Psyllid ID: psy9598


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910-----
LTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQNYETSSSEEEEEEDSKSRQRRVRPTAVTRAQREAMNQKKLKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRWNSHKNKENKKDSKRGEKKIKRMKRRRRKIRRTLVESDDEVLSRKRRGKSTYENDFDFNPAGETKTKAEKFLMSAMETERLTRLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSAATEGTSPSGTAPTAQNKNFVKRLPLSQHKIVVERINAFAEIESEEFIKESKKLFDSSTTTQPLVVKKEKKKKVVRQARTRAEYSEHIQDQYEDPDNLSLSGSEESASDSDQSQVDVSDLCESSSSSGGTSSSDYSDWIHEGVNLEPPKRVRRHTKVKPIQVSLPKQLIPEEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISQYPAYAYVVEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQNYETSSSEEEEEEDSKSRQRRVRPTAVTRAQREAMNQKKLKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRWNSHKNKENKKDSKRGEKKIKRMKRRRRKIRRTLVESDDEVLSRKRRGKSTYENDFDFNPAGETKTKAESGNEQVEEVKTRVRRRSSNRSRSNSQDNEENDEEDVDIDNFDPEQPGPSTSYAEPVASTSRGRFAGRAAKRKFKEESASESQEDENSIPETDTTEQPAKKLKVLYPKRRGQQSEDGSGDNASEMSELKQDPLSLHDENEDEDNTNEMGKRKRTTRLVKSNEPEDEEDDDDESDEDYSPSTHAVTKRKRSVRVEKSNEVDEDEESDEDYKP
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccHHHHcccccccccccccccccHHHHccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccEEEEEHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccHHHHHHHHcccccccccccccccccEEEEccccccEEEcccccccccccccccccccccccccccccccccEEEEccccEEEccccccEEEcccccccEEEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccccEEcccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEcccccccEEEEEEccccccccEEEEEEcccccEEEEEccccccEEEEccccccccccccccccccEEEEEEcccccEEEEEEccccEEEEEccccccccEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEccccccccccccccccccccccEEEEEEcccccEEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEccccEEcccccccEEEEEEcccccEEEEEcccccEEEEEccccccccccccEEEEcccccEEEcccccccccccccccccccccccccccccEEEEccccccEEEEccccccccEEcccccccccccEEEEEEccccccccccccccccccccccEEEEccEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccEEEEcHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEEEccccEEEEEEEEEcccccccccEEEEEcccccccccEEEEHHHHHHHHHccccccccEEEEEcccEEEEEEEEccccccccccEEEEEEccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccHHHHHcccccccccccccccccHHHHccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEcccccccHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHccccccccHHHcccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccccccccccccccccccccccccHHHcccHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHccccccccEEEEEEcccccHHEEcccccccEEEEEcccccEEEEcccccEEEEEEcccHHHHcccccccccccccccEEEEcccccEEEcccccEEEEEcccccccEEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEccccccccEEEEEEccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEEEcccccEEEEEccccEEEEEEccccccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEccHHcccccccccEEcccccccEEEEEEcccccEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEccccccEEEEEEcccEEEEEEcccccEEEEEEcccEEEccccccEEEEEEcccccEEEEEccccEEEEEEccccccccccccEEEEcccccEEEEcccccEEEEEccccccccccccccEEEEcccccccccEEEEccccccccccccccEEEcccccEEEEEcccccccEcHHHHHHEcEcccccEEEEccccccccccccccEEEccccccccccccccccccEEEEEcccccEEEEEEcccccEEEEEEEcccccEEEEcccccccEEEEccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccHHHHcccccccccccccccEEEEEcccHHHHHHHHHHcccEEEccccccccccccccHHcEEEEEEEEEEcccccEEEEEEEEEcccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHccEcccccccccccEEEEEEcccccccccccccccccccccccHHccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccHHccccccccHcHcccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHcccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccHHHHcHHccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccHEHccccccccccccccccc
LTTLRARFQNRFYRRITSAQFDVRYLAANAekfnephsniVKYARIITDLLLRIikepnpvdvpVVYHELLQnyetssseeeeeedsksrqrrvrptaVTRAQREAMNQkklkrpfnwkNECREVLETlwvcpdsepfrkpvdkldhpdydkiviapmdlgtireelrgdnyespidFVKDVKRVFHnsrnynqnkrsKIYIMTTRLSEFAEEHLRRLTVRWNshknkenkkdskRGEKKIKRMKRRRRKIRRTLVEsddevlsrkrrgkstyendfdfnpagetkTKAEKFLMSAMETERLTRLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKnllperydwegathsQTLAEVasshpnvtasfLPKICQrlgplldkelkpnfpglksllsggsqSLLRSEKSLAKSVLSSYDYIARQHgtsllvpnsvkvhntVNVLrsreysgplsrslmisSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLrgcsgeisdiAIDNRNILLAAGTVDKTIRIWNLQTLAPIsvlvghqgiitgvnfcplevngfnylaststdgcigfwkykldidisktvfhepvmfnerirpgnahilcssfspgglflatgsgdhhvrvykmdgvdsplgileveehsdkvdsiqwshshlrfvsgsrdgTALIWYYKCSQWRFirldmntclphtketsdetNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHtnevfvleshpfdsrvllsaghdgLIIIWDILSSKQRGYKWFHNIVegqgegalfdgkwspdgttcaltdSYGHLLVYglggfkrpqniprelffhtdyrtlnrpnglfeptydevtnlpphlmpppflvdlngtpyppevqrlvpgrenaddtellpdittnddghveivegserngerpvevegqrhyndhghvyiQTSHVHVLRsrangessaategtspsgtaptaqnknfvkrlplsQHKIVVERINAFAEIESEEFIKESKKlfdsstttqplvvkkekKKKVVRQARTRAEYSEHiqdqyedpdnlslsgseesasdsdqsqvdvsdlcesssssggtsssdysdwihegvnleppkrvrrhtkvkpiqvslpkqlipeevpdiykpsdwlaevvpkkapyypqmgdevmFFKQGYQKYVDAVRSKGIYELsrlrsspwgnlilqepelVKVVGIkyeiapprmcCLKLavmkpngkltneffnikyhdmpdvIDFFVLRQIYETAIARewnvgdrfcsmiddawwwgtiegkpsptkspflgykilwdnnerenlspwdleppkegkeatepggslpvepeEIQELlyhprpdewpqgdrdaTCEKIITGLEevmglsvaepflvpvdisqypayayvvEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANAekfnephsniVKYARIITDLLLRIikepnpvdvpVVYHELLQnyetssseeeeeedsksrqrrvrptaVTRAQREAMNQkklkrpfnwkNECREVLETlwvcpdsepfrkpvdkldhpdydkiviapmdlgtireelrgdnyespidFVKDVKRVFHnsrnynqnkrsKIYIMTTRLSEFAEEHLRRLTVRWNshknkenkkdskRGEKKIKRMKRRRRKIRRTLVEsddevlsrkrrgkstyendfdfnpagetktkaesgnEQVEEVKTRVRrrssnrsrsnsqdneendeedvdidnfdpeqpgpstsyaepvastsrgrfaGRAAKRKfkeesasesqedensipetdtteqpakklkvlypkrrgqqsedgsgdnasemselkqdplslhdenededntnemgkrkrttrlvksnepedeeddddesdedyspsthavtkrkrsvrveksnevdedeesdedykp
lttlrarfqnrfyrritsaqfdVRYLAANaekfnephsnivKYARIITDLLLRIIKEPNPVDVPVVYHELLQNyetssseeeeeedsksrqrrvrptavtraqreamnqkklkrpfnwknECREVLETlwvcpdsepfrkpvdkldhpdydKIVIAPMDLGTIREElrgdnyespidfVKDVkrvfhnsrnynqnkrskiYIMTTRLSEFAEEHLRRLtvrwnshknkenkkdskrgekkikrmkrrrrkirrtlvesddevlsrkrrgkstyendfdfnpagetkTKAEKFLMSAMETERLTRLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHgtsllvpnsvkvHNTVNVLrsreysgplsRSLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLrfvsgsrdgTALIWYYKCSQWRFIRLDMNTCLPhtketsdetnkkIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDtellpdittnddghVEIVegserngerpveVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSaategtspsgtaptaqnknfvkrlplsqHKIVVERINAFAEIESEEfikeskklfdsstttqplvvkkekkkkvvrqartraeysehiqdqyedpdNLSLSGSEESASDSDQSQVDVSDLCESSsssggtsssdysdWIHEGvnleppkrvrrhtkvkpiqvslpkqlipeevPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSrlrsspwgnlilqepELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIarewnvgdrFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKeatepggslpVEPEEIQELLYhprpdewpqgdRDATCEKIITGLEEVMGLSVAEPFLVPVDISQYPAYAYVVEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANaekfnephsnivKYARIITDLLLRIIKEPNPVDVPVVYHELLQNyetssseeeeeedsksrqrrvrptavtraqreamnqkklkrpfnwknECREVLETlwvcpdsepfrkpvdkldhpdydKIVIAPMDLGTIREElrgdnyespidfVKDVkrvfhnsrnynqnkrskiYIMTTRLSEFAEEHLRRLtvrwnshknkenkkdskrgekkikrmkrrrrkirrtlvesddevlsrkrrgkstyendfdfnpagetktkaesgneqveevktrvrrrssnrsrsnsqdneendeedvdidNFDPEqpgpstsyaepvastsrgrFAGRAAKRkfkeesasesqedensipetdtteqpakklkvlypkrrgqqsedgsgdnasemselkqdplslhdenededntnemgkrkrttrlvksnepedeeddddesdedyspsthavtkrkrsvrveksnevdedeesdedykp
LTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQNYetssseeeeeedsksRQRRVRPTAVTRAQREAMNQKKLKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRWNSHKNKENKKDSkrgekkikrmkrrrrkirrTLVESDDEVLSRKRRGKSTYENDFDFNPAGETKTKAEKFLMSAMETERLTRLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPglksllsggsqsllrsEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSAATEGTSPSGTAPTAQNKNFVKRLPLSQHKIVVERINafaeieseefikeskKLFDSSTTTQPLvvkkekkkkvvRQARTRAEYSEHIQDQYEDPDNlslsgseesasdsdqsqvdvsdLCEsssssggtsssdysdWIHEGVNLEPPKRVRRHTKVKPIQVSLPKQLIPEEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISQypayayvveypvDLTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQNYetssseeeeeedsksRQRRVRPTAVTRAQREAMNQKKLKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRWNSHKNKENKKDSkrgekkikrmkrrrrkirrTLVESDDEVLSRKRRGKSTYENDFDFNPAGETKTKAESGNEQVEEVKTRVrrrssnrsrsnsqdneendeedvdidnFDPEQPGPSTSYAEPVASTSrgrfagraakrkfkEESASESQEDENSIPETDTTEQPAKKLKVLYPKRRGQQSEDGSGDNASEMSELKQDPLSLHdenededntneMGKRKRTTRLVKSNepedeeddddesdedYSPSTHAVTKRKRSVRveksnevdedeesdedYKP
******RFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQN*****************************************PFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRW******************************************************************************RLTRLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKEL***************************SVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTK******NKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNG*******************************************************YNDHGHVYIQTSHVHVL*****************************VKRLPLSQHKIVVERINAFAEIE********************************************************************************************************************IQVSLPKQLIPEEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKP**TKSPFLGYKILWDN***************************************************DATCEKIITGLEEVMGLSVAEPFLVPVDISQYPAYAYVVEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQN*****************************************PFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRW**************************************************************************************************************************************************************************************************************************************************************************************
LTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHEL************************************************KNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVR***********************************************************************LMSAMETERLTRLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVH*********************TAPTAQNKNFVKRLPLS****************SEEFIKES********************************************************************************************************************************SDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGK***************IQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISQYPAYAYVVEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYH*************************************************WKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYN*NKRSKIYIMTTRLSEFAEEHLRRLTV****************************************************************************************************************************************************************************************************************************************************************************************
LTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQN*************************************KLKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRWNSH***********************RKIRRTLVESDDEVLSRKRRGKSTYENDFDFNPAGETKTKAEKFLMSAMETERLTRLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVHV**********************PTAQNKNFVKRLPLSQHKIVVERINAFAEIESEEFIKESKKL********************************HIQDQ*******************************************YSDWIHEGVNLEPPKRVRRHTKVKPIQVSLPKQLIPEEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLE*************SLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISQYPAYAYVVEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQN*************************************KLKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRWNSH***********************RKIRRTLVESDDEVLSRKRRGKSTYENDFDFNPAGE*****************************************VDIDNFDPEQPGPSTSYAEPVASTSRGRF********************************PAKKLKVLYPK**********************DPLSLH***************KRTT********************************************************
LTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQN*************************************KLKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRWNSHKNKE***************************************************PAGETKTKAEKFLMSAMETERLTRLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSAATEGTSPSGTAPTAQNKNFVKRLPLSQHKIVVERINAFAEIESEEFIKESKKLFDSSTTTQPLVVKKE********************************************************************WIHEGV*LEPP***********************EVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKEA**PGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISQYPAYAYVVEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQ***************************************LKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRWNSHKNK********************************************************************************************************************************************************************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQNYETSSSEEEEEEDSKSRQRRVRPTAVTRAQREAMNQKKLKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRWNSHKNKENKKDSKRGEKKxxxxxxxxxxxxxxxxxxxxxVLSRKRRGKSTYENDFDFNPAGETKTKAEKFLMSAMETERLTRLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGSERNGERPVEVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSAATEGTSPSGTAPTAQNKNFVKRLPLSQHKIVVERINAFAEIESEEFIKESKKLFDSSTTTQPLVVKKEKKKKVVRQARTRAEYSEHIQDQYEDPDNLSLSGSEESASDSDQSQVDVSDLCESSSSSGGTSSSDYSDWIHEGVNLEPPKRVRRHTKVKPIQVSLPKQLIPEEVPDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDAWWWGTIEGKPSPTKSPFLGYKILWDNNERENLSPWDLEPPKEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISQYPAYAYVVEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQNYETSSSEEEEEEDSKSRQRRVRPTAVTRAQREAMNQKKLKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLTVRWNSHKNKENKKDSKRGEKKxxxxxxxxxxxxxxxxxxxxxVLSRKRRGKSTYENDFDFNPAGETKTKAESGNEQVEEVKTRVRRRSSNRSRSNSQDNEENDEEDVDIDNFDPEQPGPSTSYAEPVASTSRGRFAGRAAKRKFKEESASESQEDENSIPETDTTEQPAKKLKVLYPKRRGQQSEDGSGDNASEMSELKQDPLSLHDENEDEDNTNEMGKRKRTTRLVKSNEPEDEEDDDDESDEDYSPSTHAVTKRKRSVRVEKSNEVDEDEESDEDYKP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1915 2.2.26 [Sep-21-2011]
Q921C3 2304 Bromodomain and WD repeat yes N/A 0.698 0.580 0.383 0.0
A2AHJ4 1799 Bromodomain and WD repeat no N/A 0.324 0.345 0.469 1e-168
Q6RI45 1802 Bromodomain and WD repeat yes N/A 0.324 0.344 0.466 1e-167
Q9NSI6 2320 Bromodomain and WD repeat no N/A 0.322 0.265 0.465 1e-166
Q8WWQ0 1821 PH-interacting protein OS no N/A 0.419 0.440 0.399 1e-161
Q8VDD9 1821 PH-interacting protein OS no N/A 0.334 0.352 0.458 1e-161
Q54MP8 2200 Bromodomain and WD repeat yes N/A 0.228 0.199 0.290 2e-51
Q008081356 Vegetative incompatibilit yes N/A 0.160 0.226 0.284 2e-22
Q8YTC21258 Uncharacterized WD repeat no N/A 0.181 0.276 0.240 7e-21
Q8YV571683 Uncharacterized WD repeat no N/A 0.163 0.185 0.248 1e-19
>sp|Q921C3|BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 Back     alignment and function desciption
 Score =  996 bits (2576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/1495 (38%), Positives = 834/1495 (55%), Gaps = 158/1495 (10%)

Query: 305  LDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNV 364
            ++ EL  LI +YL  GPC  AA+VL   +E   LLP+R DWEG  H+++  E+  S+ +V
Sbjct: 14   IESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHV 73

Query: 365  TASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQH 424
                L +ICQR+GP+LDKE+ P+   + SLL  G QSLLR+ K    +V     + A   
Sbjct: 74   APDHLLQICQRIGPMLDKEVPPSISRVTSLLGAGRQSLLRTAKDCRHTVWKGSAFAALHR 133

Query: 425  GTSLLVP-NSVKVHNTVNVLRSREYSGPLSRSLMISSHKYSNLRQHYVNLGHLSAVFCVL 483
            G    +P N     + V + R R+ +G  + S       Y +++ H   LGHLSAV+CV 
Sbjct: 134  GRPPEMPVNYGPPPSLVEIHRGRQLTGCSTFSTAFPGTMYQHIKMHRRILGHLSAVYCVA 193

Query: 484  FDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIR 543
            FD+ G  I TG+DD L+K+W   +G+LL+TLRG S EISD+A++  N L+AAG+ DK IR
Sbjct: 194  FDRTGHRIFTGSDDCLVKIWSTHNGRLLSTLRGHSAEISDMAVNYENTLIAAGSCDKIIR 253

Query: 544  IWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTV 603
            +W L+T AP++VL GH G IT + F P+      Y+ ST  DG + FW++ L+   S   
Sbjct: 254  VWCLRTCAPVAVLQGHTGSITSLQFSPMAKGPQRYMVSTGADGTVCFWQWDLE---SLKF 310

Query: 604  FHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHS 663
               P+ F E+ RPG   +LCSSFS GG+FLATGS DH +R+Y + G D+P  I E+E H+
Sbjct: 311  SPRPLKFTEKPRPG-VQMLCSSFSVGGMFLATGSTDHVIRMYFL-GFDAPEKIAELESHT 368

Query: 664  DKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKKIK 723
            DKVDSIQ+ ++  RF+SGSRDGTA IW ++  +WR I LDM+  +     + +E   K K
Sbjct: 369  DKVDSIQFCNNGDRFLSGSRDGTARIWRFEQLEWRSILLDMSARISGDTSSEEERFMKPK 428

Query: 724  VTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSA 783
            VTM+AW+  D  V+TA+N +  +K+W ++ G L+  L GH +EVFVLE+HPFDSR++LSA
Sbjct: 429  VTMIAWNQDDSTVVTAVN-DHVLKVWSSYTGQLLHNLLGHADEVFVLETHPFDSRIMLSA 487

Query: 784  GHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGL 843
            GHDG I IWDI  +K    K + N++EGQG GA+FD K+S DG   A TDS+GHLL++G 
Sbjct: 488  GHDGSIFIWDI--TKGIKMKHYFNMIEGQGHGAVFDCKFSQDGQHFACTDSHGHLLIFGF 545

Query: 844  GGFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPE 903
            G  K  + IP ++FFHTDYR L R +  +    DE T   PHLMPPPFLVD++G P+P +
Sbjct: 546  GCSKPYEKIPDQMFFHTDYRPLIRDSNNY--VLDEQTQQAPHLMPPPFLVDVDGNPHPTK 603

Query: 904  VQRLVPGRENA--------------DDTELLPDIT---TNDDGHVE----IVEG------ 936
             QRLVPGREN+               D E++  I    TND G       +++G      
Sbjct: 604  FQRLVPGRENSADEHLVPQLGYVATSDGEVIEQIISLHTNDSGDASPESSVLDGMIRQLQ 663

Query: 937  ------------SERNGERPVEVEGQRHYNDHGHVYIQTSHVHVLRSRANGESSAATEGT 984
                           NG    E   +R       + IQ+     LR     E        
Sbjct: 664  QQQDQRLGVDQDGTANGLPSGEGTPRRGSFRRLSLDIQSPPNIGLRRSGQVEGVRQMHQN 723

Query: 985  SPSGTAPTAQNKNFVKRL-------PLSQHKIVVERINAFAEIESEEFIKESKKLFDSST 1037
            +P     T ++    KR        P    ++   RI    E  +   I   KK F    
Sbjct: 724  APRSQIATERDLQAWKRRVVVPEAPPGMFRRLEDIRIERGEEERNLYVIGRKKKTFQVPQ 783

Query: 1038 TTQPLVVKKEKKKKVVRQARTRAEYSEHIQDQYEDPDNLSLSGSEESASDSDQSQVDVSD 1097
             +  +V+  + +++  R  R  A YS    DQ E    LS SG+E S S   ++  D S+
Sbjct: 784  KSNSMVLVSQSRQRTCR--RKYANYSRRNADQCE----LS-SGNESSGSVRHETSYDQSE 836

Query: 1098 LCESSSSSGGTSSSDYSDWIHE------------------------GVNLEPP------K 1127
                     G+ SS+  +W ++                        G+NL+PP      +
Sbjct: 837  ---------GSCSSEDDEWRNDRRSGSDSDSSSDSSSQYSDWTADTGINLQPPLRMSCRR 887

Query: 1128 RVRRHTKVKPIQVSLP----------------------KQLIPEEVPDI-----YKPSDW 1160
            RV R       ++S+                       +++ P E+ ++     + P  W
Sbjct: 888  RVTRFCSTSEDEMSMENISPPKRRRKRRKESKPKRESLRRMTPAELANMEHLYEFHPPVW 947

Query: 1161 LAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELV 1220
            + +   +K+P+ PQMGDEVM+F+QG++ Y++AVR   IYEL+  +  PW  + L++ ELV
Sbjct: 948  ITDTTLRKSPFVPQMGDEVMYFRQGHEAYIEAVRRNNIYELNPHKE-PWRKMDLRDQELV 1006

Query: 1221 KVVGIKYEIAPPRMCCLKLAVMKP-NGKLTNEFFNIKYHDMPDVIDFFVLRQIYETAIAR 1279
            K+VG++YE+ PP +CCLKLA + P  G+LT++ F+I+YHDMPDVIDF VLRQ Y+ A  R
Sbjct: 1007 KIVGLRYEVGPPTLCCLKLAFIDPATGRLTDKSFSIRYHDMPDVIDFLVLRQFYDEARQR 1066

Query: 1280 EWNVGDRFCSMIDDAWWWGTIEGK----PSPTKSPFLGYKILWDNNERENLSPWDLEP-P 1334
             W   DRF S+IDDAWW+GT+  +    P    S F  Y + WDN E E LSPWD+EP P
Sbjct: 1067 NWQPCDRFRSIIDDAWWFGTVLSQEPYQPQYPDSHFQCYIVRWDNTETEKLSPWDMEPIP 1126

Query: 1335 KEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPF 1394
                   E G S+ V  +E+++LLY P+  EW Q  RD  C++II+G+++++ L +A  F
Sbjct: 1127 DNVDPPEELGASISVTSDELEKLLYKPQEGEWGQRSRDEECDRIISGIDQLLNLDIAAAF 1186

Query: 1395 LVPVDISQYPAYAYVVEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSN 1454
              PVD+  YP Y  VV YP DL T+R R  NRFYRR+++  ++VRY+  NA  FNEP S 
Sbjct: 1187 AGPVDLCTYPKYCTVVAYPTDLYTIRMRLVNRFYRRLSALIWEVRYIEHNARTFNEPESV 1246

Query: 1455 IVKYARIITDLLLRIIKEPNPVDVPVVYHELLQNYETSSSEEEEEEDSKSRQRRVRPTAV 1514
            I + A+ ITD LL+ IK  +  ++           E  ++ + +E+DS            
Sbjct: 1247 IARSAKKITDQLLKFIKNQDCTNI----------SELCNTSDNDEDDSADDLDDSDLPKT 1296

Query: 1515 TRAQREAMNQKKLKRP-----FNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIV 1569
            +  +R+  N K+  R       +W+ +C+ +L  ++ C DSEPFR+PVD  ++PDY  I+
Sbjct: 1297 SSGRRKVHNWKRRSRASGCIESDWRRQCKALLILIFQCEDSEPFRQPVDLDEYPDYRDII 1356

Query: 1570 IAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEH 1629
              PMD GT+RE L   NY+SP++F KD++ +F N++ Y  NKRSKIY MT RLS   EE 
Sbjct: 1357 DTPMDFGTVRETLEAGNYDSPVEFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEK 1416

Query: 1630 LRRLTVRWN-SHKNKENKKDSKRGEKKIKR-----MKRRRRKIRRTLVESDDEVL 1678
            +++++  +    K KE  + S+R +++          RRRR +++   +S  +V+
Sbjct: 1417 MKKISFDFKIGQKFKEKLRRSQRFKQRQNCNGAVPGDRRRRNVKQKQFKSQTKVI 1471




May be a transcriptional activator. May be involved in chromatin remodeling. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape.
Mus musculus (taxid: 10090)
>sp|A2AHJ4|BRWD3_MOUSE Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=2 SV=1 Back     alignment and function description
>sp|Q6RI45|BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 Back     alignment and function description
>sp|Q9NSI6|BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 Back     alignment and function description
>sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 Back     alignment and function description
>sp|Q8VDD9|PHIP_MOUSE PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 Back     alignment and function description
>sp|Q54MP8|Y5837_DICDI Bromodomain and WD repeat-containing DDB_G0285837 OS=Dictyostelium discoideum GN=DDB_G0285837 PE=4 SV=1 Back     alignment and function description
>sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=4 SV=1 Back     alignment and function description
>sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=4 SV=1 Back     alignment and function description
>sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1915
3287924221754 PREDICTED: PH-interacting protein [Apis 0.701 0.766 0.482 0.0
3800221501755 PREDICTED: PH-interacting protein-like [ 0.704 0.769 0.481 0.0
3407091561756 PREDICTED: PH-interacting protein-like [ 0.713 0.778 0.479 0.0
3504130901760 PREDICTED: PH-interacting protein-like [ 0.704 0.767 0.482 0.0
3838624271759 PREDICTED: PH-interacting protein-like [ 0.697 0.759 0.484 0.0
3072146741777 Bromodomain and WD repeat-containing pro 0.688 0.741 0.482 0.0
3071665421794 Bromodomain and WD repeat-containing pro 0.690 0.737 0.481 0.0
3320237281807 PH-interacting protein [Acromyrmex echin 0.672 0.712 0.477 0.0
3454811141881 PREDICTED: bromodomain and WD repeat-con 0.673 0.685 0.465 0.0
2420191031552 WD repeat domain-containing protein, put 0.682 0.842 0.470 0.0
>gi|328792422|ref|XP_395863.4| PREDICTED: PH-interacting protein [Apis mellifera] Back     alignment and taxonomy information
 Score = 1337 bits (3460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/1422 (48%), Positives = 942/1422 (66%), Gaps = 78/1422 (5%)

Query: 303  TRLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHP 362
            T +  EL  LI K+L  GPC EAA VL   +E   +LP+R DWEG  H+QT  E+   + 
Sbjct: 10   TVIAPELYFLIAKFLAAGPCREAADVLKRELERAKVLPQRLDWEGHIHNQTFEELEKKYS 69

Query: 363  NVTASFLPKICQRLGPLLDKELKPNFPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIAR 422
            ++ ++ L +IC R+GP+L+KE+ P   G  SLL  G QSLLR+ + + + V +   Y  R
Sbjct: 70   HIGSNHLLQICARIGPVLEKEVPPCISGAISLLGAGRQSLLRTHEDVQRQVHTITSYSGR 129

Query: 423  QHGTSLL-VPNSVKVHNTVNVLRSREYSGPLSRSLMISSHKYSNLRQHYVNLGHLSAVFC 481
              G   L  P S+ V N V+VL+ RE SGPLSR   I +  Y+ ++ +   LGHLSAV+C
Sbjct: 130  LGGKPFLDSPYSLLVPNIVHVLQGRENSGPLSRREAIPTKFYNKMQLYRHTLGHLSAVYC 189

Query: 482  VLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKT 541
            VLFD+ G+ I+TGADDLL+K+W + DG+LLAT RG S EI DIA++  N LLAAG++D+ 
Sbjct: 190  VLFDRTGKYIITGADDLLVKVWSSIDGRLLATFRGASAEIMDIAVNFDNTLLAAGSLDRI 249

Query: 542  IRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISK 601
            +R+W  QT++P++VL GH G+IT VNFCP+  NG  YL STSTDG + FW +    +   
Sbjct: 250  LRVWCFQTMSPVAVLSGHSGMITSVNFCPISCNGVYYLVSTSTDGSVAFWSHTKKGNERA 309

Query: 602  TVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEE 661
                +P+ ++E++RPG A ++C+SFSPGG F+A GS DHHVRVY M G + P  +LEVE 
Sbjct: 310  IFQPKPIQYHEKMRPGQAQMICASFSPGGAFMAAGSADHHVRVYSMLGDEGPCRVLEVEA 369

Query: 662  HSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKK 721
            HSD VDSIQW+H+ L+F+SGS+DGTA +W+++  QW + RL M T LP   ET D++NKK
Sbjct: 370  HSDTVDSIQWAHNGLKFISGSKDGTANVWHFEQQQWMYKRLLMTTKLPGESETEDDSNKK 429

Query: 722  IKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLL 781
             KVTMV+WD SD WVITA+N +  +K+W+A +G+LV++L+GH +EVFVLESHP D RV+L
Sbjct: 430  AKVTMVSWDVSDEWVITAVN-DSCLKVWNAKSGELVKILRGHKDEVFVLESHPIDPRVIL 488

Query: 782  SAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVY 841
            SAGHDG +IIWD+L+++      F N +EGQG GA+FD KWSPDGT  A TDS+GHLL+Y
Sbjct: 489  SAGHDGQLIIWDVLNTEP--IACFQNFIEGQGNGAVFDAKWSPDGTMLAATDSHGHLLIY 546

Query: 842  GLG-GFKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPY 900
            G G G ++ + +P+ELFFHTDYR L R    +    DE T   PHLMPPPFLVD++G PY
Sbjct: 547  GFGSGVEKLKIVPKELFFHTDYRPLIRDANNY--VLDEQTQTAPHLMPPPFLVDVDGNPY 604

Query: 901  PPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEG-----SERNGERPVEVEGQRH--- 952
            PP +QRLVPGREN    +L+P+I     G  E++EG        N ++ +E   QR    
Sbjct: 605  PPALQRLVPGRENCRGEQLVPNIAVGAGGMQEVIEGLPAQEPRSNIDQLIEALAQRQNIN 664

Query: 953  -----YNDHGHVYIQTSHVHVLRS----RANGESSAATEGTSPSGTA-----PTAQNKNF 998
                   D          V  + S    R+    +   EG   S         T  NK  
Sbjct: 665  ADAESAADEREENAAEQPVRQMASPRGSRSGLRRAGDVEGVRQSSGNWQRDNTTPWNKPI 724

Query: 999  VKR-LPLSQHKIVVERINAFAEIESEEFIKESKKL---FDSSTTTQPLV---VKKEKKKK 1051
            + R +  +  +  ++ ++A AE+E E   +E +K      ++  T+  +   +   K+ +
Sbjct: 725  LARPMNPAVRETQIKVLHATAEMELENLKREMRKRPQPVSNTANTEDNIGSRIANRKRNR 784

Query: 1052 VVRQA-RTRAEYSEHIQDQ-YEDPDNLSLSGSEESASDSDQSQVDVSDLCESSSSSGGTS 1109
              R   RTRA   E  +D  +E+PDN+  +GS  S++ +D +  +  DLC  SS+S   S
Sbjct: 785  TTRHGYRTRATRGEEQEDDDFENPDNVGTTGSSASSNSNDSTAHE-EDLCSDSSTS--ES 841

Query: 1110 SSDYSDWIHE-GVNLEPPKRVRRHTKVKPIQVSLPKQL------------IP-----EEV 1151
            S++YSDWI + G+NLEPPKR +R   VK   ++ P  +            IP     +++
Sbjct: 842  STEYSDWIADHGLNLEPPKRSKRK-PVKKRSLTPPSDMDRRRNRRPRKKDIPLSTGIDDI 900

Query: 1152 PDIYKPSDWLAEVVPKKAPYYPQMGDEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGN 1211
            PD+++PS+WL E++P+KAPYYPQMGDE+++F+QG+Q Y+DAVR+K +YEL   R  PW  
Sbjct: 901  PDVFRPSEWLTEIIPRKAPYYPQMGDEIVYFRQGHQFYLDAVRNKKVYELGP-RCEPWNK 959

Query: 1212 LILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIKYHDMPDVIDFFVLRQ 1271
            + ++  E VKVVGIKYEI PPR+CCLKLA+M  +G+LT E F IKYHDM DV+DF VLRQ
Sbjct: 960  VNIRAQEFVKVVGIKYEIRPPRLCCLKLALMDEDGRLTGENFTIKYHDMADVLDFLVLRQ 1019

Query: 1272 IYETAIAREWNVGDRFCSMIDDAWWWGTIEG-KPSPTKSP---FLGYKILWDNNERENLS 1327
             ++TA+AR W+ GDRF  MIDD WW G I+  +P     P   F+ +++ WDN E E +S
Sbjct: 1020 TFDTALARSWSEGDRFRCMIDDGWWMGQIQSMEPLDEDFPESFFMCFRVRWDNGEYERMS 1079

Query: 1328 PWDLEPPKEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMG 1387
            PWDLEP  E +   E GG++PV PEEI+ +LY P  +EWP GDR+ATC +II GL++VM 
Sbjct: 1080 PWDLEPIDENRLPAELGGAVPVLPEEIRTILYQPHAEEWPMGDREATCRRIIRGLDQVMS 1139

Query: 1388 LSVAEPFLVPVDISQYPAYAYVVEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANAEK 1447
            L++AEPF+ PVD++ YPAYA+VVEYP+DLTT++ARF+N FYRRITSAQFDVRYLA NAE+
Sbjct: 1140 LAIAEPFMAPVDLNAYPAYAFVVEYPIDLTTIKARFENNFYRRITSAQFDVRYLATNAEQ 1199

Query: 1448 FNEPHSNIVKYARIITDLLLRIIKEPNPVDVPVVYHELLQNYETSSSEEEEEEDSKSRQR 1507
            FNEPHS IVK+ARI+TDL LRIIKE   +DVP +YH+L+  Y +S S E + ED+K+   
Sbjct: 1200 FNEPHSQIVKHARIVTDLCLRIIKETTEIDVPALYHQLVDTYHSSES-EVDVEDTKN--- 1255

Query: 1508 RVRPTAVTRAQREAMNQKKLKRPFNWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDK 1567
              RP+  T+    + N +  +   +WK  CR++LETLW C DS PFR+PVD+L+HPDY +
Sbjct: 1256 --RPSTSTQRATSSRNLRSPEVSNDWKVACRQLLETLWQCEDSIPFREPVDRLEHPDYHQ 1313

Query: 1568 IVIAPMDLGTIREELRGDNYESPIDFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAE 1627
            I+  PMDL T++E+L G NYE+P++F KD++ +F NSRNYN NKRS+IY MT RLS   E
Sbjct: 1314 IIDTPMDLRTVKEDLLGGNYETPLEFAKDMRLIFTNSRNYNTNKRSRIYSMTIRLSAMFE 1373

Query: 1628 EHLRRLTVRWNSHKNKENKKDSKRGEKKIKRMKRRRRKIRRT 1669
            EH+R++   W S + + N   + +G       K RR K+R T
Sbjct: 1374 EHMRKIISNWKSARRRNNNTKNTKG-------KGRRGKVRLT 1408




Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|380022150|ref|XP_003694916.1| PREDICTED: PH-interacting protein-like [Apis florea] Back     alignment and taxonomy information
>gi|340709156|ref|XP_003393179.1| PREDICTED: PH-interacting protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350413090|ref|XP_003489876.1| PREDICTED: PH-interacting protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383862427|ref|XP_003706685.1| PREDICTED: PH-interacting protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307214674|gb|EFN89603.1| Bromodomain and WD repeat-containing protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307166542|gb|EFN60609.1| Bromodomain and WD repeat-containing protein 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332023728|gb|EGI63952.1| PH-interacting protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345481114|ref|XP_001606427.2| PREDICTED: bromodomain and WD repeat-containing protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242019103|ref|XP_002430005.1| WD repeat domain-containing protein, putative [Pediculus humanus corporis] gi|212515063|gb|EEB17267.1| WD repeat domain-containing protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1915
FB|FBgn0011785 2232 BRWD3 "BRWD3" [Drosophila mela 0.322 0.276 0.485 2.4e-302
UNIPROTKB|Q6RI45 1802 BRWD3 "Bromodomain and WD repe 0.330 0.351 0.454 1.2e-270
MGI|MGI:3029414 1799 Brwd3 "bromodomain and WD repe 0.331 0.352 0.455 1.7e-268
UNIPROTKB|E1BSG1 2293 BRWD1 "Uncharacterized protein 0.325 0.272 0.451 2.4e-259
MGI|MGI:1932404 1821 Phip "pleckstrin homology doma 0.351 0.370 0.438 2.2e-258
UNIPROTKB|F1MTQ0 2322 BRWD1 "Uncharacterized protein 0.330 0.272 0.447 2.3e-258
MGI|MGI:1890651 2304 Brwd1 "bromodomain and WD repe 0.323 0.268 0.451 1.1e-257
UNIPROTKB|Q9NSI6 2320 BRWD1 "Bromodomain and WD repe 0.330 0.272 0.445 2.6e-257
RGD|1309030 2303 Brwd1 "bromodomain and WD repe 0.323 0.268 0.446 1.3e-256
ZFIN|ZDB-GENE-050208-261 1805 phip "pleckstrin homology doma 0.350 0.371 0.444 3e-255
FB|FBgn0011785 BRWD3 "BRWD3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1525 (541.9 bits), Expect = 2.4e-302, Sum P(4) = 2.4e-302
 Identities = 310/638 (48%), Positives = 415/638 (65%)

Query:   305 LDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERYDWEGATHSQTLAEVASSHPNV 364
             L  EL  LI K+L  GP  E AKVL   +E K +LP R DW+G  H QT  E+   + ++
Sbjct:    12 LKPELYFLISKFLAAGPLEETAKVLIRELEEKKVLPRRLDWQGNEHEQTFEELERKYKHI 71

Query:   365 TASFLPKICQRLGPLLDKELKPNFPXXXXXXXXXXXXXXXXEKSLAKSVLSSYDYIARQH 424
              A+ L +IC RLGPL+D+EL P+ P                ++++     S  DY  R +
Sbjct:    72 GANHLLEICSRLGPLVDRELPPSVPGINSLLGTGRQNLLRTKETVYCH-RSLRDYCTRLN 130

Query:   425 GTSLLVPNSV---KVHNTVNVLRSREYSGPLSRSLMISSHKYSNLRQHYVNLGHLSAVFC 481
             G SL  P+SV     HN   VL  RE+ G + R L++ +  Y   +     +GHLS+V+C
Sbjct:   131 GVSL--PDSVLTKPTHNLDRVLTGREHGGEVRRKLLVPTDLYRRTKLLRRTVGHLSSVYC 188

Query:   482 VLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKT 541
             VLFD+ G  I+TGADDLLIK+W A DG+LLATLRG S EI+DIAI+  N +LAAG++D  
Sbjct:   189 VLFDRTGRYIITGADDLLIKIWSAADGRLLATLRGASSEITDIAINLDNTMLAAGSLDHI 248

Query:   542 IRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISK 601
             +R+W++QT +PI+VL  H G+IT VNFCP   +   YL +TSTDG I FW+Y        
Sbjct:   249 LRVWDMQTTSPIAVLSAHTGMITSVNFCPSPRSDLKYLVTTSTDGSIAFWQYSTPRGQKI 308

Query:   602 TVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEE 661
             T   +P  ++E++RPG A ++C++FSPGG+FLA GS DHHVRVY M G D P  ILE E 
Sbjct:   309 TFAPKPTQYHEKLRPGQAQMMCTTFSPGGIFLAAGSADHHVRVYMM-GEDGPKRILETEA 367

Query:   662 HSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKETSDETNKK 721
             ++D VDS+QWSH  LRF+SGS+DGTA IW ++  QW+  +L M   L    E   E  K+
Sbjct:   368 YTDAVDSVQWSHRGLRFISGSKDGTAHIWTFESQQWKSSKLCMTERLASCPEP--EEGKR 425

Query:   722 IKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLL 781
             +KVTMVAWDASDR+VITA+N +F IKIWD+ +  L +VL+GH +E++VLES+P D  VLL
Sbjct:   426 LKVTMVAWDASDRYVITAVN-DFTIKIWDSKSAKLHRVLRGHKDELYVLESNPRDEHVLL 484

Query:   782 SAGHDGLIIIWDILSSKQRGY--KWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLL 839
             SAGHDG + +WDI    ++G     F N ++GQG G++FD KWSPDGT  A TDS+GH+L
Sbjct:   485 SAGHDGQVFLWDI----EQGVCVANFLNDIDGQGHGSVFDAKWSPDGTMIAATDSHGHIL 540

Query:   840 VYGLGG-FKRPQNIPRELFFHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGT 898
             ++GLG   ++ + +P ELFFHTD+R L R         DE T + PHLMPPPFLVD +G 
Sbjct:   541 IFGLGVCIEKYKMLPTELFFHTDFRPLLRDAQ--HHVVDEQTQIMPHLMPPPFLVDADGN 598

Query:   899 PYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEG 936
             P+P   QR VPGRE+    +L+P++T   DG V I +G
Sbjct:   599 PHPSRFQRFVPGRESCSLDQLIPNLTVGVDG-VVIDDG 635


GO:0046427 "positive regulation of JAK-STAT cascade" evidence=IGI
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
UNIPROTKB|Q6RI45 BRWD3 "Bromodomain and WD repeat-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:3029414 Brwd3 "bromodomain and WD repeat domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSG1 BRWD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1932404 Phip "pleckstrin homology domain interacting protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTQ0 BRWD1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1890651 Brwd1 "bromodomain and WD repeat domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NSI6 BRWD1 "Bromodomain and WD repeat-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309030 Brwd1 "bromodomain and WD repeat domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-261 phip "pleckstrin homology domain interacting protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1915
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-51
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 5e-43
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 5e-43
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 7e-39
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 9e-36
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 3e-34
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-29
cd0436999 cd04369, Bromodomain, Bromodomain 2e-22
cd0436999 cd04369, Bromodomain, Bromodomain 2e-22
smart00297107 smart00297, BROMO, bromo domain 3e-22
smart00297107 smart00297, BROMO, bromo domain 3e-22
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 3e-21
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 3e-21
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 2e-18
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-18
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 1e-17
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 1e-17
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-17
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 2e-17
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 2e-17
pfam0043984 pfam00439, Bromodomain, Bromodomain 2e-16
pfam0043984 pfam00439, Bromodomain, Bromodomain 2e-16
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 2e-15
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 2e-15
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 1e-14
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 1e-14
pfam0043984 pfam00439, Bromodomain, Bromodomain 5e-14
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 1e-13
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 1e-13
smart00297107 smart00297, BROMO, bromo domain 2e-13
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 2e-13
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 2e-13
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 2e-13
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 2e-13
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 4e-13
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 4e-13
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 4e-12
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 4e-12
cd0436999 cd04369, Bromodomain, Bromodomain 5e-12
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 5e-11
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 5e-11
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 1e-10
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 1e-10
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 1e-10
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 1e-10
COG5076371 COG5076, COG5076, Transcription factor involved in 2e-10
COG5076371 COG5076, COG5076, Transcription factor involved in 2e-10
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 5e-10
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 5e-10
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 4e-09
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 4e-09
COG5076371 COG5076, COG5076, Transcription factor involved in 5e-09
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 9e-09
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 9e-09
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 2e-08
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 3e-08
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 6e-08
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 1e-07
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 1e-07
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 4e-07
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 8e-07
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 2e-06
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 2e-06
smart0032040 smart00320, WD40, WD40 repeats 2e-06
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 3e-06
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 3e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 4e-06
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 8e-06
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 8e-06
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 9e-06
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 9e-06
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 9e-06
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 9e-06
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 1e-05
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 1e-05
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-05
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 2e-05
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 2e-05
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 2e-05
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 3e-05
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 3e-05
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 3e-05
smart0032040 smart00320, WD40, WD40 repeats 3e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 3e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 5e-05
smart0032040 smart00320, WD40, WD40 repeats 9e-05
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 1e-04
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 1e-04
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 1e-04
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 1e-04
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 1e-04
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 2e-04
PLN032371465 PLN03237, PLN03237, DNA topoisomerase 2; Provision 2e-04
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 3e-04
pfam09184285 pfam09184, PPP4R2, PPP4R2 3e-04
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 4e-04
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 4e-04
COG5076371 COG5076, COG5076, Transcription factor involved in 5e-04
smart0032040 smart00320, WD40, WD40 repeats 5e-04
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 5e-04
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 5e-04
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 5e-04
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 5e-04
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 5e-04
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 5e-04
pfam0043984 pfam00439, Bromodomain, Bromodomain 8e-04
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 8e-04
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 8e-04
smart00297107 smart00297, BROMO, bromo domain 9e-04
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 0.001
cd05491119 cd05491, Bromo_TBP7_like, Bromodomain; TBP7_like s 0.002
cd05491119 cd05491, Bromo_TBP7_like, Bromodomain; TBP7_like s 0.002
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.003
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.003
smart0032040 smart00320, WD40, WD40 repeats 0.004
smart0032040 smart00320, WD40, WD40 repeats 0.004
COG5296 521 COG5296, COG5296, Transcription factor involved in 0.004
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  181 bits (462), Expect = 7e-51
 Identities = 95/320 (29%), Positives = 148/320 (46%), Gaps = 37/320 (11%)

Query: 474 GHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILL 533
           GH   V CV F   G+++ TG+ D  IK+W    G+LL TL+G +G + D+A       L
Sbjct: 7   GHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYL 66

Query: 534 AAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKY 593
           A+G+ DKTIR+W+L+T   +  L GH   ++ V F P        L+S+S D  I  W  
Sbjct: 67  ASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDG----RILSSSSRDKTIKVW-- 120

Query: 594 KLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSP 653
             D++  K +          +R     +   +FSP G F+A+ S D  ++++ +      
Sbjct: 121 --DVETGKCLT--------TLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDLRT-GKC 169

Query: 654 LGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKE 713
           +  L    H+ +V+S+ +S    + +S S DGT  +W     +       + T   H   
Sbjct: 170 VATL--TGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKC------LGTLRGHENG 221

Query: 714 TSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESH 773
                     V  VA+      + +  + +  I++WD   G+ VQ L GHTN V  L   
Sbjct: 222 ----------VNSVAFSPDGYLLASG-SEDGTIRVWDLRTGECVQTLSGHTNSVTSLAWS 270

Query: 774 PFDSRVLLSAGHDGLIIIWD 793
           P D + L S   DG I IWD
Sbjct: 271 P-DGKRLASGSADGTIRIWD 289


Length = 289

>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|220135 pfam09184, PPP4R2, PPP4R2 Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99923 cd05491, Bromo_TBP7_like, Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>gnl|CDD|99923 cd05491, Bromo_TBP7_like, Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|227615 COG5296, COG5296, Transcription factor involved in TATA site selection and in elongation by RNA polymerase II [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1915
KOG0644|consensus1113 100.0
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0273|consensus524 100.0
KOG0286|consensus343 100.0
KOG0291|consensus893 100.0
KOG0272|consensus459 100.0
KOG0319|consensus775 100.0
KOG0319|consensus775 100.0
KOG0318|consensus603 100.0
KOG0279|consensus315 100.0
KOG0318|consensus603 100.0
KOG0306|consensus888 100.0
KOG0315|consensus311 100.0
KOG0291|consensus893 100.0
KOG0286|consensus343 100.0
KOG0295|consensus406 100.0
KOG0285|consensus460 100.0
KOG0265|consensus338 100.0
KOG0279|consensus315 100.0
KOG0296|consensus399 100.0
KOG0293|consensus519 100.0
KOG0645|consensus312 100.0
KOG0315|consensus311 100.0
KOG0282|consensus503 99.98
KOG0306|consensus888 99.98
KOG0281|consensus499 99.98
KOG0263|consensus707 99.98
KOG0273|consensus524 99.97
KOG0296|consensus399 99.97
KOG0284|consensus464 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0284|consensus464 99.97
KOG0276|consensus794 99.97
KOG0292|consensus1202 99.97
KOG0295|consensus406 99.97
KOG0645|consensus312 99.97
KOG0263|consensus707 99.97
KOG0266|consensus456 99.97
PLN00181793 protein SPA1-RELATED; Provisional 99.97
KOG0281|consensus499 99.97
KOG0316|consensus307 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0276|consensus794 99.97
KOG0282|consensus503 99.97
KOG0292|consensus1202 99.97
KOG1474|consensus640 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG0275|consensus508 99.96
KOG0293|consensus519 99.96
KOG0266|consensus456 99.96
KOG0643|consensus327 99.96
KOG1408|consensus1080 99.96
KOG0265|consensus338 99.96
KOG1474|consensus640 99.96
KOG0313|consensus423 99.96
KOG0640|consensus430 99.96
KOG0278|consensus334 99.96
KOG0288|consensus459 99.95
KOG1539|consensus910 99.95
KOG0772|consensus641 99.95
KOG0313|consensus423 99.95
KOG0285|consensus460 99.95
KOG0643|consensus327 99.95
KOG1539|consensus910 99.95
KOG0278|consensus334 99.95
KOG0274|consensus537 99.95
KOG1446|consensus311 99.95
KOG1407|consensus313 99.95
KOG1407|consensus313 99.94
KOG0289|consensus506 99.94
KOG0283|consensus712 99.94
KOG0973|consensus942 99.94
KOG0300|consensus481 99.94
KOG0274|consensus537 99.94
KOG0275|consensus508 99.94
KOG0305|consensus484 99.94
KOG0640|consensus430 99.94
KOG0308|consensus735 99.94
KOG0772|consensus641 99.94
KOG0299|consensus479 99.94
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.94
KOG0268|consensus433 99.94
KOG0277|consensus311 99.93
KOG0641|consensus350 99.93
KOG2106|consensus626 99.93
KOG1446|consensus311 99.93
KOG0647|consensus347 99.93
PTZ00421493 coronin; Provisional 99.93
KOG0310|consensus487 99.93
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.93
KOG1063|consensus764 99.92
KOG0277|consensus311 99.92
KOG0283|consensus712 99.92
KOG2096|consensus420 99.92
KOG0301|consensus745 99.92
KOG0288|consensus459 99.92
KOG2048|consensus691 99.92
KOG0316|consensus307 99.92
KOG0268|consensus433 99.92
KOG1408|consensus1080 99.92
KOG0308|consensus735 99.92
KOG0310|consensus487 99.92
PTZ00420568 coronin; Provisional 99.91
KOG0973|consensus942 99.91
PTZ00421493 coronin; Provisional 99.91
PTZ00420568 coronin; Provisional 99.91
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.91
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.91
KOG2106|consensus626 99.91
KOG0294|consensus362 99.91
KOG1332|consensus299 99.91
KOG1273|consensus405 99.91
KOG2048|consensus691 99.91
KOG0301|consensus745 99.91
KOG0300|consensus481 99.91
KOG1063|consensus764 99.9
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.9
KOG1036|consensus323 99.9
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.9
KOG0294|consensus362 99.9
KOG0641|consensus350 99.9
KOG1036|consensus323 99.9
KOG0305|consensus484 99.9
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.9
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.9
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.9
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.9
KOG0646|consensus476 99.89
KOG4283|consensus397 99.89
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.89
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.89
KOG0289|consensus506 99.89
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.89
KOG0264|consensus422 99.89
KOG1445|consensus1012 99.89
KOG1332|consensus299 99.89
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.89
KOG0299|consensus479 99.88
KOG4283|consensus397 99.88
KOG0646|consensus476 99.88
KOG0269|consensus839 99.88
KOG1274|consensus933 99.88
KOG0639|consensus705 99.88
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.88
KOG2096|consensus420 99.88
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.88
KOG2445|consensus361 99.88
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.88
KOG0321|consensus720 99.88
KOG0647|consensus347 99.88
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.88
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.88
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.87
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.87
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.87
KOG0650|consensus733 99.87
KOG1538|consensus1081 99.87
KOG0264|consensus422 99.87
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.87
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.87
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.87
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.87
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.87
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.87
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.86
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.86
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.86
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.86
KOG2055|consensus514 99.86
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.85
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.85
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.85
KOG2055|consensus514 99.85
KOG0639|consensus705 99.85
KOG0267|consensus825 99.85
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.85
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.85
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.85
KOG1274|consensus933 99.85
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.85
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.84
KOG4328|consensus498 99.84
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.84
KOG4328|consensus498 99.84
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.84
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.84
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.84
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.84
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.84
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.84
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.84
KOG0270|consensus463 99.83
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.83
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.83
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.83
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.83
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.83
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.83
COG2319466 FOG: WD40 repeat [General function prediction only 99.83
KOG4227|consensus609 99.83
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.83
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.83
KOG0269|consensus839 99.83
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.83
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.82
KOG1273|consensus405 99.82
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.82
KOG0321|consensus720 99.82
COG5076371 Transcription factor involved in chromatin remodel 99.82
KOG0302|consensus440 99.82
KOG0267|consensus825 99.82
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.82
KOG2445|consensus361 99.81
COG2319466 FOG: WD40 repeat [General function prediction only 99.81
KOG1034|consensus385 99.81
KOG0322|consensus323 99.8
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.8
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.8
smart00297107 BROMO bromo domain. 99.8
KOG1963|consensus792 99.8
KOG1009|consensus434 99.79
KOG1445|consensus1012 99.79
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.79
KOG0302|consensus440 99.79
KOG0307|consensus1049 99.79
KOG0270|consensus463 99.79
PF0650783 Auxin_resp: Auxin response factor; InterPro: IPR01 99.78
KOG4378|consensus673 99.78
KOG0307|consensus1049 99.78
KOG4378|consensus673 99.78
KOG1963|consensus792 99.78
KOG0650|consensus733 99.77
KOG1472|consensus720 99.76
KOG1034|consensus385 99.76
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.76
smart00297107 BROMO bromo domain. 99.76
KOG1188|consensus376 99.75
KOG1009|consensus434 99.75
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.74
KOG0008|consensus1563 99.74
KOG0642|consensus577 99.74
KOG2919|consensus406 99.74
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.74
KOG1188|consensus376 99.74
KOG0642|consensus577 99.74
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.73
KOG4227|consensus609 99.73
KOG2919|consensus406 99.73
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.72
KOG1587|consensus555 99.71
KOG0322|consensus323 99.71
KOG1538|consensus1081 99.7
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.7
KOG0303|consensus472 99.7
KOG0290|consensus364 99.7
KOG1587|consensus555 99.69
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.69
KOG1517|consensus1387 99.69
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.69
KOG1240|consensus1431 99.68
KOG1832|consensus1516 99.68
KOG1334|consensus559 99.68
KOG1334|consensus559 99.68
KOG1007|consensus370 99.67
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.67
KOG1007|consensus370 99.67
KOG1517|consensus1387 99.67
KOG1310|consensus758 99.66
KOG0649|consensus325 99.66
PRK11028330 6-phosphogluconolactonase; Provisional 99.64
PRK11028330 6-phosphogluconolactonase; Provisional 99.63
KOG4497|consensus447 99.63
KOG0303|consensus472 99.62
KOG1524|consensus737 99.61
KOG1523|consensus361 99.59
KOG0290|consensus364 99.57
KOG1245|consensus1404 99.57
KOG1524|consensus737 99.57
KOG0771|consensus398 99.57
KOG2110|consensus391 99.56
KOG1523|consensus361 99.56
KOG1472|consensus720 99.56
KOG0644|consensus1113 99.54
KOG0649|consensus325 99.54
KOG1310|consensus758 99.54
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.53
KOG2110|consensus391 99.53
KOG0771|consensus398 99.53
KOG4497|consensus447 99.52
PRK01742429 tolB translocation protein TolB; Provisional 99.51
KOG1240|consensus1431 99.51
KOG1272|consensus545 99.51
COG5076371 Transcription factor involved in chromatin remodel 99.5
KOG1245|consensus1404 99.49
KOG2139|consensus445 99.49
KOG1354|consensus433 99.49
KOG2315|consensus566 99.48
KOG0008|consensus1563 99.46
PRK01742429 tolB translocation protein TolB; Provisional 99.45
KOG2394|consensus636 99.43
KOG1828|consensus418 99.43
KOG2321|consensus703 99.42
KOG2139|consensus445 99.4
KOG2321|consensus703 99.39
KOG2111|consensus346 99.38
KOG1272|consensus545 99.38
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.36
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.35
PRK03629429 tolB translocation protein TolB; Provisional 99.35
KOG2111|consensus346 99.34
PRK03629429 tolB translocation protein TolB; Provisional 99.34
KOG1912|consensus1062 99.34
KOG1409|consensus404 99.33
PRK04922433 tolB translocation protein TolB; Provisional 99.32
PRK02889427 tolB translocation protein TolB; Provisional 99.32
KOG3881|consensus412 99.31
PRK04922433 tolB translocation protein TolB; Provisional 99.28
PRK05137435 tolB translocation protein TolB; Provisional 99.28
KOG0974|consensus967 99.27
KOG2394|consensus636 99.26
KOG1354|consensus433 99.26
KOG0974|consensus967 99.25
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.23
KOG1827|consensus629 99.22
PRK02889427 tolB translocation protein TolB; Provisional 99.22
KOG3881|consensus412 99.21
KOG2041|consensus1189 99.2
KOG1409|consensus404 99.2
KOG1827|consensus 629 99.2
PRK05137435 tolB translocation protein TolB; Provisional 99.16
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.15
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.15
KOG1912|consensus1062 99.14
KOG2315|consensus566 99.14
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.13
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.13
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.12
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.11
KOG2314|consensus698 99.11
COG4946668 Uncharacterized protein related to the periplasmic 99.1
KOG4547|consensus541 99.1
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.1
KOG1828|consensus418 99.08
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.08
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.05
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.05
PRK04792448 tolB translocation protein TolB; Provisional 99.04
PRK00178430 tolB translocation protein TolB; Provisional 99.02
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.01
KOG4190|consensus1034 99.0
PRK00178430 tolB translocation protein TolB; Provisional 99.0
KOG0309|consensus1081 99.0
KOG2041|consensus1189 99.0
KOG1064|consensus2439 98.99
KOG4547|consensus541 98.98
KOG1064|consensus2439 98.98
KOG4190|consensus1034 98.97
KOG2314|consensus698 98.96
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 98.96
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.94
PRK01029428 tolB translocation protein TolB; Provisional 98.94
PRK01029428 tolB translocation protein TolB; Provisional 98.94
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.93
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.92
KOG0280|consensus339 98.92
KOG4532|consensus344 98.9
PRK04792448 tolB translocation protein TolB; Provisional 98.88
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.84
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.84
KOG0386|consensus1157 98.82
KOG0955|consensus1051 98.82
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.8
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.79
KOG0386|consensus1157 98.78
KOG0280|consensus339 98.77
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.73
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.73
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.72
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.69
KOG0309|consensus1081 98.68
KOG4714|consensus319 98.65
KOG0882|consensus558 98.65
KOG1645|consensus463 98.63
KOG0955|consensus 1051 98.61
KOG1832|consensus1516 98.57
KOG3914|consensus390 98.57
COG4946668 Uncharacterized protein related to the periplasmic 98.5
KOG4532|consensus344 98.44
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.43
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.42
KOG3914|consensus390 98.4
KOG0882|consensus558 98.39
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.37
KOG1275|consensus1118 98.36
KOG1920|consensus1265 98.33
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.3
PRK04043419 tolB translocation protein TolB; Provisional 98.3
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.29
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.26
KOG4714|consensus319 98.23
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.22
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.21
KOG2114|consensus933 98.21
KOG4649|consensus354 98.19
PRK04043419 tolB translocation protein TolB; Provisional 98.17
KOG2114|consensus933 98.16
KOG1275|consensus1118 98.15
KOG2066|consensus846 98.11
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.1
KOG1920|consensus1265 98.08
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.07
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.06
KOG1645|consensus463 98.06
KOG3617|consensus1416 98.05
KOG2695|consensus425 98.05
KOG2695|consensus425 98.05
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.03
KOG2066|consensus846 98.01
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.0
KOG4649|consensus354 97.99
PRK02888635 nitrous-oxide reductase; Validated 97.97
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.93
KOG3621|consensus726 97.84
KOG1008|consensus783 97.84
KOG3621|consensus726 97.83
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.81
KOG1897|consensus1096 97.8
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.8
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.74
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.73
KOG3617|consensus1416 97.73
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.6
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.58
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.53
PRK02888635 nitrous-oxide reductase; Validated 97.51
KOG1008|consensus783 97.49
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.4
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.38
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.33
KOG1897|consensus1096 97.32
COG3391381 Uncharacterized conserved protein [Function unknow 97.27
KOG2276|consensus473 97.22
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.21
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.19
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.16
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.15
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.15
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.13
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.08
KOG2079|consensus1206 97.07
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.04
KOG2079|consensus1206 97.02
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.0
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.99
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.94
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.93
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 96.92
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.91
COG3391381 Uncharacterized conserved protein [Function unknow 96.9
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.81
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 96.79
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.78
KOG4640|consensus665 96.66
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.55
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.49
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.45
COG5276370 Uncharacterized conserved protein [Function unknow 96.38
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.38
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.35
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.33
KOG3630|consensus1405 96.25
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.13
KOG2444|consensus238 96.03
PF14727418 PHTB1_N: PTHB1 N-terminus 96.03
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.01
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.89
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.89
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.8
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.75
PRK10115686 protease 2; Provisional 95.69
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 95.62
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.5
PRK13616591 lipoprotein LpqB; Provisional 95.4
PHA02713557 hypothetical protein; Provisional 95.37
KOG2444|consensus238 95.34
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.33
PRK13616591 lipoprotein LpqB; Provisional 95.2
KOG2395|consensus644 95.16
KOG2395|consensus644 95.14
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.1
PHA02713557 hypothetical protein; Provisional 95.02
KOG4499|consensus310 95.01
KOG4441|consensus571 94.95
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 94.94
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.79
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 94.78
KOG4640|consensus665 94.74
COG3490366 Uncharacterized protein conserved in bacteria [Fun 94.65
>KOG0644|consensus Back     alignment and domain information
Probab=100.00  E-value=3.6e-121  Score=1091.90  Aligned_cols=1002  Identities=30%  Similarity=0.495  Sum_probs=788.8

Q ss_pred             cccHHHHHHHHHHhccCChHHHHHHHHHHHHhcCcCcccc-cccCccccccHHHHHhcCCCCCCChHHHHHHHhCCCccc
Q psy9598         304 RLDQELMLLIIKYLEKGPCHEAAKVLTDLVEAKNLLPERY-DWEGATHSQTLAEVASSHPNVTASFLPKICQRLGPLLDK  382 (1915)
Q Consensus       304 ~l~~e~~~li~~~L~~~~~~~aa~~L~~e~~~~~llp~r~-~~~g~~~~~~~~~l~~~~~~i~~~~L~~l~~~l~pll~~  382 (1915)
                      ....|++++|+++|..|||.+|+++|+.|++++.|||.|+ +|.++++....+.|+..|+||.++||++||++|++.+++
T Consensus        13 l~lsevyflil~~lS~gPcert~~vl~~elee~~ll~pr~~~W~sn~~~dd~eslvls~~hI~kdhll~i~kqlv~~~d~   92 (1113)
T KOG0644|consen   13 LDLSEVYFLILHYLSAGPCERTAQVLRQELEEYSLLPPRYHDWESNSGNDDGESLVLSYKHIAKDHLLQILKQLVPMLDK   92 (1113)
T ss_pred             cchhhHHHHHHhhcccCchhhcchhhhhhhhhhhccCccccccccCCCCcccceeeccccccchHHHHHHHHHhccCcCC
Confidence            3456999999999999999999999999999998876665 699999999999999999999999999999999999999


Q ss_pred             ccCCC---CCCcceecccCccccccchhhhccccccchhHHHhcCCCcccccC-ccCccchhhcccCccccccCCCeEEE
Q psy9598         383 ELKPN---FPGLKSLLSGGSQSLLRSEKSLAKSVLSSYDYIARQHGTSLLVPN-SVKVHNTVNVLRSREYSGPLSRSLMI  458 (1915)
Q Consensus       383 ~~~~~---~~~~~tll~~g~~sll~~~~~~~~~~~~~~~~~~~~~g~~~~~~~-~~~~~~~v~~l~~r~~tg~~d~~~~i  458 (1915)
                      ..|+.   +.+++||||.|+|+|++..+.|...+|+++.+...|.+.+..++. .....+.+.+..+....++...++..
T Consensus        93 ~~pp~~~~~a~vpTlLgtg~qsLl~r~k~~~~~~~~~s~~~~~h~~~~~~~~~sl~s~~~~~~~h~~a~~i~~at~~~ak  172 (1113)
T KOG0644|consen   93 PIPPRYCTIARVPTLLGTGRQSLLRRAKDIRHTVWKGSAFRWPHMHADQVRGVSLRSIGGGFEIHHRAPSIGCATFSIAK  172 (1113)
T ss_pred             CCCcceeeeecccchhcchhHHHHhhhhhcccccccccccccccccCcccccceeccCCcchhhhhcCcccccceeeecC
Confidence            99987   788999999999999999999999999999999999998988887 55667788888888888999999999


Q ss_pred             ecccCCceeeeEEecCCCCcEEEEEEcCCCCEEEEEECCCcEEEEECCCCcEEEEEeCCCCCEEEEEEeCCCCEEEEEeC
Q psy9598         459 SSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTV  538 (1915)
Q Consensus       459 ~~~~~~~~~~~~~l~gH~~~V~~vafspdg~~LaTGs~Dg~I~IWd~~tg~~~~~l~gH~~~I~~Lafspdg~~LaSgs~  538 (1915)
                      +...+++++.++.|.||.++|+|++|+..|.+|+||++|..|+||+..++.++.+++||.+.|+.++.+.++.++|++|.
T Consensus       173 Pgtmvqkmk~ikrLlgH~naVyca~fDrtg~~Iitgsdd~lvKiwS~et~~~lAs~rGhs~ditdlavs~~n~~iaaaS~  252 (1113)
T KOG0644|consen  173 PGTMVQKMKNIKRLLGHRNAVYCAIFDRTGRYIITGSDDRLVKIWSMETARCLASCRGHSGDITDLAVSSNNTMIAAASN  252 (1113)
T ss_pred             cHHHHHHHHHHHHHHhhhhheeeeeeccccceEeecCccceeeeeeccchhhhccCCCCccccchhccchhhhhhhhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcEEEEECCCCceEEEeecCCCCeEEEEeccCccCCCcEEEEEeCCCeEEEEecccCccccceeccCccccccccCCCC
Q psy9598         539 DKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGN  618 (1915)
Q Consensus       539 DgtIrVWDl~tg~~~~~l~~h~~~V~sl~fsp~~~~d~~~L~sgs~DgtI~iWDl~~~~~~~~~~~~~~~~~~~~~~~~~  618 (1915)
                      |..|+||.+.++.++.++.||++.|++|+|+|.        .+.+.||++++||.+-..   ......|..+..     .
T Consensus       253 D~vIrvWrl~~~~pvsvLrghtgavtaiafsP~--------~sss~dgt~~~wd~r~~~---~~y~prp~~~~~-----~  316 (1113)
T KOG0644|consen  253 DKVIRVWRLPDGAPVSVLRGHTGAVTAIAFSPR--------ASSSDDGTCRIWDARLEP---RIYVPRPLKFTE-----K  316 (1113)
T ss_pred             CceEEEEecCCCchHHHHhccccceeeeccCcc--------ccCCCCCceEeccccccc---cccCCCCCCccc-----c
Confidence            999999999999999999999999999999993        378899999999987211   111111111110     0


Q ss_pred             CceEEEEECCCCcEEEEEeCCCeEEEEEecCCCCCceeEEeccCCCCeeEEEEcCCCCEEEEEeCCCcEEEEEccCCceE
Q psy9598         619 AHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWR  698 (1915)
Q Consensus       619 ~~V~~l~fspdg~~Lasgs~Dg~I~IwDl~~~~~~~~i~~l~~h~~~V~sl~fspdg~~L~sgs~DG~I~IWDl~~~~~~  698 (1915)
                                                                   ..+.++.|..++..++||+.|+....|.+....|.
T Consensus       317 ---------------------------------------------~~~~s~~~~~~~~~f~Tgs~d~ea~n~e~~~l~~~  351 (1113)
T KOG0644|consen  317 ---------------------------------------------DLVDSILFENNGDRFLTGSRDGEARNHEFEQLAWR  351 (1113)
T ss_pred             ---------------------------------------------cceeeeeccccccccccccCCcccccchhhHhhhh
Confidence                                                         22344455556666677777777666655433322


Q ss_pred             EeeecccccCCCCccccccccccccEEEEEECCCC-CEEEEEEecCCeEEEEECCCCceEEEeeCCCCCeEEEEEccCCC
Q psy9598         699 FIRLDMNTCLPHTKETSDETNKKIKVTMVAWDASD-RWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDS  777 (1915)
Q Consensus       699 ~~~~~~~~~~~~~~~~~~~~~~~~~V~~va~spdg-~~L~t~s~~Dg~I~vwD~~tg~~i~~l~gH~~~V~sl~~sp~dg  777 (1915)
                      ..                      .+..+.++.+- .+.+++-. +..+++|++.+|.+++.+.+|...++.+.+||++.
T Consensus       352 ~~----------------------~lif~t~ssd~~~~~~~ar~-~~~~~vwnl~~g~l~H~l~ghsd~~yvLd~Hpfn~  408 (1113)
T KOG0644|consen  352 SN----------------------LLIFVTRSSDLSSIVVTARN-DHRLCVWNLYTGQLLHNLMGHSDEVYVLDVHPFNP  408 (1113)
T ss_pred             cc----------------------ceEEEeccccccccceeeee-eeEeeeeecccchhhhhhcccccceeeeeecCCCc
Confidence            11                      11112222121 34455555 88999999999999999999999999999999999


Q ss_pred             CEEEEEecCceEEEEECCCCccccceeeeeeecCCCCcceEEEEEcCCCCEEEEEeCCCeEEEEeCCCCcccccCCCcee
Q psy9598         778 RVLLSAGHDGLIIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGGFKRPQNIPRELF  857 (1915)
Q Consensus       778 ~~LaSgs~DG~I~IWdl~s~~~~~~~~~~~~~~~~~~~~V~~vafSpdg~~Lasg~~dG~I~Iwdl~s~~~~~~l~~~~~  857 (1915)
                      .+..++|.||.+.|||+..|.+  ++.+.     .+++.+.+.+||+||..+++.+..|+++|++.+.++.....+.++|
T Consensus       409 ri~msag~dgst~iwdi~eg~p--ik~y~-----~gh~kl~d~kFSqdgts~~lsd~hgql~i~g~gqs~s~k~ak~dqf  481 (1113)
T KOG0644|consen  409 RIAMSAGYDGSTIIWDIWEGIP--IKHYF-----IGHGKLVDGKFSQDGTSIALSDDHGQLYILGTGQSKSQKKAKYDQF  481 (1113)
T ss_pred             HhhhhccCCCceEeeecccCCc--ceeee-----cccceeeccccCCCCceEecCCCCCceEEeccCCCccccccccceE
Confidence            9999999999999999999988  66665     3478899999999999999999999999999999999999999999


Q ss_pred             ecCCCCeeeecCCCccceeecccCCCCCcCCCCcccCCCCCCCCCCCcccccCCCCCCCCCcccccccCCCCCceeeecc
Q psy9598         858 FHTDYRTLNRPNGLFEPTYDEVTNLPPHLMPPPFLVDLNGTPYPPEVQRLVPGRENADDTELLPDITTNDDGHVEIVEGS  937 (1915)
Q Consensus       858 F~~d~~~Lv~~~~~~~~v~D~~t~~~p~~~~~pfl~~~~G~~ypp~~Q~lv~GR~~s~~~~L~~~~~~~~d~~~~~ieg~  937 (1915)
                      |+.|+++|+++.+++  |+|.+|++.||.++++|+|+.+++|||..+|+|++||..+..+++.|++++.+.-.-+.++..
T Consensus       482 fl~dyrplirdTn~~--vldqeTq~~ph~~~p~~l~ds~~iphpe~yqtl~q~rr~sa~dh~mp~l~fia~~~~E~e~~V  559 (1113)
T KOG0644|consen  482 FLGDYRPLIRDTNGY--VLDQETQLAPHRNPPDFLCDSDMIPHPEPYQTLFQGRRLSALDHLMPPLEFIATMDWEPEEQV  559 (1113)
T ss_pred             eecCcccccccccch--hhhhHhhhccccCCCCceeccCCCcCCchhhhcccccccchhhhcCCcccchhhhccccchhh
Confidence            999999999999999  999999999999999999999999999999999999999999999999977654222222221


Q ss_pred             c------------ccCC---CchhhccccccCCCC-Ccc---------------cccc--cccccccCCCCCC-CcccCC
Q psy9598         938 E------------RNGE---RPVEVEGQRHYNDHG-HVY---------------IQTS--HVHVLRSRANGES-SAATEG  983 (1915)
Q Consensus       938 e------------e~gs---~~~~~~~~~~~~~~g-~~~---------------~~~~--~~~~~~~~~~~rr-~g~~~g  983 (1915)
                      .            |..|   .+....-+.+...+| .+.               ++.-  ..+...+..+.++ +|+++|
T Consensus       560 ls~~nds~~~~~~es~seldg~isq~krt~n~r~g~k~s~~~hg~s~ss~~~R~~~Rn~~~~isk~sg~~~~~~sg~~e~  639 (1113)
T KOG0644|consen  560 LSDQNDSEYNRSPESLSELDGMISQLKRTQNQRMGAKQSKRKHGLSKSSRPPRAAARNASSDISKISGISLDRKSGQVEG  639 (1113)
T ss_pred             hhhcccccccCCcccchhhhhhhhhhhhhhccccccchhhccCCCCccccCCcccccccchhhccCCCccccccccCCcc
Confidence            1            1101   111222222222222 111               0110  2255567788888 999999


Q ss_pred             CCCCCCCC-----------ccccccccccC-CCchhHHHHH--HHHhhhhhhhhhhHHhhcccCCC----CCCcCc--cc
Q psy9598         984 TSPSGTAP-----------TAQNKNFVKRL-PLSQHKIVVE--RINAFAEIESEEFIKESKKLFDS----STTTQP--LV 1043 (1915)
Q Consensus       984 v~~~~~n~-----------~aw~~r~~~~~-~~~~~~~~~~--~~~~~~~~e~~~~~~e~~~~~~~----~~~~~~--~~ 1043 (1915)
                      +.|+++|+           .+|+++++|.+ ..+.....++  ....+++.+.+.|..-+|+++..    +..++.  .+
T Consensus       640 ~~q~~~~~p~eq~~~~~~~~~wR~e~~vce~legt~pe~ed~~~~~dtdev~rng~kngRKrk~~l~~~~Snksd~vtlV  719 (1113)
T KOG0644|consen  640 VTQMHQNAPSEQIATLRTLQAWRREVVVCEELEGTFPELEDEAMAVDTDEVERNGYKNGRKRKLELRHPLSNKSDSVTLV  719 (1113)
T ss_pred             chhhccCCCHHHHhhhhHHHHhhcccCccccccccCccccccccccccchhhhcCCCcccccchhccCccccccccchhh
Confidence            99999877           59999999999 7777777776  55567788888998888888553    222211  11


Q ss_pred             cccc-cccccccCCCchhhhhcccccCCCCCCCCCCCCCCCCCCCCCccccccccccCCCCCCCCCCCCccccccc-CCC
Q psy9598        1044 VKKE-KKKKVVRQARTRAEYSEHIQDQYEDPDNLSLSGSEESASDSDQSQVDVSDLCESSSSSGGTSSSDYSDWIH-EGV 1121 (1915)
Q Consensus      1044 ~~~~-r~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sd~~~-~g~ 1121 (1915)
                      .... -++.+.+.++.+-.+.  .++..+..--+.+.+.++..-...+.++.......+...++++.||-|++|++ .++
T Consensus       720 ~~d~~~~~~~~s~aP~~~ld~--lNDgfsD~kiD~t~D~se~~gs~~Eis~Rndrr~eS~~~esds~SSa~sv~l~dgsi  797 (1113)
T KOG0644|consen  720 SQDLADQSTCVSRAPNGGLDS--LNDGFSDVKIDLTLDCSEDSGSGEEISLRNDRRSESNPEESDSLSSAYSVWLADGSI  797 (1113)
T ss_pred             hhhhhcccceeeeCCcccccc--cccccccccccchhhhhhcCCcccceeeecchhhccCcccccchhhhhheecccCCc
Confidence            1000 1222322222211111  11111111000011111110111223444444445555667788999999999 999


Q ss_pred             CCCCCcccc-cccccC------------CCc--CCCC-CC--------CCCCCCCCCcCCCCccccccCCCC-CCCCCCC
Q psy9598        1122 NLEPPKRVR-RHTKVK------------PIQ--VSLP-KQ--------LIPEEVPDIYKPSDWLAEVVPKKA-PYYPQMG 1176 (1915)
Q Consensus      1122 ~~~~p~r~~-r~~~~~------------~~~--~~~~-~~--------~~~~~~~~~~~~~~w~~~~~~~~~-p~~pq~g 1176 (1915)
                      |++-.+|++ +|-..+            ++.  .++. ++        ..+-..-+.+.+++||+.++-+.+ |||||||
T Consensus       798 ~~~tsrrgRi~k~~~st~a~Lt~e~~~~p~~~~~~s~s~s~~~~~p~~~~~~~~~~~~~~~sWltls~hee~~ryipQmg  877 (1113)
T KOG0644|consen  798 NLQTSRRGRITKFCSSTEAELTTELSSPPCSQDKGSGSKSHKRSTPAPLENMKPQQLFEKPSWLTLSIHEEGCRYIPQMG  877 (1113)
T ss_pred             cccccccccccccCccchhhhhhcccCCCccccccccccCcccCCCccccccchhhhcCCceeEEeehhhcCCccccccc
Confidence            998332211 111100            000  0100 00        011112257899999999887666 9999999


Q ss_pred             CeEEEEccchHHHHHHHhhcCccccCcccCCCCccCCCCCCceEEEEEEEEEecCCceEEEEEEEecCCCCcCCcEEEEE
Q psy9598        1177 DEVMFFKQGYQKYVDAVRSKGIYELSRLRSSPWGNLILQEPELVKVVGIKYEIAPPRMCCLKLAVMKPNGKLTNEFFNIK 1256 (1915)
Q Consensus      1177 d~v~yf~qGh~~~~~~~~~~~~~~~~~~~~~p~~~~~l~~~~~c~v~~i~~~~~~~~~~~~~l~~~~~~~~~~~~~f~v~ 1256 (1915)
                      |+|+||+|||+|||+|++..++ ..+  ...||+++.+.-+++.|++.|.|..++|++||++|+++|..+.+..++|++.
T Consensus       878 DEViyfrQghqeyl~~~~~n~~-~~~--~~~p~~~~~v~~~kv~kl~~~~y~~~~~s~c~m~l~~idp~s~~~~k~F~lt  954 (1113)
T KOG0644|consen  878 DEVIYFRQGHQEYLEAVRLNNI-ELN--NKEPWNKMAVEICKVEKLVYITYPGSGDSCCKMKLAVIDPASKLMDKSFKLT  954 (1113)
T ss_pred             ceeehhhhhhHHHHhhhhhccc-ccc--ccCcccccchhhheeeeeeeeeccCCCcchheeeeeeecchhhhhhccceee
Confidence            9999999999999999999887 555  5899999988888888888888888999999999999998779999999999


Q ss_pred             eCCCCCCCcEEEehHhHHHHHcCCCCCCCeEEEEEcCe------eEEEEEeecCC----CCCCCceeeEEEeCCCCCCCc
Q psy9598        1257 YHDMPDVIDFFVLRQIYETAIAREWNVGDRFCSMIDDA------WWWGTIEGKPS----PTKSPFLGYKILWDNNERENL 1326 (1915)
Q Consensus      1257 y~~~~~~~~f~v~~~~y~~~~~~~~~~g~rf~~~~~~~------~~~G~i~~~~~----~~~s~w~~~~v~wd~~~~~~~ 1326 (1915)
                      |++|++++||||+|++|++|++|||+.||+||++|+|+      ||+|+|.+++|    ||+|||+||.|+|||++.+.+
T Consensus       955 lpdlv~fpDFlV~rsrYd~AiQrnW~~~d~crvwwrda~~e~g~WWeG~ils~~pksp~fpdSpwery~v~~~~~e~~~~ 1034 (1113)
T KOG0644|consen  955 LPDLVTFPDFLVERSRYDAAIQRNWTCRDKCRVWWRDAGEEDGAWWEGRILSVKPKSPDFPDSPWERYIVRYDNTETELH 1034 (1113)
T ss_pred             cccccCcchhhhhhhhHHHHHhhccccccceeEEEccCCCcCCceeeeeeeeccCCCCCCCCCcceeEEEEecCCccccc
Confidence            99999999999999999999999999999999999775      99999999998    999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCChHHHHhhccCCCCCCCCCCCCHHHHHHHHHHHHHhcCCCccCCCCCCCCCCCCCcc
Q psy9598        1327 SPWDLEPPKEGKEATEPGGSLPVEPEEIQELLYHPRPDEWPQGDRDATCEKIITGLEEVMGLSVAEPFLVPVDISQYPAY 1406 (1915)
Q Consensus      1327 spw~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~F~~pv~~~~~p~Y 1406 (1915)
                      ||||++||+..                                                                    |
T Consensus      1035 spwe~~~i~de--------------------------------------------------------------------~ 1046 (1113)
T KOG0644|consen 1035 SPWEMEPIPDE--------------------------------------------------------------------V 1046 (1113)
T ss_pred             CccccCCCccc--------------------------------------------------------------------c
Confidence            99999998331                                                                    2


Q ss_pred             ccccCCCCCHHHHHHHhcCCCCCCHHHHHHHHHHHHHhhhhhcCCCCHHHHHHHHHHHHHHHHHh
Q psy9598        1407 AYVVEYPVDLTTLRARFQNRFYRRITSAQFDVRYLAANAEKFNEPHSNIVKYARIITDLLLRIIK 1471 (1915)
Q Consensus      1407 ~~~I~~PmdL~tI~~rl~~~~Y~~~~~~~~D~~l~~~Na~~yN~~~s~i~~~a~~l~~~~~~~~~ 1471 (1915)
                      ..-..-|..|..|+.||+|+|||++++|.+|+..|.+||.+|.+.+--+...+..|..+|.+.+.
T Consensus      1047 ~~~fpvpls~evi~~rlEn~yYrs~e~~~hdvs~mlsnae~~fg~~~~~~~ki~~l~~~~~~Tlp 1111 (1113)
T KOG0644|consen 1047 DNRFPVPLSLEVIRSRLENNYYRSQEALRHDVSVMLSNAETFFGRNKNVAIKISFLSPWFDRTLP 1111 (1113)
T ss_pred             CCCCCCcccHHHHHHHHHhhhhhhhHhhhcchhhhhcccceeecccccHHHHhhhcchhhhhhcc
Confidence            22334488899999999999999999999999999999999999999888888888888877653



>KOG0271|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>PF06507 Auxin_resp: Auxin response factor; InterPro: IPR010525 This pattern represents a conserved region of auxin-responsive transcription factors Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2276|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1915
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 4e-28
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 4e-28
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 5e-27
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 5e-27
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 6e-18
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 1e-16
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 2e-05
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 2e-16
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-05
2g9a_A311 Structural Basis For The Specific Recognition Of Me 2e-16
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-05
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 2e-16
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-05
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 3e-16
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-05
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 3e-16
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-05
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 3e-16
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-05
2g99_A308 Structural Basis For The Specific Recognition Of Me 3e-16
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-05
2h9l_A329 Wdr5delta23 Length = 329 3e-16
2h9l_A329 Wdr5delta23 Length = 329 1e-05
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 3e-16
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-05
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 3e-16
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-05
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 4e-16
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 1e-05
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 4e-16
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 7e-06
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 5e-16
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 8e-06
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 7e-16
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-05
2gnq_A336 Structure Of Wdr5 Length = 336 8e-16
2gnq_A336 Structure Of Wdr5 Length = 336 2e-05
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 8e-16
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 2e-05
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 1e-15
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 1e-12
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 5e-12
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 8e-06
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 2e-11
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 2e-11
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 9e-11
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 9e-11
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 1e-10
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 1e-10
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 1e-10
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 1e-10
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 4e-10
3zey_7318 High-resolution Cryo-electron Microscopy Structure 8e-10
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 9e-09
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 9e-09
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 1e-08
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 1e-08
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 2e-08
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 2e-08
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 2e-08
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 2e-08
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 2e-08
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 2e-08
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 2e-08
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 2e-08
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 2e-08
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 2e-08
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 2e-08
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 2e-08
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 3e-08
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 3e-08
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 4e-08
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 4e-08
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 5e-08
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 5e-08
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 7e-08
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 7e-08
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 7e-08
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 7e-08
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 8e-08
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 8e-08
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 8e-08
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 8e-08
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 9e-08
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 9e-08
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 9e-08
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 9e-08
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 1e-07
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 1e-07
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 1e-07
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 1e-07
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-07
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-07
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 2e-07
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 2e-07
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 2e-07
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 2e-07
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 3e-07
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 3e-07
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 3e-07
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 3e-07
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 4e-07
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 4e-07
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 6e-07
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-05
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 6e-07
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 2e-05
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 6e-07
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-05
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 6e-07
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 2e-05
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 6e-07
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 2e-05
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 6e-07
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-05
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 6e-07
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 2e-05
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 7e-07
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 7e-07
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 9e-07
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 9e-07
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 1e-06
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 1e-06
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 4e-05
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 1e-06
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 1e-06
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 1e-06
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 1e-06
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 2e-06
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-05
3acp_A417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 5e-06
3vl1_A420 Crystal Structure Of Yeast Rpn14 Length = 420 5e-06
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 8e-06
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 8e-06
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 8e-06
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 8e-06
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 8e-06
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 8e-06
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 1e-05
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 1e-05
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 1e-05
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 1e-05
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 1e-05
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 1e-05
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 2e-05
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 2e-05
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 2e-05
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 3e-05
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 3e-05
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 3e-05
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 7e-05
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 7e-05
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 8e-05
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 8e-05
4aez_A401 Crystal Structure Of Mitotic Checkpoint Complex Len 9e-05
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 1e-04
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-04
2e7n_A117 Solution Structure Of The Second Bromodomain From H 1e-04
2e7n_A117 Solution Structure Of The Second Bromodomain From H 1e-04
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 1e-04
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 1e-04
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 2e-04
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 2e-04
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 2e-04
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 2e-04
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 2e-04
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 2e-04
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 2e-04
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 2e-04
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 2e-04
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 2e-04
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 2e-04
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 3e-04
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 3e-04
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 3e-04
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 3e-04
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 4e-04
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 4e-04
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 4e-04
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 4e-04
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 4e-04
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 6e-04
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 5e-04
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 5e-04
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 6e-04
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 6e-04
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 6e-04
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 6e-04
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 7e-04
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 7e-04
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 7e-04
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 7e-04
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 8e-04
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 8e-04
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure

Iteration: 1

Score = 124 bits (312), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 51/103 (49%), Positives = 76/103 (73%) Query: 117 NWKNECREVLETLWVCPDSEPFRKPVDKLDHPDYDKIVIAPMDLGTIREELRGDNYESPI 176 NWK +C+E++ ++ C DSEPFR+PVD +++PDY I+ PMD GT+RE L NY+SP+ Sbjct: 10 NWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPL 69 Query: 177 DFVKDVKRVFHNSRNYNQNKRSKIYIMTTRLSEFAEEHLRRLT 219 +F KD++ +F N++ Y NKRSKIY MT RLS EE +++++ Sbjct: 70 EFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKIS 112
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|4AEZ|A Chain A, Crystal Structure Of Mitotic Checkpoint Complex Length = 401 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1915
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3aad_A292 Transcription initiation factor TFIID subunit 1; p 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2r0y_A311 Chromatin structure-remodeling complex protein RSC 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2r10_A361 Chromatin structure-remodeling complex protein RSC 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.98
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.98
3jrp_A379 Fusion protein of protein transport protein SEC13 99.98
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.98
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.97
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
3jro_A753 Fusion protein of protein transport protein SEC13 99.96
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.96
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.96
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.96
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.95
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.95
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.95
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.95
3jro_A753 Fusion protein of protein transport protein SEC13 99.95
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.95
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.94
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.94
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.94
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.94
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.94
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.94
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.93
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.92
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.91
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.91
3d7c_A112 General control of amino acid synthesis protein 5; 99.91
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.91
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.91
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.91
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.91
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.9
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.9
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.9
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.9
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.9
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.9
2dat_A123 Possible global transcription activator SNF2L2; br 99.9
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.9
3p1f_A119 CREB-binding protein; structural genomics consorti 99.9
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.9
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.9
2grc_A129 Probable global transcription activator SNF2L4; br 99.9
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.9
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.89
1k32_A1045 Tricorn protease; protein degradation, substrate g 99.89
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.89
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.89
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.89
3d7c_A112 General control of amino acid synthesis protein 5; 99.89
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.89
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.89
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.89
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.89
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.89
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.89
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.88
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.88
2grc_A129 Probable global transcription activator SNF2L4; br 99.88
2dat_A123 Possible global transcription activator SNF2L2; br 99.88
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.88
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.88
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.88
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.87
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.87
3uv4_A158 Second bromodomain of human transcription initiat 99.87
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.87
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.87
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.87
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.87
3p1f_A119 CREB-binding protein; structural genomics consorti 99.87
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.87
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.87
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.87
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.87
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.87
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.87
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.86
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.86
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.86
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.86
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.86
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.85
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.85
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.85
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.85
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.85
3uv4_A158 Second bromodomain of human transcription initiat 99.84
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.84
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.84
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.84
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.83
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.83
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.83
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.83
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.83
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.83
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.83
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.82
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.82
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.82
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.82
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.82
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.82
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.8
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.8
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.8
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.79
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.79
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.79
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.79
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.78
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.78
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.78
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.77
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.76
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.75
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.75
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.75
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.74
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.73
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.73
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.72
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.71
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.7
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.7
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.69
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.66
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.66
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.65
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.65
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.63
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.59
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.57
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.56
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.55
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.55
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.54
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.54
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.53
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.53
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.52
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.52
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.51
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.51
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.49
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.47
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.45
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.43
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.42
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.42
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.42
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.39
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.39
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.38
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.37
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.36
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.35
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.35
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.35
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.32
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.31
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.3
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.27
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.26
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.25
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.24
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.23
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.23
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.21
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.21
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.2
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.19
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.17
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.16
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 99.14
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.11
2qe8_A343 Uncharacterized protein; structural genomics, join 99.1
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.08
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.08
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.06
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.03
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.01
2qe8_A343 Uncharacterized protein; structural genomics, join 99.0
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 98.97
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.95
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.94
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.94
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.94
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.93
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.92
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.91
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.9
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.85
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.84
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.84
4a2l_A795 BT_4663, two-component system sensor histidine kin 98.83
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.8
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.77
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.72
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.67
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.66
3v9f_A781 Two-component system sensor histidine kinase/RESP 98.64
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.63
2ece_A462 462AA long hypothetical selenium-binding protein; 98.63
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.62
2ece_A462 462AA long hypothetical selenium-binding protein; 98.6
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.57
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.57
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.47
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.45
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.43
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.41
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.26
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.2
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.17
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.15
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.14
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.07
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.07
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.07
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.03
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.02
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.97
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.95
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.94
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.92
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.9
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.89
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.89
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.88
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.86
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.86
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.84
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.79
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.79
3v65_B386 Low-density lipoprotein receptor-related protein; 97.77
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.76
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.76
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.76
3v65_B386 Low-density lipoprotein receptor-related protein; 97.75
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.73
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.73
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.72
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.7
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.63
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.6
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.58
3kya_A496 Putative phosphatase; structural genomics, joint c 97.56
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.56
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.54
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.53
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.53
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.48
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.46
3ott_A758 Two-component system sensor histidine kinase; beta 97.39
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.3
3kya_A496 Putative phosphatase; structural genomics, joint c 97.28
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.23
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.18
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.18
3ott_A758 Two-component system sensor histidine kinase; beta 97.15
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.12
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.02
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.83
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 96.79
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 96.76
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.67
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.58
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 96.55
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.5
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.49
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.46
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 96.41
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.26
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 96.2
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.19
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.13
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.12
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.92
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 95.89
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 95.81
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.8
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.78
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 95.7
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.68
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 95.65
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 95.59
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.34
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.31
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.18
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.1
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 94.75
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 94.75
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 94.67
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 94.54
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 94.43
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 94.34
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 94.19
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.81
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 93.57
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 92.86
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 92.66
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 92.35
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 92.17
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 92.02
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 91.28
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 90.88
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 90.62
2jns_A90 Bromodomain-containing protein 4; ET-domain, struc 89.51
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 89.25
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 88.47
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 88.21
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 86.24
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 85.68
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 85.42
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 85.25
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 84.36
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 81.59
2xtc_A90 F-box-like/WD repeat-containing protein TBL1X; tra 81.39
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 80.84
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 80.77
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
Probab=100.00  E-value=7.6e-42  Score=455.11  Aligned_cols=401  Identities=15%  Similarity=0.141  Sum_probs=316.8

Q ss_pred             CCCeEEEecccCCceeeeEEecCCCCcEEEEEEcCCCCEEEEEECCCcEEEEECCCC--cEEEEEeCCCCCEEEEEEeCC
Q psy9598         452 LSRSLMISSHKYSNLRQHYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDG--KLLATLRGCSGEISDIAIDNR  529 (1915)
Q Consensus       452 ~d~~~~i~~~~~~~~~~~~~l~gH~~~V~~vafspdg~~LaTGs~Dg~I~IWd~~tg--~~~~~l~gH~~~I~~Lafspd  529 (1915)
                      .++.+.+|...  .......|.||.+.|+|++|+|+|++||+|+.||+|+|||+.++  .+..++.+|.+.|.+|+|+|+
T Consensus        37 ~~~~v~l~~~~--~~~~~~~~~~h~~~v~~~~~spdg~~lasg~~d~~v~lWd~~~~~~~~~~~~~~~~~~v~~v~fs~d  114 (611)
T 1nr0_A           37 NGTSVYTVPVG--SLTDTEIYTEHSHQTTVAKTSPSGYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSGPVKDISWDSE  114 (611)
T ss_dssp             ETTEEEEEETT--CSSCCEEECCCSSCEEEEEECTTSSEEEEEETTSEEEEEESSSTTCCEEEEEECSSSCEEEEEECTT
T ss_pred             CCCEEEEecCC--CcccCeEecCCCCceEEEEECCCCcEEEEEeCCCCEEEeECCCCcceeeEeecccCCceEEEEECCC
Confidence            35688888654  33455688999999999999999999999999999999999754  456788999999999999999


Q ss_pred             CCEEEEEeCC----CcEEEEECCCCceEEEeecCCCCeEEEEeccCccCCCcEEEEEeCCCeEEEEecccCccccceecc
Q psy9598         530 NILLAAGTVD----KTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFH  605 (1915)
Q Consensus       530 g~~LaSgs~D----gtIrVWDl~tg~~~~~l~~h~~~V~sl~fsp~~~~d~~~L~sgs~DgtI~iWDl~~~~~~~~~~~~  605 (1915)
                      +++|++++.+    +.|++||  ++..+..+.+|...|++++|+|++   ...|++|+.|++|++||..++...      
T Consensus       115 g~~l~~~~~~~~~~~~v~~wd--~~~~~~~l~gh~~~v~~v~f~p~~---~~~l~s~s~D~~v~lwd~~~~~~~------  183 (611)
T 1nr0_A          115 SKRIAAVGEGRERFGHVFLFD--TGTSNGNLTGQARAMNSVDFKPSR---PFRIISGSDDNTVAIFEGPPFKFK------  183 (611)
T ss_dssp             SCEEEEEECCSSCSEEEEETT--TCCBCBCCCCCSSCEEEEEECSSS---SCEEEEEETTSCEEEEETTTBEEE------
T ss_pred             CCEEEEEECCCCceeEEEEee--CCCCcceecCCCCCceEEEECCCC---CeEEEEEeCCCeEEEEECCCCeEe------
Confidence            9999999865    3677776  567778899999999999999953   247999999999999997765322      


Q ss_pred             CccccccccCCCCCceEEEEECCCCcEEEEEeCCCeEEEEEecCCCCCceeEEec-------cCCCCeeEEEEcCCCCEE
Q psy9598         606 EPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSPLGILEVE-------EHSDKVDSIQWSHSHLRF  678 (1915)
Q Consensus       606 ~~~~~~~~~~~~~~~V~~l~fspdg~~Lasgs~Dg~I~IwDl~~~~~~~~i~~l~-------~h~~~V~sl~fspdg~~L  678 (1915)
                            ..+.+|...|.+++|+|+|.+|++|+.|++|+|||+..   ...+..+.       +|.+.|.+++|+|+|.+|
T Consensus       184 ------~~l~~H~~~V~~v~fspdg~~las~s~D~~i~lwd~~~---g~~~~~~~~~~~~~~~h~~~V~~v~~spdg~~l  254 (611)
T 1nr0_A          184 ------STFGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVD---GTKTGVFEDDSLKNVAHSGSVFGLTWSPDGTKI  254 (611)
T ss_dssp             ------EEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTT---CCEEEECBCTTSSSCSSSSCEEEEEECTTSSEE
T ss_pred             ------eeeccccCceEEEEECCCCCEEEEEECCCcEEEEECCC---CcEeeeeccccccccccCCCEEEEEECCCCCEE
Confidence                  22346788999999999999999999999999999843   33444452       799999999999999999


Q ss_pred             EEEeCCCcEEEEEccCCceEEeeecccccC---------------------------CCCccccccccccccEEEEEECC
Q psy9598         679 VSGSRDGTALIWYYKCSQWRFIRLDMNTCL---------------------------PHTKETSDETNKKIKVTMVAWDA  731 (1915)
Q Consensus       679 ~sgs~DG~I~IWDl~~~~~~~~~~~~~~~~---------------------------~~~~~~~~~~~~~~~V~~va~sp  731 (1915)
                      ++|+.|++|+|||+.++++...........                           ..........+|...|++++|+|
T Consensus       255 ~s~s~D~~v~lWd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~s~s~d~~i~~~~~~~~~~~~~~~gh~~~v~~l~~sp  334 (611)
T 1nr0_A          255 ASASADKTIKIWNVATLKVEKTIPVGTRIEDQQLGIIWTKQALVSISANGFINFVNPELGSIDQVRYGHNKAITALSSSA  334 (611)
T ss_dssp             EEEETTSEEEEEETTTTEEEEEEECCSSGGGCEEEEEECSSCEEEEETTCCEEEEETTTTEEEEEECCCSSCEEEEEECT
T ss_pred             EEEeCCCeEEEEeCCCCceeeeecCCCCccceeEEEEEcCCEEEEEeCCCcEEEEeCCCCCcceEEcCCCCCEEEEEEeC
Confidence            999999999999999887654321100000                           00001122346888999999999


Q ss_pred             CCCEEEEEEecCCeEEEEECCCCceEEEe-eC------------------------------------------------
Q psy9598         732 SDRWVITAINFNFQIKIWDAFNGDLVQVL-KG------------------------------------------------  762 (1915)
Q Consensus       732 dg~~L~t~s~~Dg~I~vwD~~tg~~i~~l-~g------------------------------------------------  762 (1915)
                      +|.+|++++. |+.|++||+.++.+...+ .+                                                
T Consensus       335 dg~~l~s~s~-D~~v~~Wd~~~~~~~~~~~~~h~~~v~~~~~s~~~~l~s~s~d~~v~~w~~~~~~~~~~~~~~~~~~~~  413 (611)
T 1nr0_A          335 DGKTLFSADA-EGHINSWDISTGISNRVFPDVHATMITGIKTTSKGDLFTVSWDDHLKVVPAGGSGVDSSKAVANKLSSQ  413 (611)
T ss_dssp             TSSEEEEEET-TSCEEEEETTTCCEEECSSCSCSSCEEEEEECTTSCEEEEETTTEEEEECSSSSSSCTTSCCEEECSSC
T ss_pred             CCCEEEEEeC-CCcEEEEECCCCceeeecccCCcceEEEEEECCCCcEEEEEcCCceEEeecCCccccccceeeeecCCC
Confidence            9999999998 999999999876554332 11                                                


Q ss_pred             ---------------------------------CCCCeEEEEEccCCCCEEEEEecCceEEEEECCCCccccceeeeeee
Q psy9598         763 ---------------------------------HTNEVFVLESHPFDSRVLLSAGHDGLIIIWDILSSKQRGYKWFHNIV  809 (1915)
Q Consensus       763 ---------------------------------H~~~V~sl~~sp~dg~~LaSgs~DG~I~IWdl~s~~~~~~~~~~~~~  809 (1915)
                                                       |...+.+++|+| ++.+|++|+.||+|+|||+.++..  . .+.  .
T Consensus       414 ~~~~~~s~dg~~~~~~~~~~v~~~~~~~~~~~~~~~~v~~va~sp-dg~~lasgs~D~~v~lwd~~~~~~--~-~~~--~  487 (611)
T 1nr0_A          414 PLGLAVSADGDIAVAACYKHIAIYSHGKLTEVPISYNSSCVALSN-DKQFVAVGGQDSKVHVYKLSGASV--S-EVK--T  487 (611)
T ss_dssp             EEEEEECTTSSCEEEEESSEEEEEETTEEEEEECSSCEEEEEECT-TSCEEEEEETTSEEEEEEEETTEE--E-EEE--E
T ss_pred             CcEEEEeCCCcEEEEEeCceEEEEeCCceeeeecCCCceEEEEeC-CCCEEEEeCCCCeEEEEEccCCce--e-eee--c
Confidence                                             234467889999 999999999999999999977543  1 111  1


Q ss_pred             cCCCCcceEEEEEcCCCCEEEEEeCCCeEEEEeCCC-Cccccc--C------CCceeecCCCCeeeecC-CCccceeecc
Q psy9598         810 EGQGEGALFDGKWSPDGTTCALTDSYGHLLVYGLGG-FKRPQN--I------PRELFFHTDYRTLNRPN-GLFEPTYDEV  879 (1915)
Q Consensus       810 ~~~~~~~V~~vafSpdg~~Lasg~~dG~I~Iwdl~s-~~~~~~--l------~~~~~F~~d~~~Lv~~~-~~~~~v~D~~  879 (1915)
                       ..|.+.|.+++|+|||.+||+++.|+.|++|++.+ ++....  .      ...+.|++|++.|+..+ .+.+.+||+.
T Consensus       488 -~~h~~~v~~v~fspdg~~las~s~d~~v~~w~~~~~~~~~~~~~~~~H~~~V~~v~fspdg~~lasgs~D~~v~lW~~~  566 (611)
T 1nr0_A          488 -IVHPAEITSVAFSNNGAFLVATDQSRKVIPYSVANNFELAHTNSWTFHTAKVACVSWSPDNVRLATGSLDNSVIVWNMN  566 (611)
T ss_dssp             -EECSSCEEEEEECTTSSEEEEEETTSCEEEEEGGGTTEESCCCCCCCCSSCEEEEEECTTSSEEEEEETTSCEEEEETT
T ss_pred             -cCCCCceEEEEECCCCCEEEEEcCCCCEEEEEcCCCCceeeeeeeeecccceeEEEECCCCCEEEEEECCCcEEEEECC
Confidence             24668899999999999999999999999999987 544332  1      12688999999998554 4557899987


Q ss_pred             cCC
Q psy9598         880 TNL  882 (1915)
Q Consensus       880 t~~  882 (1915)
                      ++.
T Consensus       567 ~~~  569 (611)
T 1nr0_A          567 KPS  569 (611)
T ss_dssp             CTT
T ss_pred             Ccc
Confidence            653



>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure
>2jns_A Bromodomain-containing protein 4; ET-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2xtc_A F-box-like/WD repeat-containing protein TBL1X; transcription; 2.22A {Homo sapiens} PDB: 2xte_A 2xtd_A Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1915
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-34
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-32
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-20
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 5e-20
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-14
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-32
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-17
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-14
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-31
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-17
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-17
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-11
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-11
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 3e-30
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-13
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-06
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.002
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-27
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-17
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-13
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 6e-22
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 6e-22
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 2e-16
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 7e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-21
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-12
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-08
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-21
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.002
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 2e-21
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 2e-21
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 4e-14
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-21
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 8e-10
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 9e-21
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 9e-21
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 7e-15
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 8e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-20
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-07
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-05
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 2e-20
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 2e-20
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 1e-10
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 0.002
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 3e-20
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 3e-20
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 2e-16
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 1e-04
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 5e-20
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 5e-20
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 2e-15
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 4e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-19
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-04
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-19
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-17
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-15
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-17
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 7e-17
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 5e-16
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 9e-08
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-07
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-15
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-10
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-14
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-12
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-12
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 8e-07
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-06
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-05
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 6e-10
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 4e-04
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 3e-08
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 3e-07
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 3e-07
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 0.001
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-06
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-05
d1jofa_365 b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactoniz 0.004
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  132 bits (333), Expect = 3e-34
 Identities = 67/324 (20%), Positives = 128/324 (39%), Gaps = 25/324 (7%)

Query: 474 GHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILL 533
           GH S V  V+F  +  V+V+ ++D  IK+W    G    TL+G +  + DI+ D+   LL
Sbjct: 15  GHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLL 74

Query: 534 AAGTVDKTIRIWNLQTLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKY 593
           A+ + D TI++W+ Q    I  + GH   ++ V+  P      +++ S S D  I  W+ 
Sbjct: 75  ASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMP----NGDHIVSASRDKTIKMWEV 130

Query: 594 KLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSPGGLFLATGSGDHHVRVYKMDGVDSP 653
           +    +     H   +                 +  G  +A+ S D  VRV+ +   +  
Sbjct: 131 QTGYCVKTFTGHREWVR------------MVRPNQDGTLIASCSNDQTVRVWVVATKEC- 177

Query: 654 LGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCLPHTKE 713
               E+ EH   V+ I W+            G+      K   +        T       
Sbjct: 178 --KAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVS 235

Query: 714 TSDETNK----KIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFV 769
           T             V  V + +  +++++    +  +++WD  N   ++ L  H + V  
Sbjct: 236 TGMCLMTLVGHDNWVRGVLFHSGGKFILSC-ADDKTLRVWDYKNKRCMKTLNAHEHFVTS 294

Query: 770 LESHPFDSRVLLSAGHDGLIIIWD 793
           L+ H   +  +++   D  + +W+
Sbjct: 295 LDFHK-TAPYVVTGSVDQTVKVWE 317


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Length = 365 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1915
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.94
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.92
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.91
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.9
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.89
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.89
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.89
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.89
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.89
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.88
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.88
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.87
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.87
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.86
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.86
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.86
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.84
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.84
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.83
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.83
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.77
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.75
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.71
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.71
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.69
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.69
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.66
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.58
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.49
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.45
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.43
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.38
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.36
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.18
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.96
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.86
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.86
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.7
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.67
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.65
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.62
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.6
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.58
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.58
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.56
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.55
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.52
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.47
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.44
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.35
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.85
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.76
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.75
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.65
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.62
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.6
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.49
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.4
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.32
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.3
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.1
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.0
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.97
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 96.89
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.74
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.73
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.66
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.47
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.41
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.4
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 96.39
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.25
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.24
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.07
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 95.92
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.76
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 94.99
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.46
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 93.24
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 92.22
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 91.93
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.39
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 88.85
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 87.6
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 86.74
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 85.02
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=6.6e-36  Score=354.14  Aligned_cols=308  Identities=23%  Similarity=0.364  Sum_probs=268.3

Q ss_pred             eEEecCCCCcEEEEEEcCCCCEEEEEECCCcEEEEECCCCcEEEEEeCCCCCEEEEEEeCCCCEEEEEeCCCcEEEEECC
Q psy9598         469 HYVNLGHLSAVFCVLFDKLGEVIVTGADDLLIKLWRARDGKLLATLRGCSGEISDIAIDNRNILLAAGTVDKTIRIWNLQ  548 (1915)
Q Consensus       469 ~~~l~gH~~~V~~vafspdg~~LaTGs~Dg~I~IWd~~tg~~~~~l~gH~~~I~~Lafspdg~~LaSgs~DgtIrVWDl~  548 (1915)
                      .++|.||.++|+||+|+|++++||||+.||+|+|||+.+++++.++.+|...|.+++|++++.++++++.++.+.+|+..
T Consensus        10 ~~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~~~~~~~~~~~~   89 (317)
T d1vyhc1          10 KYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQ   89 (317)
T ss_dssp             SCEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEETT
T ss_pred             cEEEcCCCCCeEEEEEcCCCCEEEEEeCCCeEEEEECCCCCEEEEEeCCCCcEEEEeeeccccccccccccccccccccc
Confidence            35789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceEEEeecCCCCeEEEEeccCccCCCcEEEEEeCCCeEEEEecccCccccceeccCccccccccCCCCCceEEEEECC
Q psy9598         549 TLAPISVLVGHQGIITGVNFCPLEVNGFNYLASTSTDGCIGFWKYKLDIDISKTVFHEPVMFNERIRPGNAHILCSSFSP  628 (1915)
Q Consensus       549 tg~~~~~l~~h~~~V~sl~fsp~~~~d~~~L~sgs~DgtI~iWDl~~~~~~~~~~~~~~~~~~~~~~~~~~~V~~l~fsp  628 (1915)
                      .......+.+|...+.++.|++.    +..|++++.|+.+++||+.++..+..+            ..|...+.+++|++
T Consensus        90 ~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~d~~~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~  153 (317)
T d1vyhc1          90 GFECIRTMHGHDHNVSSVSIMPN----GDHIVSASRDKTIKMWEVQTGYCVKTF------------TGHREWVRMVRPNQ  153 (317)
T ss_dssp             SSCEEECCCCCSSCEEEEEECSS----SSEEEEEETTSEEEEEETTTCCEEEEE------------ECCSSCEEEEEECT
T ss_pred             ccccccccccccccceeeeccCC----CceEEeeccCcceeEeecccceeeeEE------------ccCCCcceeeeccc
Confidence            99999999999999999999994    489999999999999999887543332            24567899999999


Q ss_pred             CCcEEEEEeCCCeEEEEEecCCCCCceeEEeccCCCCeeEEEEcCCCCEEEEEeCCCcEEEEEccCCceEEeeecccccC
Q psy9598         629 GGLFLATGSGDHHVRVYKMDGVDSPLGILEVEEHSDKVDSIQWSHSHLRFVSGSRDGTALIWYYKCSQWRFIRLDMNTCL  708 (1915)
Q Consensus       629 dg~~Lasgs~Dg~I~IwDl~~~~~~~~i~~l~~h~~~V~sl~fspdg~~L~sgs~DG~I~IWDl~~~~~~~~~~~~~~~~  708 (1915)
                      ++.+|++|+.||.|++|++.   ....+..+.+|...+.+++|++++..+......+.                      
T Consensus       154 ~~~~l~~~~~d~~v~~~~~~---~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~----------------------  208 (317)
T d1vyhc1         154 DGTLIASCSNDQTVRVWVVA---TKECKAELREHRHVVECISWAPESSYSSISEATGS----------------------  208 (317)
T ss_dssp             TSSEEEEEETTSCEEEEETT---TCCEEEEECCCSSCEEEEEECCSCGGGGGGGCCSC----------------------
T ss_pred             CCCEEEEEeCCCeEEEEeec---cceeeEEEecCCCCceEEEEeeccccceeeccccc----------------------
Confidence            99999999999999999983   44567778899999999999987653322211111                      


Q ss_pred             CCCccccccccccccEEEEEECCCCCEEEEEEecCCeEEEEECCCCceEEEeeCCCCCeEEEEEccCCCCEEEEEecCce
Q psy9598         709 PHTKETSDETNKKIKVTMVAWDASDRWVITAINFNFQIKIWDAFNGDLVQVLKGHTNEVFVLESHPFDSRVLLSAGHDGL  788 (1915)
Q Consensus       709 ~~~~~~~~~~~~~~~V~~va~spdg~~L~t~s~~Dg~I~vwD~~tg~~i~~l~gH~~~V~sl~~sp~dg~~LaSgs~DG~  788 (1915)
                                      ....+...+.++++++. |+.|++||+.++.++..+.+|...|.+++|+| ++.+|++|+.||.
T Consensus       209 ----------------~~~~~~~~~~~~~~~~~-d~~i~~~~~~~~~~~~~~~~~~~~v~~~~~~~-~~~~l~s~~~dg~  270 (317)
T d1vyhc1         209 ----------------ETKKSGKPGPFLLSGSR-DKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHS-GGKFILSCADDKT  270 (317)
T ss_dssp             ----------------C-------CCEEEEEET-TSEEEEEETTTTEEEEEEECCSSCEEEEEECS-SSSCEEEEETTTE
T ss_pred             ----------------eeeeeccCCceeEeccC-CCEEEEEECCCCcEEEEEeCCCCCEEEEEECC-CCCEEEEEECCCe
Confidence                            11233456778888887 99999999999999999999999999999999 9999999999999


Q ss_pred             EEEEECCCCccccceeeeeeecCCCCcceEEEEEcCCCCEEEEEeCCCeEEEEe
Q psy9598         789 IIIWDILSSKQRGYKWFHNIVEGQGEGALFDGKWSPDGTTCALTDSYGHLLVYG  842 (1915)
Q Consensus       789 I~IWdl~s~~~~~~~~~~~~~~~~~~~~V~~vafSpdg~~Lasg~~dG~I~Iwd  842 (1915)
                      |+|||+.++++  +..+.     .|.+.|++++|+|++.+||+|+.||.|+||+
T Consensus       271 i~iwd~~~~~~--~~~~~-----~h~~~V~~~~~s~~~~~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         271 LRVWDYKNKRC--MKTLN-----AHEHFVTSLDFHKTAPYVVTGSVDQTVKVWE  317 (317)
T ss_dssp             EEEECCTTSCC--CEEEE-----CCSSCEEEEEECSSSSCEEEEETTSEEEEEC
T ss_pred             EEEEECCCCcE--EEEEc-----CCCCCEEEEEEcCCCCEEEEEeCCCeEEEeC
Confidence            99999999988  76665     4678999999999999999999999999996



>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure