Psyllid ID: psy9627

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MNWASRAMTYKPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKVGS
cccccccccccccccEEEEEccccHHHHHHHHHHcccccEEEEccccccccccEEEEEEEccccHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHccccEEEEccccccHHHHHHHHccc
cccccccccccccccEEEEEcccHHHHHHHHHHHHHccEEEEEccccccccccEEEEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHccc
mnwasramtykpdrqvlmwsatwprEVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGllndisskdenkTIIFAETKRKVDKITKSIQNYGwaavgihgdksqqERDYVLKVGS
mnwasramtykpdrqvlmwsATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFgllndisskdenktiifaetkrkvdkITKSIQNYgwaavgihgdksqqerDYVLKVGS
MNWASRAMTYKPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKVGS
************DRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHG***************
******A*TYKPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKVGS
********TYKPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKVGS
****SRAMTYKPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKVG*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNWASRAMTYKPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKVGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
A5A6J2 614 Probable ATP-dependent RN yes N/A 0.891 0.187 0.643 7e-41
Q61656 614 Probable ATP-dependent RN yes N/A 0.891 0.187 0.643 7e-41
Q5R4I9 614 Probable ATP-dependent RN yes N/A 0.891 0.187 0.643 7e-41
P17844 614 Probable ATP-dependent RN yes N/A 0.891 0.187 0.643 7e-41
Q92841 729 Probable ATP-dependent RN no N/A 0.891 0.157 0.626 1e-40
Q501J6 650 Probable ATP-dependent RN no N/A 0.891 0.176 0.626 4e-40
Q4R6M5 614 Probable ATP-dependent RN N/A N/A 0.891 0.187 0.634 4e-40
P19109 719 ATP-dependent RNA helicas no N/A 0.899 0.161 0.635 1e-38
Q4PHU9 552 ATP-dependent RNA helicas N/A N/A 0.883 0.206 0.591 5e-36
Q6C4D4 552 ATP-dependent RNA helicas yes N/A 0.891 0.208 0.6 1e-35
>sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 Back     alignment and function desciption
 Score =  165 bits (418), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 95/115 (82%)

Query: 11  KPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKL 70
           +PDRQ LMWSATWP+EV++LAEDFL  YI INIG+L LSANHNI Q+V+VC + EK+ KL
Sbjct: 270 RPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKL 329

Query: 71  FGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVL 125
             L+ +I S+ ENKTI+F ETKR+ D++T+ ++  GW A+GIHGDKSQQERD+VL
Sbjct: 330 IRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVL 384
Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for estrogen receptor ESR1 and androgen receptor AR. Increases ESR1 AF-1 domain-mediated transactivation and ESR1 AF-1 and AF-2 domains transcriptional synergistic activity. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specicic manner; the function probbaly involves association with histone deacetylases, such as HDAC1.
Pan troglodytes (taxid: 9598)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 Back     alignment and function description
>sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 Back     alignment and function description
>sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 Back     alignment and function description
>sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 Back     alignment and function description
>sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=2 SV=1 Back     alignment and function description
>sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 Back     alignment and function description
>sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 Back     alignment and function description
>sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 Back     alignment and function description
>sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
328697427 551 PREDICTED: ATP-dependent RNA helicase p6 0.899 0.210 0.758 1e-45
328697425 516 PREDICTED: ATP-dependent RNA helicase p6 0.899 0.224 0.758 1e-45
345497627 634 PREDICTED: probable ATP-dependent RNA he 0.891 0.181 0.730 1e-44
307191878 465 Probable ATP-dependent RNA helicase DDX5 0.891 0.247 0.730 1e-44
322796814 1201 hypothetical protein SINV_01003 [Solenop 0.891 0.095 0.730 1e-44
340725185 607 PREDICTED: LOW QUALITY PROTEIN: probable 0.891 0.189 0.730 1e-44
350412507 619 PREDICTED: probable ATP-dependent RNA he 0.891 0.185 0.730 1e-44
332020302 570 Putative ATP-dependent RNA helicase DDX5 0.891 0.201 0.730 1e-44
380027510 623 PREDICTED: probable ATP-dependent RNA he 0.891 0.184 0.730 2e-44
328779158 616 PREDICTED: probable ATP-dependent RNA he 0.891 0.186 0.730 2e-44
>gi|328697427|ref|XP_001946984.2| PREDICTED: ATP-dependent RNA helicase p62-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/116 (75%), Positives = 99/116 (85%)

Query: 11  KPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKL 70
           +PDRQVLMWSATWP+EVQKLA DFL  YIQ+N+GSLTLSANHNI Q V+VC EHEKE+KL
Sbjct: 313 RPDRQVLMWSATWPKEVQKLANDFLSDYIQLNVGSLTLSANHNILQNVDVCQEHEKEDKL 372

Query: 71  FGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLK 126
             LL DI++ +ENKTIIFAETKRKVD IT+ I N G  AVGIHGDKSQ ERD+VLK
Sbjct: 373 MDLLQDIANMEENKTIIFAETKRKVDTITRKITNMGARAVGIHGDKSQSERDHVLK 428

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328697425|ref|XP_003240334.1| PREDICTED: ATP-dependent RNA helicase p62-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345497627|ref|XP_001602045.2| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307191878|gb|EFN75297.1| Probable ATP-dependent RNA helicase DDX5 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322796814|gb|EFZ19232.1| hypothetical protein SINV_01003 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340725185|ref|XP_003400954.1| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase DDX5-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350412507|ref|XP_003489671.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332020302|gb|EGI60733.1| Putative ATP-dependent RNA helicase DDX5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380027510|ref|XP_003697466.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Apis florea] Back     alignment and taxonomy information
>gi|328779158|ref|XP_001122489.2| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
FB|FBgn0035720 818 CG10077 [Drosophila melanogast 0.891 0.140 0.686 1.8e-39
ZFIN|ZDB-GENE-030131-925 617 ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.891 0.186 0.660 9.7e-39
UNIPROTKB|B4DLW8 535 DDX5 "Probable ATP-dependent R 0.891 0.214 0.643 2.6e-38
UNIPROTKB|F1MBQ8 614 DDX5 "Uncharacterized protein" 0.891 0.187 0.643 4.6e-38
UNIPROTKB|J3KTA4 614 DDX5 "Probable ATP-dependent R 0.891 0.187 0.643 4.6e-38
UNIPROTKB|P17844 614 DDX5 "Probable ATP-dependent R 0.891 0.187 0.643 4.6e-38
UNIPROTKB|A5A6J2 614 DDX5 "Probable ATP-dependent R 0.891 0.187 0.643 4.6e-38
UNIPROTKB|Q5R4I9 614 DDX5 "Probable ATP-dependent R 0.891 0.187 0.643 4.6e-38
MGI|MGI:105037 614 Ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.891 0.187 0.643 4.6e-38
RGD|619906 615 Ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.891 0.186 0.643 4.7e-38
FB|FBgn0035720 CG10077 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 429 (156.1 bits), Expect = 1.8e-39, P = 1.8e-39
 Identities = 79/115 (68%), Positives = 100/115 (86%)

Query:    11 KPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKL 70
             +PDRQVLMWSATWP+EV++LAE+FL++YIQ+NIGSL+LSANHNI Q+V+VC E+EK  KL
Sbjct:   333 RPDRQVLMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNILQIVDVCDENEKLMKL 392

Query:    71 FGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVL 125
               LL DIS+++E KTIIF ETK++VD+IT++I   GW A  IHGDKSQQERD+VL
Sbjct:   393 IKLLTDISAENETKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVL 447
GO:0003724 "RNA helicase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IDA
ZFIN|ZDB-GENE-030131-925 ddx5 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B4DLW8 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MBQ8 DDX5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J3KTA4 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P17844 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5A6J2 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Pan troglodytes (taxid:9598)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R4I9 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:105037 Ddx5 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619906 Ddx5 "DEAD (Asp-Glu-Ala-Asp) box helicase 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q61656DDX5_MOUSE3, ., 6, ., 4, ., 1, 30.64340.89140.1872yesN/A
Q8W4R3RH30_ARATH3, ., 6, ., 4, ., 1, 30.50430.87590.1912yesN/A
Q6CIV2DBP2_KLULA3, ., 6, ., 4, ., 1, 30.54780.89140.2075yesN/A
P0CQ76DBP2_CRYNJ3, ., 6, ., 4, ., 1, 30.55650.88370.2111yesN/A
A2QC74DBP2_ASPNC3, ., 6, ., 4, ., 1, 30.56520.89140.2035yesN/A
Q5B0J9DBP2_EMENI3, ., 6, ., 4, ., 1, 30.55650.89140.2042yesN/A
Q6BY27DBP2_DEBHA3, ., 6, ., 4, ., 1, 30.53440.89920.2164yesN/A
A5A6J2DDX5_PANTR3, ., 6, ., 4, ., 1, 30.64340.89140.1872yesN/A
A3LQW7DBP2_PICST3, ., 6, ., 4, ., 1, 30.53440.89920.2188yesN/A
P17844DDX5_HUMAN3, ., 6, ., 4, ., 1, 30.64340.89140.1872yesN/A
Q6FLF3DBP2_CANGA3, ., 6, ., 4, ., 1, 30.56520.89140.2113yesN/A
Q5R4I9DDX5_PONAB3, ., 6, ., 4, ., 1, 30.64340.89140.1872yesN/A
Q4X195DBP2_ASPFU3, ., 6, ., 4, ., 1, 30.56520.89140.2102yesN/A
Q755N4DBP2_ASHGO3, ., 6, ., 4, ., 1, 30.57750.88370.2046yesN/A
Q2U070DBP2_ASPOR3, ., 6, ., 4, ., 1, 30.56520.89140.2075yesN/A
P24783DBP2_YEAST3, ., 6, ., 4, ., 1, 30.56030.89920.2124yesN/A
P24782DBP2_SCHPO3, ., 6, ., 4, ., 1, 30.50430.89140.2090yesN/A
Q6C4D4DBP2_YARLI3, ., 6, ., 4, ., 1, 30.60.89140.2083yesN/A
Q4IF76DBP2_GIBZE3, ., 6, ., 4, ., 1, 30.53910.89140.2072yesN/A
Q54CE0DDX17_DICDI3, ., 6, ., 4, ., 1, 30.52170.87590.1439yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
PTZ00110 545 PTZ00110, PTZ00110, helicase; Provisional 1e-41
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 6e-27
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 9e-17
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 1e-11
PLN00206 518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 1e-10
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 6e-10
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-09
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 4e-09
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-08
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 2e-07
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-04
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 0.001
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information 
 Score =  143 bits (363), Expect = 1e-41
 Identities = 62/116 (53%), Positives = 80/116 (68%), Gaps = 2/116 (1%)

Query: 11  KPDRQVLMWSATWPREVQKLAEDFL-DSYIQINIGSLTLSANHNIQQVVEVCAEHEKENK 69
           +PDRQ LMWSATWP+EVQ LA D   +  + +N+GSL L+A HNI+Q V V  EHEK  K
Sbjct: 306 RPDRQTLMWSATWPKEVQSLARDLCKEEPVHVNVGSLDLTACHNIKQEVFVVEEHEKRGK 365

Query: 70  LFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVL 125
           L  LL  I  +D +K +IF ETK+  D +TK ++  GW A+ IHGDK Q+ER +VL
Sbjct: 366 LKMLLQRIM-RDGDKILIFVETKKGADFLTKELRLDGWPALCIHGDKKQEERTWVL 420

Length = 545
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
KOG0328|consensus400 99.95
KOG0331|consensus 519 99.93
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.93
KOG0330|consensus 476 99.92
KOG0343|consensus 758 99.9
KOG0333|consensus 673 99.88
KOG0332|consensus477 99.87
KOG0326|consensus459 99.87
KOG0339|consensus 731 99.86
KOG0342|consensus 543 99.86
KOG0341|consensus 610 99.86
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 99.86
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.84
PTZ00110 545 helicase; Provisional 99.84
KOG0327|consensus397 99.84
KOG0345|consensus 567 99.84
KOG0338|consensus 691 99.84
KOG0340|consensus 442 99.83
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 99.82
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 99.81
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 99.8
KOG0336|consensus 629 99.8
KOG0335|consensus482 99.78
KOG4284|consensus 980 99.78
KOG0334|consensus 997 99.77
KOG0346|consensus 569 99.77
KOG0337|consensus 529 99.77
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 99.76
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 99.76
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.75
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 99.75
PTZ00424401 helicase 45; Provisional 99.73
KOG0348|consensus 708 99.66
KOG0347|consensus 731 99.61
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.51
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 99.51
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 99.51
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.51
PRK10689 1147 transcription-repair coupling factor; Provisional 99.51
PRK09401 1176 reverse gyrase; Reviewed 99.51
PHA02653 675 RNA helicase NPH-II; Provisional 99.51
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.5
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 99.49
KOG0344|consensus 593 99.48
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 99.48
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.47
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.43
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.42
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.38
COG1202 830 Superfamily II helicase, archaea-specific [General 99.37
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.37
PRK14701 1638 reverse gyrase; Provisional 99.36
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.33
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.3
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.2
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.16
KOG0329|consensus387 99.15
KOG0351|consensus 941 99.13
PRK13767 876 ATP-dependent helicase; Provisional 99.08
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 98.99
PRK00254 720 ski2-like helicase; Provisional 98.98
PRK02362 737 ski2-like helicase; Provisional 98.95
KOG0350|consensus 620 98.93
PHA02558 501 uvsW UvsW helicase; Provisional 98.91
PRK09694 878 helicase Cas3; Provisional 98.91
PRK01172 674 ski2-like helicase; Provisional 98.86
PRK09200 790 preprotein translocase subunit SecA; Reviewed 98.83
KOG0349|consensus 725 98.83
PRK04914 956 ATP-dependent helicase HepA; Validated 98.83
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 98.82
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 98.81
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 98.76
COG1201 814 Lhr Lhr-like helicases [General function predictio 98.74
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.73
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 98.71
PRK05298 652 excinuclease ABC subunit B; Provisional 98.7
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 98.66
KOG0353|consensus 695 98.62
PRK12904 830 preprotein translocase subunit SecA; Reviewed 98.61
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 98.58
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 98.57
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 98.53
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.51
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 98.4
PRK13766 773 Hef nuclease; Provisional 98.33
KOG0352|consensus 641 98.22
COG1205 851 Distinct helicase family with a unique C-terminal 98.18
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 98.08
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.86
TIGR00595 505 priA primosomal protein N'. All proteins in this f 97.8
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 97.73
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 97.64
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 97.63
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 97.62
COG1204 766 Superfamily II helicase [General function predicti 97.53
KOG0922|consensus 674 97.47
PRK05580 679 primosome assembly protein PriA; Validated 97.36
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 97.27
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.13
KOG0951|consensus 1674 97.06
KOG0354|consensus 746 96.9
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 96.9
KOG1002|consensus 791 96.85
smart0049082 HELICc helicase superfamily c-terminal domain. 96.81
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 96.75
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 96.71
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 96.66
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 96.66
KOG0948|consensus 1041 96.55
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 96.41
PRK12326 764 preprotein translocase subunit SecA; Reviewed 96.31
COG4098441 comFA Superfamily II DNA/RNA helicase required for 96.06
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 95.86
KOG0952|consensus 1230 95.85
KOG0947|consensus 1248 95.77
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 95.68
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 95.67
KOG0923|consensus 902 95.67
KOG0385|consensus 971 95.63
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 95.55
CHL00122 870 secA preprotein translocase subunit SecA; Validate 95.45
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 95.32
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 95.18
KOG0950|consensus 1008 95.18
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 95.18
KOG0390|consensus 776 95.13
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 95.12
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 95.07
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 95.07
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 95.06
KOG0920|consensus 924 95.04
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 94.97
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 94.92
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 94.87
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 94.81
KOG0925|consensus 699 94.72
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 94.6
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 94.56
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 94.52
KOG0384|consensus 1373 94.43
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 94.4
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 94.39
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 94.37
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 94.34
KOG1000|consensus 689 94.22
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 94.21
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 94.07
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 93.99
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 93.95
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 93.9
KOG0392|consensus 1549 93.89
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 93.58
COG1198 730 PriA Primosomal protein N' (replication factor Y) 93.55
KOG0391|consensus 1958 93.51
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 93.33
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 93.21
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 93.2
PLN02160136 thiosulfate sulfurtransferase 93.19
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 93.08
TIGR00595 505 priA primosomal protein N'. All proteins in this f 93.03
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 93.0
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 92.79
PRK05580 679 primosome assembly protein PriA; Validated 92.73
PRK14873 665 primosome assembly protein PriA; Provisional 92.48
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 92.26
KOG0924|consensus 1042 92.22
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 92.17
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 92.11
PRK05320257 rhodanese superfamily protein; Provisional 92.04
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 91.99
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 91.85
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 91.78
PRK01415247 hypothetical protein; Validated 91.62
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 91.23
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 91.23
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 90.81
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 90.54
KOG1123|consensus 776 90.19
PRK06646154 DNA polymerase III subunit chi; Provisional 90.16
PLN02723320 3-mercaptopyruvate sulfurtransferase 90.15
KOG0926|consensus 1172 90.01
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 89.96
PRK05728142 DNA polymerase III subunit chi; Validated 89.89
smart00487201 DEXDc DEAD-like helicases superfamily. 89.77
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 89.71
KOG0389|consensus 941 89.52
KOG0387|consensus 923 89.4
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 89.02
KOG0347|consensus 731 88.62
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 88.56
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 88.25
PF04364137 DNA_pol3_chi: DNA polymerase III chi subunit, HolC 87.93
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 87.79
KOG0388|consensus1185 87.58
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 87.03
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 86.93
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 86.77
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 86.64
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 86.5
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 86.14
KOG4439|consensus 901 85.75
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 85.63
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 85.31
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 84.78
smart00115 241 CASc Caspase, interleukin-1 beta converting enzyme 84.71
PRK05600370 thiamine biosynthesis protein ThiF; Validated 84.4
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 84.28
PLN02723 320 3-mercaptopyruvate sulfurtransferase 84.22
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 83.94
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 83.33
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 83.04
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 83.02
PF13307 167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 82.57
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 82.42
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 82.14
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 82.02
KOG4150|consensus 1034 81.93
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 81.15
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 81.04
PRK07411390 hypothetical protein; Validated 80.56
PRK13766 773 Hef nuclease; Provisional 80.35
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 80.23
>KOG0328|consensus Back     alignment and domain information 
Probab=99.95  E-value=7e-28  Score=164.72  Aligned_cols=120  Identities=27%  Similarity=0.388  Sum_probs=112.7

Q ss_pred             hhhccCCCCceEEEEEecCcHHHHHHHHHhccCccEEEeCCCCcccCCCceEEEEEcCc-cchHHHHHHHHHhhhcCCCC
Q psy9627           5 SRAMTYKPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAE-HEKENKLFGLLNDISSKDEN   83 (129)
Q Consensus         5 ~il~~l~~~~Q~ll~SAT~~~~v~~~~~~~~~~~~~i~~~~~~~~~~~~i~~~~~~~~~-~~k~~~L~~ll~~~~~~~~~   83 (129)
                      +|.+.+||..|++++|||+|.++.+....|+.+|+.|.+..++ .+.++++|+|+.++. ++|.+.|++++..+   ...
T Consensus       192 diyr~lp~~~Qvv~~SATlp~eilemt~kfmtdpvrilvkrde-ltlEgIKqf~v~ve~EewKfdtLcdLYd~L---tIt  267 (400)
T KOG0328|consen  192 DIYRYLPPGAQVVLVSATLPHEILEMTEKFMTDPVRILVKRDE-LTLEGIKQFFVAVEKEEWKFDTLCDLYDTL---TIT  267 (400)
T ss_pred             HHHHhCCCCceEEEEeccCcHHHHHHHHHhcCCceeEEEecCC-CchhhhhhheeeechhhhhHhHHHHHhhhh---ehh
Confidence            5788999999999999999999999999999999999999888 566899999999988 45999999999975   578


Q ss_pred             cEEEEecccccHHHHHHHHHhcCceEEEecCCCChhHHHHHHhcC
Q psy9627          84 KTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKVG  128 (129)
Q Consensus        84 ~~iVF~nt~~~~~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~~  128 (129)
                      +++|||||++.++|+.+.|+..++.+.++||+|+|++|++++++|
T Consensus       268 QavIFcnTk~kVdwLtekm~~~nftVssmHGDm~qkERd~im~dF  312 (400)
T KOG0328|consen  268 QAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMEQKERDKIMNDF  312 (400)
T ss_pred             eEEEEecccchhhHHHHHHHhhCceeeeccCCcchhHHHHHHHHh
Confidence            999999999999999999999999999999999999999999987

>KOG0331|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>PRK06646 DNA polymerase III subunit chi; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>PRK05728 DNA polymerase III subunit chi; Validated Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF04364 DNA_pol3_chi: DNA polymerase III chi subunit, HolC; InterPro: IPR007459 The DNA polymerase III holoenzyme (2 Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>smart00115 CASc Caspase, interleukin-1 beta converting enzyme (ICE) homologues Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 8e-18
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 3e-15
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 2e-12
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 1e-11
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 2e-10
2vso_A395 Crystal Structure Of A Translation Initiation Compl 3e-09
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 5e-09
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 6e-09
2hyi_C413 Structure Of The Human Exon Junction Complex With A 7e-09
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 7e-09
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 7e-09
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 7e-09
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 3e-08
1fuu_A394 Yeast Initiation Factor 4a Length = 394 6e-08
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 7e-08
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 7e-08
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 2e-07
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 2e-07
2jgn_A185 Ddx3 Helicase Domain Length = 185 7e-07
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 1e-06
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 3e-06
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 1e-04
3fho_B 508 Structure Of S. Pombe Dbp5 Length = 508 5e-04
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 7e-04
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure 
Iteration: 1

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 46/118 (38%), Positives = 72/118 (61%), Gaps = 3/118 (2%)
Query: 8   MTYKPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKE 67
           M  K  R  +M+SAT+P+E+Q LA DFLD YI + +G +  S + NI Q V    E +K 
Sbjct: 205 MPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVG-STSENITQKVVWVEESDKR 263
Query: 68  NKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVL 125
           + L  LLN  ++  ++ T++F ETK+  D +   + + G+A   IHGD+SQ++R+  L
Sbjct: 264 SFLLDLLN--ATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEAL 319
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 3e-57
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 5e-56
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 6e-37
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 6e-37
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 9e-27
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 5e-26
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-25
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 3e-25
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 4e-25
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-24
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 8e-24
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 3e-23
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 4e-23
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 4e-23
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-22
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 2e-21
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-20
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-20
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 3e-20
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 1e-17
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 2e-16
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 1e-15
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 5e-15
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 2e-14
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 1e-13
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 2e-13
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 3e-12
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 7e-12
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 8e-12
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 2e-05
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 3e-05
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 4e-05
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 5e-05
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 6e-05
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 8e-05
3bor_A237 Human initiation factor 4A-II; translation initiat 1e-04
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
 Score =  181 bits (463), Expect = 3e-57
 Identities = 38/119 (31%), Positives = 70/119 (58%), Gaps = 5/119 (4%)

Query: 8   MTYKPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKE 67
           +T +P+ Q LM+SAT+P E+Q++A +FL +Y+ + IG +   A  +++Q +    ++ K 
Sbjct: 231 VTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVG-GACSDVKQTIYEVNKYAKR 289

Query: 68  NKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLK 126
           +KL  +L++      + TI+F ETKR  D +   +    +    IHGD+ Q +R+  L+
Sbjct: 290 SKLIEILSE----QADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALR 344
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 99.84
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.76
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 99.76
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.76
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 99.74
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.73
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.72
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.71
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.7
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.67
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.67
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.65
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 99.59
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 99.59
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 99.59
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.58
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 99.58
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.57
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.54
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.52
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.52
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 99.49
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 99.43
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 99.39
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.37
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.37
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.05
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 99.35
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.27
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.26
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 99.21
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.19
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.18
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.16
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.13
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.08
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 99.03
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.01
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.01
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.01
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 99.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.99
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 98.98
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 98.97
1yks_A 440 Genome polyprotein [contains: flavivirin protease 98.96
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 98.93
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 98.92
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 98.9
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 98.88
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 98.86
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 98.86
4gl2_A 699 Interferon-induced helicase C domain-containing P; 98.82
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 98.8
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 98.76
1z5z_A 271 Helicase of the SNF2/RAD54 family; hydrolase, reco 98.75
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 98.74
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.72
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 98.7
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 98.64
3h1t_A590 Type I site-specific restriction-modification syst 98.62
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 98.6
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 98.57
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 98.54
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 98.52
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 98.4
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 98.39
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 98.38
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 98.31
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 98.26
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.25
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 98.17
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.12
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 97.99
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 97.95
3bor_A237 Human initiation factor 4A-II; translation initiat 97.94
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 97.94
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 97.91
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 97.9
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 97.87
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 97.83
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 97.77
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 97.72
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 97.34
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 96.84
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 96.67
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 96.11
2jtq_A85 Phage shock protein E; solution structure rhodanes 95.99
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 95.72
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 95.68
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 95.62
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 95.61
3foj_A100 Uncharacterized protein; protein SSP1007, structur 95.54
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 95.54
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 95.32
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 95.15
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 94.89
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 94.83
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 94.76
1tq1_A129 AT5G66040, senescence-associated family protein; C 94.69
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 94.6
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 94.48
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 94.46
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 94.14
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 94.08
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 93.98
1vee_A134 Proline-rich protein family; hypothetical protein, 93.92
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 93.61
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 92.99
3hgt_A 328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 92.9
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 92.62
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 92.38
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 91.89
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 91.89
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 91.23
2l82_A 162 Designed protein OR32; structural genomics, northe 91.19
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 91.09
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 90.82
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 90.74
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 90.19
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 90.17
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 90.07
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 89.96
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 89.79
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 89.71
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 89.67
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 89.63
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 89.48
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 88.93
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 88.61
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 88.34
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 88.26
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 88.14
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 87.95
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 87.74
3h11_A 272 CAsp8 and FADD-like apoptosis regulator; cell deat 87.63
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 87.58
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 87.57
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 87.25
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 86.79
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 86.16
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 86.0
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 85.93
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 85.81
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 85.75
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 85.65
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 85.64
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 85.55
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 85.43
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 84.7
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 84.55
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 84.4
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 84.22
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 84.15
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 83.73
2h54_A178 Caspase-1; allosteric site, dimer interface, hydro 83.65
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 83.08
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 83.01
3h11_B 271 Caspase-8; cell death, apoptosis, caspase, alterna 82.98
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 82.61
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 82.09
3e4c_A 302 Caspase-1; zymogen, inflammasome, ICE, IL-1B, inna 81.86
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 81.15
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 80.95
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 80.68
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 80.22
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=99.84  E-value=6.7e-20  Score=133.95  Aligned_cols=113  Identities=33%  Similarity=0.581  Sum_probs=103.2

Q ss_pred             CCCceEEEEEecCcHHHHHHHHHhccCccEEEeCCCCcccCCCceEEEEEcCccchHHHHHHHHHhhhcCCCCcEEEEec
Q psy9627          11 KPDRQVLMWSATWPREVQKLAEDFLDSYIQINIGSLTLSANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAE   90 (129)
Q Consensus        11 ~~~~Q~ll~SAT~~~~v~~~~~~~~~~~~~i~~~~~~~~~~~~i~~~~~~~~~~~k~~~L~~ll~~~~~~~~~~~iVF~n   90 (129)
                      ++.+|+++||||+|+.+.+++..++.++..+.++... ....++.|.++.+....|...|..++...    ..++||||+
T Consensus       234 ~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~-~~~~~i~~~~~~~~~~~k~~~l~~~l~~~----~~~~lVF~~  308 (434)
T 2db3_A          234 RPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVG-GACSDVKQTIYEVNKYAKRSKLIEILSEQ----ADGTIVFVE  308 (434)
T ss_dssp             CSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTT-CCCTTEEEEEEECCGGGHHHHHHHHHHHC----CTTEEEECS
T ss_pred             CCCceEEEEeccCCHHHHHHHHHhccCCEEEEecccc-ccccccceEEEEeCcHHHHHHHHHHHHhC----CCCEEEEEe
Confidence            6789999999999999999999999999999888766 56678999999999999999999888863    345999999


Q ss_pred             ccccHHHHHHHHHhcCceEEEecCCCChhHHHHHHhcC
Q psy9627          91 TKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKVG  128 (129)
Q Consensus        91 t~~~~~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~~  128 (129)
                      |++.|+.+++.|...|+++..+||++++.+|.++++.|
T Consensus       309 t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F  346 (434)
T 2db3_A          309 TKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDF  346 (434)
T ss_dssp             SHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHH
T ss_pred             CcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999876
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3h11_A CAsp8 and FADD-like apoptosis regulator; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} PDB: 3h13_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2h54_A Caspase-1; allosteric site, dimer interface, hydrolase; HET: PHQ; 1.80A {Homo sapiens} PDB: 1rwm_A* 1rwk_A* 1rwo_A* 1rwp_A* 1rwv_A* 1rww_A* 1rwn_A* 2h48_A* 2h4w_A* 1rwx_A* 2hbq_A* 2hby_A* 1ibc_A 3d6m_A* 2h4y_A* 2h51_A* 3d6f_A* 3d6h_A* 2hbz_A* 2hbr_A* ... Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3h11_B Caspase-8; cell death, apoptosis, caspase, alternative splicing, HOST- virus interaction, polymorphism, cytoplasm, disease mutation; 1.90A {Homo sapiens} SCOP: c.17.1.1 PDB: 2k7z_A 1i4e_B 2fun_B 2c2z_B* Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>3e4c_A Caspase-1; zymogen, inflammasome, ICE, IL-1B, innate immunity, apoptosis, hydrolase, protease protease; 2.05A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 4e-11
d1gkub2 248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 1e-10
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 3e-10
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 3e-09
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 6e-09
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 8e-09
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 1e-08
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 1e-08
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 2e-08
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 3e-08
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 7e-08
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 1e-06
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-06
d1oywa3 200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 4e-06
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 5e-06
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 2e-05
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 4e-05
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 9e-05
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 4e-04
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 0.001
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 0.002
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: HCV helicase domain
species: Human hepatitis C virus (HCV), different isolates [TaxId: 11103]

 Score = 56.5 bits (136), Expect = 4e-11
 Identities = 17/79 (21%), Positives = 30/79 (37%), Gaps = 6/79 (7%)

Query: 44  GSLTLSANH-NIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSI 102
           GS+T    H NI++V         E   +G    +      + +IF  +K+K D++   +
Sbjct: 2   GSVT--VPHPNIEEVALST---TGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKL 56

Query: 103 QNYGWAAVGIHGDKSQQER 121
              G  AV  +        
Sbjct: 57  VALGINAVAYYRGLDVSVI 75
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.68
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.68
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.66
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.64
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.61
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.6
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.41
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.38
d1t5la2 181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.25
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.15
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 98.84
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 98.63
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 98.61
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 98.61
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 98.58
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 98.57
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 98.57
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.53
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 98.5
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.43
d1z5za1 244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.43
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 98.42
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.39
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 98.34
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 98.28
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 98.25
d2eyqa5 211 Transcription-repair coupling factor, TRCF {Escher 98.04
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 97.7
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 97.51
d1gm5a4 206 RecG helicase domain {Thermotoga maritima [TaxId: 97.43
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 96.58
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 96.46
d1nkta4 219 Translocation ATPase SecA, nucleotide-binding doma 96.44
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 96.16
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 96.05
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 95.88
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 95.57
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 95.05
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 94.83
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 94.41
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 93.44
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 93.11
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 92.55
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 92.37
d2eyqa2117 Transcription-repair coupling factor, TRCF {Escher 92.34
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 91.94
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 90.91
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 89.59
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 89.24
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 89.04
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 88.9
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 87.67
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 87.52
g1qtn.1 242 Caspase-8 {Human (Homo sapiens) [TaxId: 9606]} 86.01
d1tf5a3 273 Translocation ATPase SecA, nucleotide-binding doma 85.97
g1pyo.1 257 Caspase-2 {Human (Homo sapiens) [TaxId: 9606]} 85.88
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 83.65
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 83.1
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 82.93
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 82.21
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 82.05
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative ATP-dependent RNA helicase DHH1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.68  E-value=8.6e-17  Score=102.79  Aligned_cols=76  Identities=26%  Similarity=0.343  Sum_probs=71.2

Q ss_pred             cCCCceEEEEEcCccchHHHHHHHHHhhhcCCCCcEEEEecccccHHHHHHHHHhcCceEEEecCCCChhHHHHHHhcC
Q psy9627          50 ANHNIQQVVEVCAEHEKENKLFGLLNDISSKDENKTIIFAETKRKVDKITKSIQNYGWAAVGIHGDKSQQERDYVLKVG  128 (129)
Q Consensus        50 ~~~~i~~~~~~~~~~~k~~~L~~ll~~~~~~~~~~~iVF~nt~~~~~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~~  128 (129)
                      +.++++|+|+.+++.+|...|..+++.   .+..++||||||++.|+.++..|...|+++..+||+|++++|.++++.|
T Consensus         3 tl~~i~q~yi~v~~~~K~~~L~~ll~~---~~~~k~iVF~~~~~~~~~l~~~L~~~g~~~~~~h~~~~~~~r~~~~~~f   78 (171)
T d1s2ma2           3 TLKGITQYYAFVEERQKLHCLNTLFSK---LQINQAIIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEF   78 (171)
T ss_dssp             BCTTEEEEEEECCGGGHHHHHHHHHHH---SCCSEEEEECSSHHHHHHHHHHHHHHTCCEEEECTTSCHHHHHHHHHHH
T ss_pred             CccceEEEEEEcCHHHHHHHHHHHHHh---CCCCceEEEEeeeehhhHhHHhhhcccccccccccccchhhhhhhhhhc
Confidence            457899999999999999999999987   4678999999999999999999999999999999999999999999876
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure