Escheri 4e-11
d1feca2117 c.3.1.5 (A:170-286) Trypanothione reductase {Crith 5e-11
d1lvla2115 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase 9e-11
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 1e-10
d1aoga2117 c.3.1.5 (A:170-286) Trypanothione reductase {Trypa 3e-10
d1m6ia2137 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF 7e-10
d1mo9a2121 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl co 8e-10
d2cyua139 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoa 5e-09
d1w85i_42 a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl 7e-09
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 8e-09
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 5e-05
d1xhca2122 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductas 2e-08
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 2e-08
d1d7ya2121 c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu 3e-08
d1dcza_77 b.84.1.1 (A:) Biotin carboxyl carrier domain of tr 3e-08
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 5e-08
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 3e-05
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 1e-07
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 4e-06
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 1e-07
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 2e-07
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 2e-07
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 1e-05
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 2e-07
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 3e-07
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 1e-06
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 2e-06
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 2e-06
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 3e-06
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 4e-06
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 4e-06
d1m6ia1213 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f 4e-06
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 6e-06
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 1e-05
d1bdoa_80 b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carbox 2e-05
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 3e-05
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 6e-05
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 7e-05
d1q1ra2133 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseud 8e-05
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 9e-05
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 0.002
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 9e-05
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 1e-04
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 1e-04
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 1e-04
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 1e-04
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 2e-04
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 2e-04
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 4e-04
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 4e-04
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 4e-04
d1nhpa2123 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus 5e-04
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 5e-04
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 7e-04
d1pj5a2305 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox 0.002
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 0.003
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 0.003
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 0.003
>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 233 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: CoA-dependent acyltransferases
superfamily: CoA-dependent acyltransferases
family: CAT-like
domain: Dihydrolipoamide succinyltransferase
species: Escherichia coli [TaxId: 562]

 Score =  228 bits (582), Expect = 9e-70
 Identities = 130/219 (59%), Positives = 178/219 (81%)

Query: 167 SRLEECVPMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKL 226
           +R E+ VPM+RLR  +AERLL+++ ++A+LTTFNE+NM+ I+DLR +Y + FEK H ++L
Sbjct: 1   ARSEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRL 60

Query: 227 GFMSFFVKAVVSALKQYPIINASVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSI 286
           GFMSF+VKAVV ALK+YP +NAS+DG++++YH Y+D+ +A+S+ RGLV P+LR+ DT+ +
Sbjct: 61  GFMSFYVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGM 120

Query: 287 ADIEKKINEFINKAQDNKLLPEEMSGGTFTISNGGVFGSMLSTPIINPPQSAILGVHAIK 346
           ADIEKKI E   K +D KL  E+++GG FTI+NGGVFGS++STPIINPPQSAILG+HAIK
Sbjct: 121 ADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIK 180

Query: 347 KRVIVENNNVVIRPINYFALSYDHRIIDGREAVLSLMSF 385
            R +  N  V I P+ Y ALSYDHR+IDGRE+V  L++ 
Sbjct: 181 DRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVTI 219
>d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 124 Back     information, alignment and structure
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 123 Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Length = 214 Back     information, alignment and structure
>d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 243 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 128 Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 115 Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 123 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 118 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 140 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 128 Back     information, alignment and structure
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 119 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 126 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 80 Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 123 Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 125 Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 119 Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 122 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 156 Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Length = 81 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 117 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 117 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Length = 79 Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 117 Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 115 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 117 Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 121 Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Length = 39 Back     information, alignment and structure
>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Length = 42 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 122 Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Length = 77 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Length = 80 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 133 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 123 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query866
d1scza_233 Dihydrolipoamide succinyltransferase {Escherichia 100.0
d1dpba_243 Dihydrolipoamide acetyltransferase {Azotobacter vi 100.0
d1b5sa_242 Dihydrolipoamide acetyltransferase {Bacillus stear 100.0
d1q23a_214 Chloramphenicol acetyltransferase, CAT {Escherichi 99.97
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.97
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.97
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.97
d3claa_213 Chloramphenicol acetyltransferase, CAT {Escherichi 99.96
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.96
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.96
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.95
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.95
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.95
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.94
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.94
d1v59a3123 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.94
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.94
d1dxla3123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.94
d3lada3124 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.94
d1lvla3123 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.94
d1ojta3128 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.93
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.93
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.93
d1ebda3115 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.93
d1xdia2118 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.93
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.91
d3grsa3115 Glutathione reductase {Human (Homo sapiens) [TaxId 99.9
d1gesa3115 Glutathione reductase {Escherichia coli [TaxId: 56 99.89
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 99.87
d1feca3128 Trypanothione reductase {Crithidia fasciculata [Ta 99.87
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.87
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 99.86
d1onfa3119 Glutathione reductase {Plasmodium falciparum [TaxI 99.86
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.85
d1mo9a3140 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.84
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 99.83
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.81
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 99.81
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 99.8
d1h6va3133 Mammalian thioredoxin reductase {Rat (Rattus norve 99.8
d1nhpa3126 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.78
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.78
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.77
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 99.76
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.75
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.75
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.74
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.74
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.73
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.72
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.71
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.71
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.71
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.69
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.67
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.66
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.64
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.62
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.62
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.59
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.55
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.54
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.54
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 99.53
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.51
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.5
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.5
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.48
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.47
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.47
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.46
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.39
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 99.34
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.34
d1w85i_42 E3/E1 binding domain of dihydrolipoyl acetyltransf 99.34
d2cyua139 E3-binding domain of dihydrolipoamide succinyltran 99.29
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.23
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.22
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.15
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.14
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.13
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.12
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 99.1
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.04
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.04
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.04
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.03
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.0
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.99
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.99
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.92
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.91
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.91
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.91
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 98.9
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.88
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.87
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.84
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.84
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.82
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.79
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.79
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.77
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.75
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.73
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.73
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.72
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.69
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.69
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.67
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.66
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.64
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.64
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.6
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.57
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.57
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.53
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.51
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.51
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.49
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.49
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.47
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.46
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.44
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.44
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.43
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.42
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.41
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.41
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.38
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.37
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.36
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.33
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.29
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.28
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.26
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.25
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.25
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.25
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.18
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.14
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.12
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.08
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.06
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.94
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.91
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.88
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.87
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.85
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.77
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.75
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.73
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.7
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.62
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 97.58
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 97.56
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.53
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.46
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.45
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.42
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.42
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.28
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.11
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 97.11
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.1
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.1
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.03
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 97.03
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.99
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 96.96
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 96.94
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 96.92
d1onla_127 Protein H of glycine cleavage system {Thermus ther 96.82
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 96.81
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 96.75
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.75
d1hpca_131 Protein H of glycine cleavage system {Pea (Pisum s 96.72
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 96.64
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.63
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.62
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 96.6
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 96.53
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 96.48
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.42
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 96.4
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 96.34
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 96.23
d1dcza_77 Biotin carboxyl carrier domain of transcarboxylase 95.99
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 95.92
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 95.92
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 95.77
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 95.75
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.62
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.57
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 95.5
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.84
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 94.76
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 94.73
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 94.66
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.48
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.4
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.39
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.38
d1bdoa_80 Biotinyl domain of acetyl-CoA carboxylase {Escheri 94.36
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.36
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.3
d1iyua_79 Lipoyl domain of dihydrolipoamide acetyltransferas 93.82
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.81
d1k8ma_87 Lipoyl domain of the mitochondrial branched-chain 93.74
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.7
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 93.61
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 93.56
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 93.45
d1qjoa_80 Lipoyl domain of dihydrolipoamide acetyltransferas 93.04
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 93.04
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 92.71
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 92.48
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 92.48
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 92.32
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 92.26
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 92.24
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 92.18
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.18
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.09
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 91.95
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 91.92
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 91.91
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.71
d1vf7a_237 Multidrug resistance protein MexA domain {Pseudomo 91.71
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 91.61
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 91.4
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 91.23
d1ghja_79 Lipoyl domain of the 2-oxoglutarate dehydrogenase 90.96
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 90.89
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 90.7
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 90.68
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 90.53
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 90.36
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 90.31
d1y8ob1102 Lipoyl domain of dihydrolipoamide acetyltransferas 90.15
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.71
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 89.54
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 89.46
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 89.13
d1gjxa_81 Lipoyl domain of dihydrolipoamide acetyltransferas 88.86
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 88.67
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 88.41
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 88.04
d1laba_80 Lipoyl domain of dihydrolipoamide acetyltransferas 87.88
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 87.72
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 87.61
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 87.29
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 87.07
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 86.99
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 86.23
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 85.9
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 85.54
d1pmra_80 Lipoyl domain of the 2-oxoglutarate dehydrogenase 85.14
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 84.81
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 84.72
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 84.65
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 84.47
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 84.36
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 84.35
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 84.25
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 84.24
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 83.67
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 83.62
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 83.37
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 83.34
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 82.7
d1id1a_153 Rck domain from putative potassium channel Kch {Es 82.61
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 82.48
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 82.09
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 81.78
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 81.54
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 80.91
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 80.86
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 80.85
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 80.71
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 80.38
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 80.24
>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: CoA-dependent acyltransferases
superfamily: CoA-dependent acyltransferases
family: CAT-like
domain: Dihydrolipoamide succinyltransferase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=9e-57  Score=452.05  Aligned_cols=216  Identities=60%  Similarity=1.016  Sum_probs=210.9

Q ss_pred             ccccccCchhHHHHHHHHHHhccccceEEEEeeeechHHHHHHHHhhhHHHhhccCccCHHHHHHHHHHHHHHhCCccce
Q psy9583         169 LEECVPMSRLRLCIAERLLQSQANSAILTTFNEINMQSIIDLRLKYKDKFEKEHNVKLGFMSFFVKAVVSALKQYPIINA  248 (866)
Q Consensus       169 ~~~~~~~~~~r~~ia~~m~~s~~~~p~~~~~~~~d~t~l~~~r~~~~~~~~~~~~~~~t~~~~~~ka~~~al~~~P~~n~  248 (866)
                      .++++|++++||+||++|++||+++||+|++.++|+|+++++|+++++.++++.|.++|+++||+||+++||++||++|+
T Consensus         3 ~ee~vpls~~rk~ia~~m~~S~~~iP~~~~~~evd~t~l~~~r~~~~~~~~~~~~~klt~~~~likA~a~aL~~~P~~Na   82 (233)
T d1scza_           3 SEKRVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSFYVKAVVEALKRYPEVNA   82 (233)
T ss_dssp             SCCCCCCCHHHHHHHHHHHHHHTTSCEEEEEEEEECHHHHHHHHHHHHHHHHHHSSCCCSHHHHHHHHHHHHHHCTTTTC
T ss_pred             CCcccCCcHHHHHHHHHHHHHhccCCeEEEEEEEEHHHHHHHHHHHHHhhHhhcCCccCHHHHHHHHHHHHHHhCchhhe
Confidence            46789999999999999999999999999999999999999999999888888899999999999999999999999999


Q ss_pred             EEeCCeeEEccceeEEEEEecCCceEEeEEecCCCCCHHHHHHHHHHHHHHHhcCCCCccccCCceEEEEcCCCcCcccc
Q psy9583         249 SVDGNNIIYHKYYDIGIAISSSRGLVVPILRNADTMSIADIEKKINEFINKAQDNKLLPEEMSGGTFTISNGGVFGSMLS  328 (866)
Q Consensus       249 ~~~~~~~~~~~~~~i~~av~~~~gl~~pvi~~~~~~~~~~i~~~~~~~~~~~~~~~l~~~~~~~gt~tisn~g~~g~~~~  328 (866)
                      +|+++++++++++|||+||++++||++||||+++++|+.||+++++++.+++|+|+|+++|++||||||||+|++|+++|
T Consensus        83 ~~~~~~i~~~~~vnIgiAv~~~~GL~vPvI~~a~~~sl~eia~~~~~l~~~ar~~~L~~~d~~ggTfTISNlG~~g~~~~  162 (233)
T d1scza_          83 SIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELAVKGRDGKLTVEDLTGGNFTITNGGVFGSLMS  162 (233)
T ss_dssp             EEETTEEECCSSCCEEECEEETTEEECCEETTGGGCCHHHHHHHHHHHHHHTTTTCCCHHHHSCCSEEEEEGGGGTCCCC
T ss_pred             EEcCCeEEEeccceEEEEEEcCCCeEEeEeeccccCCHHHHHHHHHHHHHHhhcCCCCHHHhCCCcEEEEcCccccceee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCceEEEEeccceeeEEEeCCeeEeeeeeeeeecccccccccchhhhhhhh
Q psy9583         329 TPIINPPQSAILGVHAIKKRVIVENNNVVIRPINYFALSYDHRIIDGREAVLSLMS  384 (866)
Q Consensus       329 ~~ii~~p~~~il~vg~~~~~~~~~~~~~~ir~~~~~~l~~dhr~~dg~~a~~~~~~  384 (866)
                      +|||||||+||||+|++.++|++.+|++++|++|+++++||||++||+++++|...
T Consensus       163 tpii~ppq~aIl~vG~i~~~pv~~~g~i~~r~~~~lsls~DHRviDGa~aa~Fl~~  218 (233)
T d1scza_         163 TPIINPPQSAILGMHAIKDRPMAVNGQVEILPMMYLALSYDHRLIDGRESVGFLVT  218 (233)
T ss_dssp             CCCCCTTCSEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEETTTCCHHHHHHHHHH
T ss_pred             eeecCCCCceEEecccceeeccccCCeEEEEEEeEEEEEhhcchhccHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999988764
>d1dpba_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1b5sa_ c.43.1.1 (A:) Dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q23a_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3claa_ c.43.1.1 (A:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1v59a3 d.87.1.1 (A:356-478) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1dxla3 d.87.1.1 (A:348-470) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada3 d.87.1.1 (A:349-472) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla3 d.87.1.1 (A:336-458) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojta3 d.87.1.1 (A:471-598) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ebda3 d.87.1.1 (A:347-461) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xdia2 d.87.1.1 (A:349-466) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d3grsa3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa3 d.87.1.1 (A:336-450) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca3 d.87.1.1 (A:358-485) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa3 d.87.1.1 (A:377-495) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mo9a3 d.87.1.1 (A:384-523) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va3 d.87.1.1 (A:367-499) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nhpa3 d.87.1.1 (A:322-447) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1w85i_ a.9.1.1 (I:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1onla_ b.84.1.1 (A:) Protein H of glycine cleavage system {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1iyua_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1k8ma_ b.84.1.1 (A:) Lipoyl domain of the mitochondrial branched-chain alpha-ketoacid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qjoa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vf7a_ f.46.1.1 (A:) Multidrug resistance protein MexA domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ghja_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1y8ob1 b.84.1.1 (B:128-229) Lipoyl domain of dihydrolipoamide acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gjxa_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmra_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure