Psyllid ID: psy9637


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490
MAAKGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKGTNIIGAHSLEELVKNLKKPRRVMMLVKAGSAVDDFIDKLVPLLEKGDIIIDGGNSEYQDTDRRSKALEAKGLLYVGCGVSGGEDGARYGPSLMPGGNPAAWPALKPIFQKLNPSFETSAPTPKPQRDKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGGNSIAAKVGSEPCCDWVGEQGAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWNKGELDSFLIEITKDILKFKDTDGAPLVEKIKDYAGQKGTGKWTAISALDYGVPVTLIGESVFSRCLSSLFDERQKASQVLQGPNPTYK
ccccccccEEHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcccccccEEEEccHHHHHHHcccHHHHHHHHcccccHHHHHHHHccccccccEEEEcccccccccHHHHHHHHHccccEEEcccHHHHHHccccccccccccHHHHHHcHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccccccccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccccc
ccccEcEEEEcccHHHHHHHHHHHHccccEEEEccccHHHHHHHHccccccccEEcccHHHHHHHEccccEEEEcccccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHcccEEEEEEEEcHHHHHHHccEEEEEEccccHHHHHHHHHHHccEcccccEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccEcHHHHHHHHHHHccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEcccccccccEcccccccccHHHHEcccccEcccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccEHHHHHHHHHHHcEcccccEcHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHccccccccc
MAAKGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLAneakgtniiGAHSLEELVKNLKKPRRVMMLVKAGSAVDDFIDKLVPllekgdiiidggnseyqdtDRRSKALEAKGLLYvgcgvsggedgarygpslmpggnpaawpalkpifqklnpsfetsaptpkpqrdkKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIkaafdknpalsnllldpffkdAIHATQSSWRAVVSQSallgiptpaFATALAFYdgyrskrlpanLLQAQRDYFGAHTYellaapgkfvhtnwtghggnsiaakvgsepccdwvgeqgagHFVKMVHNGIEYGDMQLICEAYHLMTgalgmshdEMSAVFEdwnkgeldsFLIEITKDILKfkdtdgaplvEKIKdyagqkgtgkWTAISALDYGVPVTLIGESVFSRCLSSLFDERQKasqvlqgpnptyk
MAAKGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKgtniigahslEELVKNLKKPRRVMMLVkagsavddfIDKLVPLLekgdiiidggnseyqdTDRRSKALEAKGLLYVGCGVSGGEDGARYGPSLMPGGNPAAWPALKPIFQKLNPSFEtsaptpkpqrdkKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGGNSIAAKVGSEPCCDWVGEQGAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWNKGELDSFLIEITKDILKFKDTDGAPLVEKIKdyagqkgtGKWTAISALDYGVPVTLIGESVFSRCLSSLFDerqkasqvlqgpnptyk
MAAKGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKGTNIIGAHSLEELVKNLKKPRRVMMLVKAGSAVDDFIDKLVPLLEKGDIIIDGGNSEYQDTDRRSKALEAKGLLYVGCGVSGGEDGARYGPSLMPGGNPAAWPALKPIFQKLNPSFETSAPTPKPQRDKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGGNSIAAKVGSEPCCDWVGEQGAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWNKGELDSFLIEITKDILKFKDTDGAPLVEKIKDYAGQKGTGKWTAISALDYGVPVTLIGESVFSRCLSSLFDERQKASQVLQGPNPTYK
*****DIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKGTNIIGAHSLEELVKNLKKPRRVMMLVKAGSAVDDFIDKLVPLLEKGDIIIDGGN***********ALEAKGLLYVGCGVSGG******************WPAL**************************FLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGGNSIAAKVGSEPCCDWVGEQGAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWNKGELDSFLIEITKDILKFKDTDGAPLVEKIKDYAGQKGTGKWTAISALDYGVPVTLIGESVFSRCLSSLF******************
**AKGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKGTNIIGAHSLEELVKNLKKPRRVMMLVKAGSAVDDFIDKLVPLLEKGDIIIDGGNSEYQDTDRRSKALEAKGLLYVGCGVSGGEDGARYGPSLMPGGNPAAWPALKPIFQKLNPSFETSAPTPKPQRDKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGGNSIAAKVGSEPCCDWVGEQGAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWNKGELDSFLIEITKDILKFKDTDGAPLVEKIKDYAGQKGTGKWTAISALDYGVPVTLIGESVFSRCLSSLFDERQ**************
MAAKGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKGTNIIGAHSLEELVKNLKKPRRVMMLVKAGSAVDDFIDKLVPLLEKGDIIIDGGNSEYQDTDRRSKALEAKGLLYVGCGVSGGEDGARYGPSLMPGGNPAAWPALKPIFQKLNPSFE***********KKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGGNSIAAKVGSEPCCDWVGEQGAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWNKGELDSFLIEITKDILKFKDTDGAPLVEKIKDYAGQKGTGKWTAISALDYGVPVTLIGESVFSRCLSSLFDER***************
**AKGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKGTNIIGAHSLEELVKNLKKPRRVMMLVKAGSAVDDFIDKLVPLLEKGDIIIDGGNSEYQDTDRRSKALEAKGLLYVGCGVSGGEDGARYGPSLMPGGNPAAWPALKPIFQKLNPSFETSAPTPKPQRDKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGGNSIAAKVGSEPCCDWVGEQGAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWNKGELDSFLIEITKDILKFKDTDGAPLVEKIKDYAGQKGTGKWTAISALDYGVPVTLIGESVFSRCLSSLFDERQKASQVLQ*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKGTNIIGAHSLEELVKNLKKPRRVMMLVKAGSAVDDFIDKLVPLLEKGDIIIDGGNSEYQDTDRRSKALEAKGLLYVGCGVSGGEDGARYGPSLMPGGNPAAWPALKPIFQKLNPSFETSAPTPKPQRDKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGGNSIAAKVGSEPCCDWVGEQGAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWNKGELDSFLIEITKDILKFKDTDGAPLVEKIKDYAGQKGTGKWTAISALDYGVPVTLIGESVFSRCLSSLFDERQKASQVLQGPNPTYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query490 2.2.26 [Sep-21-2011]
P52209483 6-phosphogluconate dehydr yes N/A 0.359 0.364 0.679 3e-69
P41570481 6-phosphogluconate dehydr N/A N/A 0.334 0.340 0.728 6e-68
Q17761484 6-phosphogluconate dehydr yes N/A 0.310 0.314 0.748 7e-67
P00349483 6-phosphogluconate dehydr N/A N/A 0.355 0.360 0.68 9e-67
Q9DCD0483 6-phosphogluconate dehydr yes N/A 0.314 0.318 0.735 1e-65
P85968483 6-phosphogluconate dehydr yes N/A 0.314 0.318 0.722 6e-65
O60037485 6-phosphogluconate dehydr N/A N/A 0.334 0.338 0.703 1e-64
P41572481 6-phosphogluconate dehydr yes N/A 0.373 0.380 0.641 2e-64
P41573481 6-phosphogluconate dehydr N/A N/A 0.373 0.380 0.635 6e-64
P70718484 6-phosphogluconate dehydr yes N/A 0.344 0.349 0.664 3e-62
>sp|P52209|6PGD_HUMAN 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens GN=PGD PE=1 SV=3 Back     alignment and function desciption
 Score =  263 bits (671), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 123/181 (67%), Positives = 138/181 (76%), Gaps = 5/181 (2%)

Query: 162 NPSFETSAPTPKPQR-----DKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLN 216
           +   + S     PQ+     DKK FLE+IR+ALYASKI+SYAQGFML+RQAA   GW LN
Sbjct: 295 DERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLN 354

Query: 217 YGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSA 276
           YGGIALMWRGGCIIRSVFLG IK AFD+NP L NLLLD FFK A+   Q SWR  VS   
Sbjct: 355 YGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGV 414

Query: 277 LLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGG 336
             GIP P F TAL+FYDGYR + LPA+L+QAQRDYFGAHTYELLA PG+F+HTNWTGHGG
Sbjct: 415 QAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGG 474

Query: 337 N 337
            
Sbjct: 475 T 475




Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH.
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 4
>sp|P41570|6PGD_CERCA 6-phosphogluconate dehydrogenase, decarboxylating OS=Ceratitis capitata GN=Pgd PE=2 SV=1 Back     alignment and function description
>sp|Q17761|6PGD_CAEEL 6-phosphogluconate dehydrogenase, decarboxylating OS=Caenorhabditis elegans GN=T25B9.9 PE=3 SV=2 Back     alignment and function description
>sp|P00349|6PGD_SHEEP 6-phosphogluconate dehydrogenase, decarboxylating OS=Ovis aries GN=PGD PE=1 SV=4 Back     alignment and function description
>sp|Q9DCD0|6PGD_MOUSE 6-phosphogluconate dehydrogenase, decarboxylating OS=Mus musculus GN=Pgd PE=2 SV=3 Back     alignment and function description
>sp|P85968|6PGD_RAT 6-phosphogluconate dehydrogenase, decarboxylating OS=Rattus norvegicus GN=Pgd PE=1 SV=1 Back     alignment and function description
>sp|O60037|6PGD_CUNEL 6-phosphogluconate dehydrogenase, decarboxylating OS=Cunninghamella elegans GN=6-PGD PE=2 SV=1 Back     alignment and function description
>sp|P41572|6PGD_DROME 6-phosphogluconate dehydrogenase, decarboxylating OS=Drosophila melanogaster GN=Pgd PE=2 SV=1 Back     alignment and function description
>sp|P41573|6PGD_DROSI 6-phosphogluconate dehydrogenase, decarboxylating OS=Drosophila simulans GN=Pgd PE=3 SV=1 Back     alignment and function description
>sp|P70718|6PGD_AGGAC 6-phosphogluconate dehydrogenase, decarboxylating OS=Aggregatibacter actinomycetemcomitans GN=gnd PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
297666494411 PREDICTED: 6-phosphogluconate dehydrogen 0.638 0.761 0.610 1e-116
348570952 1140 PREDICTED: kinesin-like protein KIF1B-li 0.689 0.296 0.506 1e-80
390352584484 PREDICTED: 6-phosphogluconate dehydrogen 0.365 0.369 0.727 3e-74
156367416484 predicted protein [Nematostella vectensi 0.365 0.369 0.727 6e-73
328710078482 PREDICTED: 6-phosphogluconate dehydrogen 0.351 0.356 0.755 6e-73
291235153484 PREDICTED: predicted protein-like [Sacco 0.365 0.369 0.722 2e-72
196007278486 expressed hypothetical protein [Trichopl 0.336 0.339 0.763 1e-71
357609752468 6-phosphogluconate dehydrogenase [Danaus 0.373 0.391 0.699 2e-71
156554573482 PREDICTED: 6-phosphogluconate dehydrogen 0.371 0.377 0.710 2e-71
405976318484 6-phosphogluconate dehydrogenase, decarb 0.353 0.357 0.724 4e-71
>gi|297666494|ref|XP_002811567.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating [Pongo abelii] Back     alignment and taxonomy information
 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 227/372 (61%), Positives = 258/372 (69%), Gaps = 59/372 (15%)

Query: 3   AKGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKGTNIIGAHSLEEL 62
           A+ DI LIGLAVMGQNLILNMNDHGF V A+NRT +KVD FLANEAKGT ++GAHSL+E+
Sbjct: 54  AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAHSLKEM 113

Query: 63  VKNLKKPRRVMMLVKAGSAVDDFIDKLVPLLEKGDIIIDGGNSEYQDTDRRSKALEAKGL 122
           V  LKKPRR+++LVKAG AVDDFI+KL                      RR + L+AKG+
Sbjct: 114 VSKLKKPRRIILLVKAGQAVDDFIEKL----------------------RRCQDLKAKGI 151

Query: 123 LYVGCGVSGGEDGARYGPSLMPGGNPAAWPALKPIFQKLNPSFETSAP------TPK--- 173
           L+VG GVSGGE+GARYGPSLMPGGN  AWP +K IFQ +     T  P      +P    
Sbjct: 152 LFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWSRSPHVGE 211

Query: 174 -----------------------PQR-----DKKEFLENIRQALYASKIVSYAQGFMLMR 205
                                  PQ+     DKK FLE+IR+ALYASKI+SYAQGFML+R
Sbjct: 212 AVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLR 271

Query: 206 QAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQ 265
           QAA   GW LNYGGIALMWRGGCIIRSVFLG IK AFD+NP L NLLLD FFK A+   Q
Sbjct: 272 QAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQ 331

Query: 266 SSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGK 325
            SWR  VS     GIP P F TAL+FYDGYR + LPANL+QAQRDYFGAHTYELLA PG+
Sbjct: 332 DSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLAKPGQ 391

Query: 326 FVHTNWTGHGGN 337
           F+HTNWTGHGG 
Sbjct: 392 FIHTNWTGHGGT 403




Source: Pongo abelii

Species: Pongo abelii

Genus: Pongo

Family: Hominidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|348570952|ref|XP_003471260.1| PREDICTED: kinesin-like protein KIF1B-like [Cavia porcellus] Back     alignment and taxonomy information
>gi|390352584|ref|XP_003727927.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating isoform 1 [Strongylocentrotus purpuratus] gi|390352586|ref|XP_003727928.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating isoform 2 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|156367416|ref|XP_001627413.1| predicted protein [Nematostella vectensis] gi|156214322|gb|EDO35313.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|328710078|ref|XP_001950254.2| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|291235153|ref|XP_002737508.1| PREDICTED: predicted protein-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|196007278|ref|XP_002113505.1| expressed hypothetical protein [Trichoplax adhaerens] gi|190583909|gb|EDV23979.1| expressed hypothetical protein [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|357609752|gb|EHJ66637.1| 6-phosphogluconate dehydrogenase [Danaus plexippus] Back     alignment and taxonomy information
>gi|156554573|ref|XP_001600933.1| PREDICTED: 6-phosphogluconate dehydrogenase, decarboxylating-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|405976318|gb|EKC40830.1| 6-phosphogluconate dehydrogenase, decarboxylating [Crassostrea gigas] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query490
UNIPROTKB|Q3ZCI4483 PGD "6-phosphogluconate dehydr 0.365 0.370 0.683 2.6e-130
UNIPROTKB|P00349483 PGD "6-phosphogluconate dehydr 0.365 0.370 0.683 8.8e-130
UNIPROTKB|Q5ZIZ0483 PGD "6-phosphogluconate dehydr 0.328 0.333 0.745 1.1e-129
UNIPROTKB|F1RIF8481 PGD "6-phosphogluconate dehydr 0.328 0.334 0.751 2.3e-129
UNIPROTKB|P52209483 PGD "6-phosphogluconate dehydr 0.326 0.331 0.75 7.9e-129
UNIPROTKB|F1PE09483 PGD "6-phosphogluconate dehydr 0.328 0.333 0.739 2.7e-128
ZFIN|ZDB-GENE-040426-2807511 pgd "phosphogluconate hydrogen 0.363 0.348 0.675 3.4e-126
MGI|MGI:97553483 Pgd "phosphogluconate dehydrog 0.469 0.476 0.556 2e-63
UNIPROTKB|B4DQJ8470 PGD "6-phosphogluconate dehydr 0.326 0.340 0.75 1.7e-124
RGD|1583832483 Pgd "phosphogluconate dehydrog 0.469 0.476 0.548 8.8e-63
UNIPROTKB|Q3ZCI4 PGD "6-phosphogluconate dehydrogenase, decarboxylating" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 663 (238.4 bits), Expect = 2.6e-130, Sum P(2) = 2.6e-130
 Identities = 123/180 (68%), Positives = 141/180 (78%)

Query:   159 QKLNPSFETSAPTPKP-QRDKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNY 217
             +++  S +   P   P + DKK FLE+IR+ALYASKI+SYAQGFML+RQAA   GW LNY
Sbjct:   296 ERIQASKKLKGPQNVPFEGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNY 355

Query:   218 GGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSAL 277
             GGIALMWRGGCIIRSVFLG IK AFD+NP L NLLLD FFK A+   Q SWR  +S    
Sbjct:   356 GGIALMWRGGCIIRSVFLGKIKDAFDRNPGLQNLLLDDFFKSAVENCQDSWRRAISTGVQ 415

Query:   278 LGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGGN 337
              GIP P F TAL+FYDGYR + LPANL+QAQRDYFGAHTYELLA PG+F+HTNWTGHGG+
Sbjct:   416 AGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGS 475


GO:0019322 "pentose biosynthetic process" evidence=IEA
GO:0009051 "pentose-phosphate shunt, oxidative branch" evidence=IEA
GO:0004616 "phosphogluconate dehydrogenase (decarboxylating) activity" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
UNIPROTKB|P00349 PGD "6-phosphogluconate dehydrogenase, decarboxylating" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIZ0 PGD "6-phosphogluconate dehydrogenase, decarboxylating" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIF8 PGD "6-phosphogluconate dehydrogenase, decarboxylating" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P52209 PGD "6-phosphogluconate dehydrogenase, decarboxylating" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PE09 PGD "6-phosphogluconate dehydrogenase, decarboxylating" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2807 pgd "phosphogluconate hydrogenase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:97553 Pgd "phosphogluconate dehydrogenase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B4DQJ8 PGD "6-phosphogluconate dehydrogenase, decarboxylating" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1583832 Pgd "phosphogluconate dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O833516PGD_TREPA1, ., 1, ., 1, ., 4, 40.50490.41220.4139yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.766
4th Layer1.1.1.440.824

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
pfam00393290 pfam00393, 6PGD, 6-phosphogluconate dehydrogenase, 3e-99
PRK09287459 PRK09287, PRK09287, 6-phosphogluconate dehydrogena 5e-98
PRK09287 459 PRK09287, PRK09287, 6-phosphogluconate dehydrogena 4e-94
COG0362473 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Ca 3e-92
COG0362473 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Ca 5e-92
COG0362 473 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Ca 2e-91
TIGR00873467 TIGR00873, gnd, 6-phosphogluconate dehydrogenase ( 1e-89
PRK09287459 PRK09287, PRK09287, 6-phosphogluconate dehydrogena 3e-88
TIGR00873467 TIGR00873, gnd, 6-phosphogluconate dehydrogenase ( 3e-87
TIGR00873 467 TIGR00873, gnd, 6-phosphogluconate dehydrogenase ( 6e-87
pfam00393 290 pfam00393, 6PGD, 6-phosphogluconate dehydrogenase, 2e-85
PTZ00142470 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogena 1e-82
PTZ00142470 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogena 4e-80
PTZ00142 470 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogena 3e-73
PRK09599301 PRK09599, PRK09599, 6-phosphogluconate dehydrogena 4e-66
PLN02350493 PLN02350, PLN02350, phosphogluconate dehydrogenase 5e-65
PLN02350493 PLN02350, PLN02350, phosphogluconate dehydrogenase 9e-64
pfam03446163 pfam03446, NAD_binding_2, NAD binding domain of 6- 3e-63
PLN02350 493 PLN02350, PLN02350, phosphogluconate dehydrogenase 1e-55
COG1023300 COG1023, Gnd, Predicted 6-phosphogluconate dehydro 1e-55
PRK12490299 PRK12490, PRK12490, 6-phosphogluconate dehydrogena 8e-50
TIGR00872298 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogena 2e-44
PRK09599301 PRK09599, PRK09599, 6-phosphogluconate dehydrogena 4e-23
COG1023300 COG1023, Gnd, Predicted 6-phosphogluconate dehydro 4e-22
PRK12490299 PRK12490, PRK12490, 6-phosphogluconate dehydrogena 2e-20
TIGR00872298 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogena 9e-18
COG2084286 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase 6e-17
TIGR01505291 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropiona 5e-09
PRK11559296 PRK11559, garR, tartronate semialdehyde reductase; 8e-08
TIGR01692288 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogen 2e-05
PRK15059292 PRK15059, PRK15059, tartronate semialdehyde reduct 7e-05
>gnl|CDD|215895 pfam00393, 6PGD, 6-phosphogluconate dehydrogenase, C-terminal domain Back     alignment and domain information
 Score =  300 bits (770), Expect = 3e-99
 Identities = 103/161 (63%), Positives = 125/161 (77%), Gaps = 1/161 (0%)

Query: 172 PKPQRDKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIR 231
            K + DK EF+E++RQALYASKIVSYAQGFML+R A++ +GW LN G IA +WRGGCIIR
Sbjct: 131 AKDKGDKAEFIEDVRQALYASKIVSYAQGFMLLRAASKEYGWNLNLGEIARIWRGGCIIR 190

Query: 232 SVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAF 291
           + FL  IK A++KNP L NLLLDP+FK  I   Q SWR VV+ +   GIP PAF++AL++
Sbjct: 191 AQFLDKIKDAYEKNPDLPNLLLDPYFKKEIKEYQQSWRRVVAIAVEAGIPVPAFSSALSY 250

Query: 292 YDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWT 332
           YD YR++RLPANL+QAQRDYFGAHTYE     G F HTNWT
Sbjct: 251 YDSYRTERLPANLIQAQRDYFGAHTYERTDKEGFF-HTNWT 290


This family represents the C-terminal all-alpha domain of 6-phosphogluconate dehydrogenase. The domain contains two structural repeats of 5 helices each. Length = 290

>gnl|CDD|236453 PRK09287, PRK09287, 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236453 PRK09287, PRK09287, 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|223439 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|223439 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|223439 COG0362, Gnd, 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|129951 TIGR00873, gnd, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|236453 PRK09287, PRK09287, 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|129951 TIGR00873, gnd, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|129951 TIGR00873, gnd, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|215895 pfam00393, 6PGD, 6-phosphogluconate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|240287 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240287 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240287 PTZ00142, PTZ00142, 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236582 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|215200 PLN02350, PLN02350, phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|215200 PLN02350, PLN02350, phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|217563 pfam03446, NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>gnl|CDD|215200 PLN02350, PLN02350, phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|223954 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237116 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|233163 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|236582 PRK09599, PRK09599, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|223954 COG1023, Gnd, Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237116 PRK12490, PRK12490, 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|233163 TIGR00872, gnd_rel, 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>gnl|CDD|224995 COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|130569 TIGR01505, tartro_sem_red, 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>gnl|CDD|183197 PRK11559, garR, tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|130753 TIGR01692, HIBADH, 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|185019 PRK15059, PRK15059, tartronate semialdehyde reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 490
COG0362 473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 100.0
KOG2653|consensus 487 100.0
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 100.0
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 100.0
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 100.0
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 100.0
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 100.0
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 100.0
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 100.0
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 100.0
KOG0409|consensus327 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
PF00393 291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 100.0
PRK15059292 tartronate semialdehyde reductase; Provisional 100.0
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 100.0
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 100.0
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 100.0
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 100.0
PLN02858 1378 fructose-bisphosphate aldolase 100.0
COG0362473 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate 100.0
PF00393291 6PGD: 6-phosphogluconate dehydrogenase, C-terminal 100.0
KOG2653|consensus487 100.0
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 99.98
PRK09287459 6-phosphogluconate dehydrogenase; Validated 99.97
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 99.97
TIGR00873467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 99.97
PTZ00142470 6-phosphogluconate dehydrogenase; Provisional 99.97
PLN02350493 phosphogluconate dehydrogenase (decarboxylating) 99.96
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 99.94
PRK15182425 Vi polysaccharide biosynthesis protein TviB; Provi 99.94
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 99.93
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.91
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 99.91
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.89
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 99.88
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 99.87
PLN02353473 probable UDP-glucose 6-dehydrogenase 99.86
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 99.86
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenas 99.84
PRK12557342 H(2)-dependent methylenetetrahydromethanopterin de 99.83
PRK08229341 2-dehydropantoate 2-reductase; Provisional 99.83
PLN02688266 pyrroline-5-carboxylate reductase 99.82
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 99.79
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 99.77
PRK08507275 prephenate dehydrogenase; Validated 99.77
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 99.74
PRK07417279 arogenate dehydrogenase; Reviewed 99.74
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.73
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 99.72
PRK08655437 prephenate dehydrogenase; Provisional 99.72
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 99.69
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.67
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.66
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.65
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 99.65
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 99.64
COG1023300 Gnd Predicted 6-phosphogluconate dehydrogenase [Ca 99.61
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 99.59
PRK07680273 late competence protein ComER; Validated 99.59
TIGR01724341 hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome 99.59
PRK12921305 2-dehydropantoate 2-reductase; Provisional 99.58
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 99.58
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 99.58
PRK07502307 cyclohexadienyl dehydrogenase; Validated 99.57
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.57
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 99.56
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 99.55
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 99.55
PRK06545359 prephenate dehydrogenase; Validated 99.55
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 99.53
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 99.52
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 99.51
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.51
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 99.5
PRK06249313 2-dehydropantoate 2-reductase; Provisional 99.49
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 99.48
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.47
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 99.47
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 99.46
PLN02256304 arogenate dehydrogenase 99.46
PLN02712667 arogenate dehydrogenase 99.45
PRK08269314 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.44
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 99.44
PRK05708305 2-dehydropantoate 2-reductase; Provisional 99.43
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 99.37
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 99.36
PRK08818370 prephenate dehydrogenase; Provisional 99.36
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 99.35
PLN02712 667 arogenate dehydrogenase 99.35
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 99.3
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 99.3
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 99.29
PTZ00431260 pyrroline carboxylate reductase; Provisional 99.27
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 99.26
COG2085211 Predicted dinucleotide-binding enzymes [General fu 99.25
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 99.25
PRK05479330 ketol-acid reductoisomerase; Provisional 99.24
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 99.23
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 99.23
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 99.17
KOG2666|consensus481 99.13
PRK07574385 formate dehydrogenase; Provisional 99.11
PRK12480330 D-lactate dehydrogenase; Provisional 99.11
PLN03139386 formate dehydrogenase; Provisional 99.09
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 99.06
PRK13243333 glyoxylate reductase; Reviewed 99.05
TIGR00745293 apbA_panE 2-dehydropantoate 2-reductase. This mode 99.03
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 99.02
PF02153258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 99.02
PRK11730715 fadB multifunctional fatty acid oxidation complex 99.02
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 99.01
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 99.0
PRK13403335 ketol-acid reductoisomerase; Provisional 98.98
PRK06436303 glycerate dehydrogenase; Provisional 98.98
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 98.98
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 98.96
PRK11154708 fadJ multifunctional fatty acid oxidation complex 98.95
PRK08605332 D-lactate dehydrogenase; Validated 98.94
TIGR02440699 FadJ fatty oxidation complex, alpha subunit FadJ. 98.94
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 98.94
KOG2380|consensus480 98.89
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 98.85
PLN02928347 oxidoreductase family protein 98.84
PRK13302271 putative L-aspartate dehydrogenase; Provisional 98.81
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 98.81
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 98.78
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 98.74
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 98.71
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 98.68
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 98.67
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 98.66
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.64
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 98.63
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 98.63
PRK06487317 glycerate dehydrogenase; Provisional 98.62
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 98.61
PRK06932314 glycerate dehydrogenase; Provisional 98.61
PRK13304265 L-aspartate dehydrogenase; Reviewed 98.56
PRK06141314 ornithine cyclodeaminase; Validated 98.55
PLN02306386 hydroxypyruvate reductase 98.51
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 98.47
PRK06444197 prephenate dehydrogenase; Provisional 98.46
PF14833122 NAD_binding_11: NAD-binding of NADP-dependent 3-hy 98.46
COG4007340 Predicted dehydrogenase related to H2-forming N5,N 98.46
KOG0069|consensus336 98.44
PRK15059292 tartronate semialdehyde reductase; Provisional 98.43
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 98.41
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.41
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.39
KOG2304|consensus298 98.38
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 98.37
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.31
TIGR00112245 proC pyrroline-5-carboxylate reductase. This enzym 98.31
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 98.29
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 98.28
TIGR01692288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 98.27
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.24
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid trans 98.23
PF0098496 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenas 98.2
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.18
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 98.13
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 98.13
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 98.11
PRK06223307 malate dehydrogenase; Reviewed 98.09
PRK05225487 ketol-acid reductoisomerase; Validated 98.06
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 98.02
PLN00203519 glutamyl-tRNA reductase 98.01
PTZ00075476 Adenosylhomocysteinase; Provisional 98.0
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.99
KOG2305|consensus313 97.99
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 97.99
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.98
COG0569225 TrkA K+ transport systems, NAD-binding component [ 97.95
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 97.94
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.91
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.87
PRK06407301 ornithine cyclodeaminase; Provisional 97.86
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 97.85
PRK07340304 ornithine cyclodeaminase; Validated 97.84
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 97.84
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.82
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.81
PRK08618325 ornithine cyclodeaminase; Validated 97.81
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 97.8
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.8
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.8
cd01483143 E1_enzyme_family Superfamily of activating enzymes 97.79
KOG2711|consensus372 97.78
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.78
PRK06823315 ornithine cyclodeaminase; Validated 97.77
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 97.77
PRK11579346 putative oxidoreductase; Provisional 97.76
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.76
PRK13301267 putative L-aspartate dehydrogenase; Provisional 97.73
COG0673342 MviM Predicted dehydrogenases and related proteins 97.73
PLN02494477 adenosylhomocysteinase 97.73
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.72
PRK13303265 L-aspartate dehydrogenase; Provisional 97.72
PRK08291330 ectoine utilization protein EutC; Validated 97.72
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 97.72
PTZ00082321 L-lactate dehydrogenase; Provisional 97.69
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.69
PRK00048257 dihydrodipicolinate reductase; Provisional 97.67
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 97.65
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.63
KOG0068|consensus406 97.63
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.62
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.62
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 97.61
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 97.59
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 97.58
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.54
PRK06046326 alanine dehydrogenase; Validated 97.53
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 97.5
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.46
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 97.44
TIGR00036266 dapB dihydrodipicolinate reductase. 97.44
PTZ00117319 malate dehydrogenase; Provisional 97.43
PRK07589346 ornithine cyclodeaminase; Validated 97.41
PRK13940414 glutamyl-tRNA reductase; Provisional 97.41
PRK08300302 acetaldehyde dehydrogenase; Validated 97.38
PRK04148134 hypothetical protein; Provisional 97.37
KOG0409|consensus327 97.37
PRK03659601 glutathione-regulated potassium-efflux system prot 97.35
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 97.32
PRK10669558 putative cation:proton antiport protein; Provision 97.32
PRK09496453 trkA potassium transporter peripheral membrane com 97.31
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.3
KOG2741|consensus351 97.29
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.29
PRK06199379 ornithine cyclodeaminase; Validated 97.29
COG5495289 Uncharacterized conserved protein [Function unknow 97.27
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 97.27
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 97.26
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.2
PRK06349426 homoserine dehydrogenase; Provisional 97.18
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.18
PRK03562621 glutathione-regulated potassium-efflux system prot 97.17
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.16
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.14
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 97.13
PRK15076431 alpha-galactosidase; Provisional 97.12
PF10100429 DUF2338: Uncharacterized protein conserved in bact 97.12
PRK09496453 trkA potassium transporter peripheral membrane com 97.11
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 97.11
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 97.11
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 97.11
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 97.09
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 97.09
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 97.09
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.06
PRK06270341 homoserine dehydrogenase; Provisional 97.05
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 97.03
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.0
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.97
COG2910211 Putative NADH-flavin reductase [General function p 96.96
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 96.96
PRK05442326 malate dehydrogenase; Provisional 96.92
PRK10206344 putative oxidoreductase; Provisional 96.91
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.89
KOG3124|consensus267 96.86
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 96.86
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.81
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.8
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.76
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.75
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 96.71
PRK12548289 shikimate 5-dehydrogenase; Provisional 96.63
PLN02602350 lactate dehydrogenase 96.63
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 96.62
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.62
PRK14027283 quinate/shikimate dehydrogenase; Provisional 96.61
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 96.61
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 96.59
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.59
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.58
PRK11861 673 bifunctional prephenate dehydrogenase/3-phosphoshi 96.57
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 96.54
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.52
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.52
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.49
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.48
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.44
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 96.39
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.39
PRK14982340 acyl-ACP reductase; Provisional 96.38
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.36
TIGR02717447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 96.34
PRK08328231 hypothetical protein; Provisional 96.33
CHL00194317 ycf39 Ycf39; Provisional 96.32
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 96.32
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 96.31
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.31
PTZ00325321 malate dehydrogenase; Provisional 96.23
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.22
PRK06392326 homoserine dehydrogenase; Provisional 96.19
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 96.18
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 96.17
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 96.14
PRK05086312 malate dehydrogenase; Provisional 96.14
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 96.11
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 96.08
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.08
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.04
PLN00106323 malate dehydrogenase 96.03
PLN00112444 malate dehydrogenase (NADP); Provisional 96.02
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 96.01
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 96.0
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.99
COG4408431 Uncharacterized protein conserved in bacteria [Fun 95.99
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 95.97
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 95.95
PLN02477410 glutamate dehydrogenase 95.92
PRK09414445 glutamate dehydrogenase; Provisional 95.91
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 95.9
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.87
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.87
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 95.82
COG2344211 AT-rich DNA-binding protein [General function pred 95.8
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 95.78
PRK00141473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.76
PRK08223287 hypothetical protein; Validated 95.75
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.68
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.68
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.66
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 95.65
PRK06719157 precorrin-2 dehydrogenase; Validated 95.64
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 95.62
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.61
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.58
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 95.58
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.56
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 95.55
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 95.54
PRK12550272 shikimate 5-dehydrogenase; Reviewed 95.53
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 95.53
PRK00676338 hemA glutamyl-tRNA reductase; Validated 95.52
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.52
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 95.51
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 95.51
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.5
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.48
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.45
TIGR01019286 sucCoAalpha succinyl-CoA synthetase, alpha subunit 95.45
PRK02006498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.43
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.43
PRK14852 989 hypothetical protein; Provisional 95.43
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.42
PRK05678291 succinyl-CoA synthetase subunit alpha; Validated 95.41
PRK01390460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.41
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.4
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 95.4
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 95.36
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.34
PRK14030445 glutamate dehydrogenase; Provisional 95.29
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 95.29
PRK05993277 short chain dehydrogenase; Provisional 95.28
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 95.25
PRK08374336 homoserine dehydrogenase; Provisional 95.23
PRK00961342 H(2)-dependent methylenetetrahydromethanopterin de 95.19
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.17
PRK08163396 salicylate hydroxylase; Provisional 95.16
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.16
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 95.16
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 95.16
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.15
PRK05884223 short chain dehydrogenase; Provisional 95.15
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 95.11
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 95.11
PRK14851 679 hypothetical protein; Provisional 95.06
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.02
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 95.01
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.99
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 94.95
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 94.93
PLN02353473 probable UDP-glucose 6-dehydrogenase 94.91
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 94.9
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 94.86
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 94.85
TIGR01087433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 94.84
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 94.82
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 94.81
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 94.8
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 94.75
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 94.73
PRK08040336 putative semialdehyde dehydrogenase; Provisional 94.71
TIGR01082448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 94.7
TIGR01723340 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydr 94.7
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.65
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 94.64
PRK06847375 hypothetical protein; Provisional 94.64
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.63
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 94.63
PRK06180277 short chain dehydrogenase; Provisional 94.61
PRK07454241 short chain dehydrogenase; Provisional 94.53
PRK14031444 glutamate dehydrogenase; Provisional 94.52
PLN02383344 aspartate semialdehyde dehydrogenase 94.5
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.48
PLN03209576 translocon at the inner envelope of chloroplast su 94.44
PRK07877 722 hypothetical protein; Provisional 94.43
PRK10537393 voltage-gated potassium channel; Provisional 94.36
PRK05600370 thiamine biosynthesis protein ThiF; Validated 94.33
cd05298437 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; 94.31
COG1486442 CelF Alpha-galactosidases/6-phospho-beta-glucosida 94.31
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 94.3
PRK07060245 short chain dehydrogenase; Provisional 94.26
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.25
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 94.25
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 94.21
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 94.18
PRK07236386 hypothetical protein; Provisional 94.18
PRK08306296 dipicolinate synthase subunit A; Reviewed 94.17
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.14
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 94.11
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 94.08
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 94.08
PRK06182273 short chain dehydrogenase; Validated 94.04
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 94.01
PRK15116268 sulfur acceptor protein CsdL; Provisional 93.97
PRK07411390 hypothetical protein; Validated 93.89
PRK06101240 short chain dehydrogenase; Provisional 93.89
PRK08309177 short chain dehydrogenase; Provisional 93.85
PLN00016378 RNA-binding protein; Provisional 93.85
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 93.75
cd05197425 GH4_glycoside_hydrolases Glycoside Hydrases Family 93.74
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 93.7
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.7
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 93.69
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 93.63
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 93.59
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 93.58
PRK11908347 NAD-dependent epimerase/dehydratase family protein 93.56
PRK10538248 malonic semialdehyde reductase; Provisional 93.52
PRK08340259 glucose-1-dehydrogenase; Provisional 93.46
KOG3007|consensus333 93.44
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 93.43
PRK12939250 short chain dehydrogenase; Provisional 93.43
PRK07326237 short chain dehydrogenase; Provisional 93.42
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 93.4
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 93.39
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 93.35
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 93.34
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 93.31
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 93.29
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 93.28
PLN02896353 cinnamyl-alcohol dehydrogenase 93.26
cd05296419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 93.24
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.23
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.21
PRK09880343 L-idonate 5-dehydrogenase; Provisional 93.2
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 93.17
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.11
PRK08265261 short chain dehydrogenase; Provisional 93.09
PRK05868372 hypothetical protein; Validated 93.08
PRK06753373 hypothetical protein; Provisional 93.07
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 93.05
PRK08219227 short chain dehydrogenase; Provisional 93.04
PF02056183 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP 93.04
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 93.02
PRK09186256 flagellin modification protein A; Provisional 92.92
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.89
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 92.88
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 92.85
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 92.83
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 92.82
PRK05693274 short chain dehydrogenase; Provisional 92.79
PRK08267260 short chain dehydrogenase; Provisional 92.78
PRK07024257 short chain dehydrogenase; Provisional 92.78
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 92.77
PRK06179270 short chain dehydrogenase; Provisional 92.76
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 92.74
PRK06057255 short chain dehydrogenase; Provisional 92.71
PRK06953222 short chain dehydrogenase; Provisional 92.69
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 92.66
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 92.66
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 92.64
PLN02695370 GDP-D-mannose-3',5'-epimerase 92.61
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 92.6
PRK07825273 short chain dehydrogenase; Provisional 92.59
PRK07774250 short chain dehydrogenase; Provisional 92.58
PRK07523255 gluconate 5-dehydrogenase; Provisional 92.57
PRK12828239 short chain dehydrogenase; Provisional 92.49
PRK07074257 short chain dehydrogenase; Provisional 92.47
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 92.42
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 92.4
KOG1370|consensus434 92.38
COG0300265 DltE Short-chain dehydrogenases of various substra 92.32
PRK12829264 short chain dehydrogenase; Provisional 92.3
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.28
PRK01368454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.25
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 92.25
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 92.23
PF04016147 DUF364: Domain of unknown function (DUF364); Inter 92.22
PRK07538413 hypothetical protein; Provisional 92.21
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.2
PRK07045388 putative monooxygenase; Reviewed 92.19
KOG0023|consensus360 92.17
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 92.15
PLN02427386 UDP-apiose/xylose synthase 92.13
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=4e-92  Score=694.36  Aligned_cols=305  Identities=66%  Similarity=1.108  Sum_probs=294.2

Q ss_pred             CCcEEEEcccHHHHHHHHHHHHCCCeEEEEeCChHHHHHHHHcccCCCCeeccCCHHHHHhhCCCCcEEEEecCCCchHH
Q psy9637           4 KGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKGTNIIGAHSLEELVKNLKKPRRVMMLVKAGSAVD   83 (490)
Q Consensus         4 ~~~IgiIGlG~MG~~lA~~L~~~G~~V~v~dr~~~~~~~l~~~g~~~~~i~~~~s~~e~v~~l~~~dvIil~vp~~~~v~   83 (490)
                      ++.||+||||+||.+||+|++++||+|.+|||+++++++|.+......++.++.|++|++++|++|+.|++||.++.+|+
T Consensus         3 ~~~iGviGLaVMG~NLaLNi~~~G~~VavyNRt~~ktd~f~~~~~~~k~i~~~~sieefV~~Le~PRkI~lMVkAG~~VD   82 (473)
T COG0362           3 KADIGVIGLAVMGSNLALNIADHGYTVAVYNRTTEKTDEFLAERAKGKNIVPAYSIEEFVASLEKPRKILLMVKAGTPVD   82 (473)
T ss_pred             ccceeeEehhhhhHHHHHHHHhcCceEEEEeCCHHHHHHHHHhCccCCCccccCcHHHHHHHhcCCceEEEEEecCCcHH
Confidence            46899999999999999999999999999999999999999887766789999999999999999999999999999999


Q ss_pred             HHHHhhcccCCCCCEEEcCCCCChHHHHHHHHHHHHccccccccCCCCCccccccCCccCCCCCcchHHHHHHHHHhhCC
Q psy9637          84 DFIDKLVPLLEKGDIIIDGGNSEYQDTDRRSKALEAKGLLYVGCGVSGGEDGARYGPSLMPGGNPAAWPALKPIFQKLNP  163 (490)
Q Consensus        84 ~vl~~l~~~l~~g~iiId~s~~~~~~~~~~~~~l~~~gi~~ld~~vsGg~~~a~~G~~im~GG~~~a~~~v~~ll~~l~~  163 (490)
                      +++++|+|+|.+||||||+||++|+||.||.+.+.++|++|+.++||||+++|++||+||+||++++|+.++|+|+++++
T Consensus        83 ~~I~~L~p~Le~gDIiIDGGNs~y~DT~RR~~eL~~~Gi~FvG~GVSGGEeGA~~GPSiMpGG~~eay~~v~pil~~IaA  162 (473)
T COG0362          83 AVIEQLLPLLEKGDIIIDGGNSHYKDTIRRNKELSEKGILFVGMGVSGGEEGARHGPSIMPGGQKEAYELVAPILTKIAA  162 (473)
T ss_pred             HHHHHHHhhcCCCCEEEeCCCcCCchHHHHHHHHHhcCCeEEeccccccccccccCCCcCCCCCHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999997765


Q ss_pred             ceeeCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHhcccchhhHhHhHhHHhhc
Q psy9637         164 SFETSAPTPKPQRDKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAFD  243 (490)
Q Consensus       164 ~~~~~g~~g~~~g~~a~~~Kll~n~l~~~~~~~~aE~~~la~~a~~~~~~Gld~~~v~~i~~~g~~~~s~~l~~i~~~~~  243 (490)
                                                                                                      
T Consensus       163 --------------------------------------------------------------------------------  162 (473)
T COG0362         163 --------------------------------------------------------------------------------  162 (473)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cCcccccccCChhHHHHHHHHHHHHHHHHHHHHHcCCCchHHHHHHHHHHHHHhCCChhhhHHHHHHhhcccccccccCC
Q psy9637         244 KNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAP  323 (490)
Q Consensus       244 ~~~~~~~~~~~~~f~~~l~~~~kDl~~~~~~A~~~gv~~P~~~aa~~~~~~~~~~g~~~~~~~a~rd~fgah~~~r~~~~  323 (490)
                                                                                                      
T Consensus       163 --------------------------------------------------------------------------------  162 (473)
T COG0362         163 --------------------------------------------------------------------------------  162 (473)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCceeecccCCCCCCccccCCCCCcceeecCCCCcchhHHhhhhHHHHHHHHHHHHHHHHHhhcCCChHHHHHHHHHhcc
Q psy9637         324 GKFVHTNWTGHGGNSIAAKVGSEPCCDWVGEQGAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWNK  403 (490)
Q Consensus       324 ~~~~h~~w~~~~~~~~~a~~~~~~c~~~~g~~g~gh~vkmvhngiey~~m~~~~E~~~~~~~~~~~~~~~~~~~~~~w~~  403 (490)
                                        +++++|||+|+||+||||||||||||||||+||+|||+|.|||..+|||++||++||+.||+
T Consensus       163 ------------------k~~g~pCc~~iG~~GAGHfVKmVHNGIEYgDMQlIaE~Y~ilk~~lgls~~ei~~vF~~WN~  224 (473)
T COG0362         163 ------------------KVDGEPCCTWIGPDGAGHFVKMVHNGIEYGDMQLIAEAYDILKDGLGLSAEEIAEVFEEWNK  224 (473)
T ss_pred             ------------------hcCCCCceeeECCCCCCceeeeeecCchHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHhcc
Confidence                              23578999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcchhHHHHHHHHHhcccCCC-CCcchhhhccccCCCcchHHHHHHHHhcCCCchhhHHHHHHHhhccCchHHHHHHhhc
Q psy9637         404 GELDSFLIEITKDILKFKDTD-GAPLVEKIKDYAGQKGTGKWTAISALDYGVPVTLIGESVFSRCLSSLFDERQKASQVL  482 (490)
Q Consensus       404 g~~~s~l~~~~~~~~~~~~~~-~~~~l~~i~~~~~~~g~g~w~~~~a~~~~~p~~~i~~a~~~r~~s~~~~~r~~~~~~~  482 (490)
                      |+|+|||+|||++||++||++ ++|++|.|+|.++||||||||+++|+++|||+|+|++|||+|++|+.|++|..+++.|
T Consensus       225 geL~SYLIeIT~~IL~~kD~~~~kplvd~ILD~AgQKGTGkWt~~~AldlGvP~t~I~eaVfAR~lSs~K~eR~~Ask~l  304 (473)
T COG0362         225 GELDSYLIEITADILRKKDEEGGKPLVDKILDKAGQKGTGKWTVISALDLGVPLTLITEAVFARYLSSLKDERVAASKVL  304 (473)
T ss_pred             CcchHHHHHHHHHHHhhcCcccCCchHHHHHHHhcCCCcchhhHHHHHHcCCCcHHHHHHHHHHHHHHhHHHHHHHHhhc
Confidence            999999999999999999986 4599999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCC
Q psy9637         483 QGPN  486 (490)
Q Consensus       483 ~~~~  486 (490)
                      .+|.
T Consensus       305 ~~~~  308 (473)
T COG0362         305 AGPK  308 (473)
T ss_pred             CCCC
Confidence            8884



>KOG2653|consensus Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>COG0362 Gnd 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00393 6PGD: 6-phosphogluconate dehydrogenase, C-terminal domain; InterPro: IPR006114 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>KOG2653|consensus Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>COG0677 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12557 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase-related protein; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK08269 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG2666|consensus Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>KOG2380|consensus Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK06444 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF14833 NAD_binding_11: NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase; PDB: 3OBB_A 3Q3C_A 2UYY_D 3G0O_A 1WP4_A 2CVZ_B 1YB4_A 3PDU_G 2I9P_D 2GF2_D Back     alignment and domain information
>COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR00112 proC pyrroline-5-carboxylate reductase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PF00984 UDPG_MGDP_dh: UDP-glucose/GDP-mannose dehydrogenase family, central domain; InterPro: IPR014026 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>KOG2305|consensus Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>KOG2711|consensus Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG0409|consensus Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>KOG2741|consensus Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG5495 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PF10100 DUF2338: Uncharacterized protein conserved in bacteria (DUF2338); InterPro: IPR016935 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3124|consensus Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG4408 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK00961 H(2)-dependent methylenetetrahydromethanopterin dehydrogenase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>TIGR01723 hmd_TIGR 5,10-methenyltetrahydromethanopterin hydrogenase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases Back     alignment and domain information
>COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>KOG3007|consensus Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG1370|consensus Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PF04016 DUF364: Domain of unknown function (DUF364); InterPro: IPR007161 This is a entry represents of bacterial and archaeal proteins of unknown function Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
2jkv_A505 Structure Of Human Phosphogluconate Dehydrogenase I 2e-70
2jkv_A 505 Structure Of Human Phosphogluconate Dehydrogenase I 6e-66
4gwg_A484 Crystal Structure Analysis Of 6-Phosphogluconate De 2e-70
4gwg_A 484 Crystal Structure Analysis Of 6-Phosphogluconate De 7e-66
1pgn_A482 Crystallographic Study Of Coenzyme, Coenzyme Analog 6e-68
1pgn_A 482 Crystallographic Study Of Coenzyme, Coenzyme Analog 1e-63
2p4q_A497 Crystal Structure Analysis Of Gnd1 In Saccharomyces 7e-60
2p4q_A 497 Crystal Structure Analysis Of Gnd1 In Saccharomyces 2e-58
2w90_A471 Geobacillus Stearothermophilus 6-Phosphogluconate D 1e-50
2w90_A 471 Geobacillus Stearothermophilus 6-Phosphogluconate D 4e-49
2w8z_A470 Geobacillus Stearothermophilus 6-Phosphogluconate D 1e-50
2w8z_A 470 Geobacillus Stearothermophilus 6-Phosphogluconate D 4e-49
3fwn_A480 Dimeric 6-Phosphogluconate Dehydrogenase Complexed 1e-47
3fwn_A 480 Dimeric 6-Phosphogluconate Dehydrogenase Complexed 5e-46
2iyo_A 472 Structural Characterization Of A Bacterial 6pdh Rev 2e-47
2iyp_A 473 Product Rup Length = 473 3e-47
2iz0_A 474 Pex Inhibitor-Home Data Length = 474 3e-47
2zya_A480 Dimeric 6-Phosphogluconate Dehydrogenase Complexed 2e-46
2zya_A 480 Dimeric 6-Phosphogluconate Dehydrogenase Complexed 6e-46
2zyg_A480 Apo-Form Of Dimeric 6-Phosphogluconate Dehydrogenas 8e-46
2zyg_A 480 Apo-Form Of Dimeric 6-Phosphogluconate Dehydrogenas 1e-45
1pgj_A478 X-Ray Structure Of 6-Phosphogluconate Dehydrogenase 8e-32
1pgj_A 478 X-Ray Structure Of 6-Phosphogluconate Dehydrogenase 2e-21
4e21_A358 The Crystal Structure Of 6-Phosphogluconate Dehydro 2e-23
4e21_A358 The Crystal Structure Of 6-Phosphogluconate Dehydro 4e-09
3doj_A310 Structure Of Glyoxylate Reductase 1 From Arabidopsi 5e-05
1wp4_A289 Structure Of Tt368 Protein From Thermus Thermophilu 2e-04
>pdb|2JKV|A Chain A, Structure Of Human Phosphogluconate Dehydrogenase In Complex With Nadph At 2.53a Length = 505 Back     alignment and structure

Iteration: 1

Score = 263 bits (672), Expect = 2e-70, Method: Compositional matrix adjust. Identities = 123/181 (67%), Positives = 138/181 (76%), Gaps = 5/181 (2%) Query: 162 NPSFETSAPTPKPQR-----DKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLN 216 + + S PQ+ DKK FLE+IR+ALYASKI+SYAQGFML+RQAA GW LN Sbjct: 317 DERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLN 376 Query: 217 YGGIALMWRGGCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSA 276 YGGIALMWRGGCIIRSVFLG IK AFD+NP L NLLLD FFK A+ Q SWR VS Sbjct: 377 YGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGV 436 Query: 277 LLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGG 336 GIP P F TAL+FYDGYR + LPA+L+QAQRDYFGAHTYELLA PG+F+HTNWTGHGG Sbjct: 437 QAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGG 496 Query: 337 N 337 Sbjct: 497 T 497
>pdb|2JKV|A Chain A, Structure Of Human Phosphogluconate Dehydrogenase In Complex With Nadph At 2.53a Length = 505 Back     alignment and structure
>pdb|4GWG|A Chain A, Crystal Structure Analysis Of 6-Phosphogluconate Dehydrogenase Apo- Form Length = 484 Back     alignment and structure
>pdb|4GWG|A Chain A, Crystal Structure Analysis Of 6-Phosphogluconate Dehydrogenase Apo- Form Length = 484 Back     alignment and structure
>pdb|1PGN|A Chain A, Crystallographic Study Of Coenzyme, Coenzyme Analogue And Substrate Binding In 6-Phosphogluconate Dehydrogenase: Implications For Nadp Specificity And The Enzyme Mechanism Length = 482 Back     alignment and structure
>pdb|1PGN|A Chain A, Crystallographic Study Of Coenzyme, Coenzyme Analogue And Substrate Binding In 6-Phosphogluconate Dehydrogenase: Implications For Nadp Specificity And The Enzyme Mechanism Length = 482 Back     alignment and structure
>pdb|2P4Q|A Chain A, Crystal Structure Analysis Of Gnd1 In Saccharomyces Cerevisiae Length = 497 Back     alignment and structure
>pdb|2P4Q|A Chain A, Crystal Structure Analysis Of Gnd1 In Saccharomyces Cerevisiae Length = 497 Back     alignment and structure
>pdb|2W90|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 471 Back     alignment and structure
>pdb|2W90|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 471 Back     alignment and structure
>pdb|2W8Z|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 470 Back     alignment and structure
>pdb|2W8Z|A Chain A, Geobacillus Stearothermophilus 6-Phosphogluconate Dehydrogenase With Bound 6-Phosphogluconate Length = 470 Back     alignment and structure
>pdb|3FWN|A Chain A, Dimeric 6-Phosphogluconate Dehydrogenase Complexed With 6- Phosphogluconate And 2'-Monophosphoadenosine-5'-Diphosphate Length = 480 Back     alignment and structure
>pdb|3FWN|A Chain A, Dimeric 6-Phosphogluconate Dehydrogenase Complexed With 6- Phosphogluconate And 2'-Monophosphoadenosine-5'-Diphosphate Length = 480 Back     alignment and structure
>pdb|2IYO|A Chain A, Structural Characterization Of A Bacterial 6pdh Reveals Aspects Of Specificity, Mechanism And Mode Of Inhibition Length = 472 Back     alignment and structure
>pdb|2IYP|A Chain A, Product Rup Length = 473 Back     alignment and structure
>pdb|2IZ0|A Chain A, Pex Inhibitor-Home Data Length = 474 Back     alignment and structure
>pdb|2ZYA|A Chain A, Dimeric 6-Phosphogluconate Dehydrogenase Complexed With 6- Phosphogluconate Length = 480 Back     alignment and structure
>pdb|2ZYA|A Chain A, Dimeric 6-Phosphogluconate Dehydrogenase Complexed With 6- Phosphogluconate Length = 480 Back     alignment and structure
>pdb|2ZYG|A Chain A, Apo-Form Of Dimeric 6-Phosphogluconate Dehydrogenase Length = 480 Back     alignment and structure
>pdb|2ZYG|A Chain A, Apo-Form Of Dimeric 6-Phosphogluconate Dehydrogenase Length = 480 Back     alignment and structure
>pdb|1PGJ|A Chain A, X-Ray Structure Of 6-Phosphogluconate Dehydrogenase From The Protozoan Parasite T. Brucei Length = 478 Back     alignment and structure
>pdb|1PGJ|A Chain A, X-Ray Structure Of 6-Phosphogluconate Dehydrogenase From The Protozoan Parasite T. Brucei Length = 478 Back     alignment and structure
>pdb|4E21|A Chain A, The Crystal Structure Of 6-Phosphogluconate Dehydrogenase From Geobacter Metallireducens Length = 358 Back     alignment and structure
>pdb|4E21|A Chain A, The Crystal Structure Of 6-Phosphogluconate Dehydrogenase From Geobacter Metallireducens Length = 358 Back     alignment and structure
>pdb|3DOJ|A Chain A, Structure Of Glyoxylate Reductase 1 From Arabidopsis (Atglyr1) Length = 310 Back     alignment and structure
>pdb|1WP4|A Chain A, Structure Of Tt368 Protein From Thermus Thermophilus Hb8 Length = 289 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query490
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 1e-104
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 1e-100
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 2e-97
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 1e-100
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 4e-99
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 2e-96
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 9e-99
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 4e-65
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 2e-97
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 3e-96
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 2e-95
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 2e-96
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 1e-95
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 3e-95
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 1e-89
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 2e-88
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 2e-87
3l6d_A306 Putative oxidoreductase; structural genomics, prot 7e-16
1vpd_A299 Tartronate semialdehyde reductase; structural geno 9e-16
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 1e-15
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 1e-14
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 1e-14
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 2e-14
3qha_A296 Putative oxidoreductase; seattle structural genomi 4e-14
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 4e-14
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 4e-14
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 1e-13
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 2e-13
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 2e-13
1yb4_A295 Tartronic semialdehyde reductase; structural genom 1e-12
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 7e-12
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 4e-10
4ezb_A317 Uncharacterized conserved protein; structural geno 2e-09
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 2e-06
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 1e-04
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Length = 482 Back     alignment and structure
 Score =  317 bits (815), Expect = e-104
 Identities = 120/171 (70%), Positives = 133/171 (77%)

Query: 167 TSAPTPKPQRDKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRG 226
                   + DKK FLE+IR+ALYASKI+SYAQGFML+RQAA   GW LNYGGIALMWRG
Sbjct: 304 KGPQNIPFEGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRG 363

Query: 227 GCIIRSVFLGNIKAAFDKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFA 286
           GCIIRSVFLG IK AFD+NP L NLLLD FFK A+   Q SWR  +S     GIP P F 
Sbjct: 364 GCIIRSVFLGKIKDAFDRNPGLQNLLLDDFFKSAVENCQDSWRRAISTGVQAGIPMPCFT 423

Query: 287 TALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGGN 337
           TAL+FYDGYR   LPANL+QAQRDYFGAHTYELLA PG+F+HTNWTGHGG+
Sbjct: 424 TALSFYDGYRHAMLPANLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGS 474


>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Length = 482 Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Length = 482 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Length = 358 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Length = 358 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Length = 480 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Length = 480 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Length = 480 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Length = 474 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Length = 474 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Length = 474 Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Length = 478 Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Length = 478 Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Length = 478 Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Length = 306 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Length = 299 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Length = 320 Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Length = 287 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Length = 287 Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Length = 301 Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Length = 296 Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Length = 316 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Length = 310 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Length = 296 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Length = 303 Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Length = 295 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Length = 289 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Length = 312 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Length = 317 Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Length = 266 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Length = 264 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Length = 215 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 100.0
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 100.0
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 100.0
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 100.0
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 100.0
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 100.0
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 100.0
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 100.0
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 100.0
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 100.0
3qha_A296 Putative oxidoreductase; seattle structural genomi 100.0
3l6d_A306 Putative oxidoreductase; structural genomics, prot 100.0
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 100.0
4ezb_A317 Uncharacterized conserved protein; structural geno 100.0
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 100.0
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 100.0
1vpd_A299 Tartronate semialdehyde reductase; structural geno 100.0
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 100.0
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 100.0
1yb4_A295 Tartronic semialdehyde reductase; structural genom 100.0
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 100.0
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 99.98
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 99.97
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 99.97
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 99.96
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 99.95
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 99.95
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 99.95
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 99.95
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 99.95
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 99.95
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 99.93
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 99.93
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 99.92
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 99.92
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 99.92
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 99.91
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 99.89
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 99.89
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 99.88
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 99.88
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 99.88
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 99.86
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 99.84
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 99.84
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 99.84
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 99.84
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 99.84
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 99.83
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 99.83
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 99.82
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 99.82
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 99.81
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 99.81
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 99.79
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 99.79
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 99.77
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 99.75
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 99.75
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 99.73
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 99.72
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 99.72
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 99.7
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 99.7
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 99.7
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 99.7
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 99.69
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 99.69
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 99.68
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 99.68
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 99.68
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 99.68
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 99.68
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 99.67
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 99.66
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 99.65
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 99.45
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 99.61
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 99.61
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 99.59
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 99.56
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 99.55
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 99.54
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 99.53
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 99.51
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 99.46
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 99.46
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 99.45
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 99.44
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 99.3
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 99.26
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 99.25
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.24
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 99.24
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 99.24
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.23
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.23
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 99.22
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.21
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 99.2
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 99.2
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.19
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 99.19
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 99.19
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.19
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 99.18
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.18
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.18
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.18
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.17
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.17
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.16
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 99.16
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 99.16
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.14
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 99.14
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 99.12
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 99.12
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.11
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 99.1
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 99.08
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.06
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 99.04
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.03
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.03
3fr7_A525 Putative ketol-acid reductoisomerase (OS05G057370 99.02
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 98.99
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 98.99
3obb_A300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 98.99
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 98.96
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 98.94
2rir_A300 Dipicolinate synthase, A chain; structural genomic 98.93
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 98.92
3zwc_A742 Peroxisomal bifunctional enzyme; beta oxidation pa 98.89
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 98.87
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.86
2duw_A145 Putative COA-binding protein; ligand binding prote 98.8
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.75
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 98.72
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.72
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.71
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 98.7
3euw_A344 MYO-inositol dehydrogenase; protein structure init 98.7
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 98.66
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.64
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 98.61
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 98.59
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 98.58
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 98.57
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 98.56
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 98.56
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 98.56
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.54
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 98.5
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.49
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 98.48
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 98.47
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 98.47
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.47
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 98.46
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 98.45
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.44
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 98.43
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.43
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 98.42
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 98.42
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 98.41
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 98.41
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 98.4
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 98.4
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 98.39
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.38
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 98.38
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 98.38
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 98.37
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 98.37
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 98.37
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 98.36
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 98.35
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.35
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 98.35
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.34
1ydw_A362 AX110P-like protein; structural genomics, protein 98.33
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 98.33
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 98.32
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 98.32
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.29
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.29
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 98.28
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 98.28
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 98.27
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.27
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 98.27
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.26
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 98.26
1iuk_A140 Hypothetical protein TT1466; structural genomics, 98.26
3ulk_A491 Ketol-acid reductoisomerase; branched-chain amino 98.26
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 98.26
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.22
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.2
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.2
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 98.18
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 98.17
4had_A350 Probable oxidoreductase protein; structural genomi 98.17
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 98.16
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 98.12
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 98.11
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 98.11
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 98.09
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 98.08
3qha_A296 Putative oxidoreductase; seattle structural genomi 98.07
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.07
2d59_A144 Hypothetical protein PH1109; COA binding, structur 98.06
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 98.06
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 98.06
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 98.06
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 98.05
1obb_A480 Maltase, alpha-glucosidase; glycosidase, sulfinic 98.05
1id1_A153 Putative potassium channel protein; RCK domain, E. 98.05
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 98.03
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 98.03
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 98.02
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 98.02
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.01
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 98.0
3btv_A438 Galactose/lactose metabolism regulatory protein GA 98.0
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 98.0
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 98.0
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 97.99
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 97.98
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.98
3tl2_A315 Malate dehydrogenase; center for structural genomi 97.98
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.97
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 97.97
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.97
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 97.96
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 97.95
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 97.94
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 97.92
3fef_A450 Putative glucosidase LPLD; gulosidase, structural 97.92
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 97.91
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 97.9
1u8x_X472 Maltose-6'-phosphate glucosidase; structural genom 97.9
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 97.9
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 97.89
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.89
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 97.89
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 97.88
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.88
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.87
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 97.87
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 97.87
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 97.86
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.84
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 97.83
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.81
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 97.8
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.79
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 97.79
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.77
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.76
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.74
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 97.73
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 97.71
3oqb_A383 Oxidoreductase; structural genomics, protein struc 97.7
4h3v_A390 Oxidoreductase domain protein; structural genomics 97.69
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 97.68
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.68
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 97.66
1vpd_A299 Tartronate semialdehyde reductase; structural geno 97.66
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 97.65
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 97.63
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 97.62
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.61
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 97.59
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.58
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 97.57
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 97.57
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 97.57
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 97.54
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 97.53
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.52
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 97.51
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 97.51
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.5
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.48
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.46
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.46
3l6d_A306 Putative oxidoreductase; structural genomics, prot 97.46
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 97.43
4ezb_A317 Uncharacterized conserved protein; structural geno 97.42
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 97.41
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 97.37
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 97.36
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 97.34
4g65_A461 TRK system potassium uptake protein TRKA; structur 97.33
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 97.3
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 97.29
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 97.29
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 97.28
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.25
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.25
1yb4_A295 Tartronic semialdehyde reductase; structural genom 97.24
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 97.23
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.21
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 97.2
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 97.19
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 97.17
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 97.14
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 97.13
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.12
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.11
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 97.1
3ius_A286 Uncharacterized conserved protein; APC63810, silic 97.07
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 97.05
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 97.01
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 96.96
3l07_A285 Bifunctional protein fold; structural genomics, ID 96.95
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 96.93
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.93
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mit 96.92
1lnq_A336 MTHK channels, potassium channel related protein; 96.91
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 96.91
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.9
3p2o_A285 Bifunctional protein fold; structural genomics, ce 96.9
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.9
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.87
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 96.87
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 96.86
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.85
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.85
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.84
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.77
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.77
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.76
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.76
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 96.74
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 96.74
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.73
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 96.73
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 96.73
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 96.68
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 96.63
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.63
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 96.6
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.6
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 96.59
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 96.52
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.49
3u95_A477 Glycoside hydrolase, family 4; hydrolysis, cytosol 96.46
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 96.45
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 96.43
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 96.4
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.27
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 96.26
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 96.25
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 96.22
2wm3_A299 NMRA-like family domain containing protein 1; unkn 96.22
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 96.19
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.18
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.15
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.12
4hv4_A494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 96.11
2ph5_A480 Homospermidine synthase; alpha-beta protein, struc 96.11
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.1
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.08
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 96.04
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 96.01
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 95.89
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 95.88
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 95.86
1up7_A417 6-phospho-beta-glucosidase; hydrolase, family4 hyd 95.77
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 95.77
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 95.69
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 95.66
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 95.64
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 95.63
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 95.57
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 95.51
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 95.46
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 95.36
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 95.35
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 95.34
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 95.29
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 95.28
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 95.26
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 95.25
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 95.23
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 95.23
3hn7_A524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 95.19
1tt5_A531 APPBP1, amyloid protein-binding protein 1; cell cy 95.18
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.16
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 95.16
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 95.14
4gx0_A565 TRKA domain protein; membrane protein, ION channel 95.13
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 95.1
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 95.07
4hb9_A412 Similarities with probable monooxygenase; flavin, 95.07
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 94.99
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 94.99
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 94.98
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 94.94
1xq6_A253 Unknown protein; structural genomics, protein stru 94.9
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 94.87
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 94.86
2qrj_A394 Saccharopine dehydrogenase, NAD+, L-lysine- formin 94.83
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 94.83
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 94.81
3slg_A372 PBGP3 protein; structural genomics, seattle struct 94.72
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 94.67
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 94.66
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 94.6
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 94.59
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 94.57
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 94.51
4gx0_A565 TRKA domain protein; membrane protein, ION channel 94.49
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 94.46
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.38
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 94.38
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 94.37
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 94.34
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 94.3
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 94.26
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 94.23
4g65_A461 TRK system potassium uptake protein TRKA; structur 94.23
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 94.22
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 94.19
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 94.16
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.12
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 94.09
2f00_A491 UDP-N-acetylmuramate--L-alanine ligase; amide bond 94.03
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 94.03
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 94.02
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 94.0
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 94.0
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 93.97
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; 93.96
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 93.94
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 93.94
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 93.93
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 93.91
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 93.88
3dme_A369 Conserved exported protein; structural genomics, P 93.86
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 93.86
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta p 93.86
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 93.85
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 93.83
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 93.81
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 93.81
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 93.81
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 93.8
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 93.77
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 93.77
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 93.76
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 93.75
2csu_A457 457AA long hypothetical protein; structural genomi 93.74
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 93.73
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 93.72
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 93.67
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 93.65
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 93.61
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 93.59
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 93.57
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 93.57
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 93.55
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 93.55
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 93.52
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 93.48
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 93.48
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 93.44
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 93.44
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 93.41
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 93.41
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 93.39
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 93.38
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 93.34
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 93.33
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 93.31
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 93.29
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 93.29
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 93.26
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 93.25
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 93.24
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 93.23
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 93.23
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 93.21
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 93.15
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 93.12
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 93.07
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 93.06
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 93.04
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 93.03
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 93.02
3tjr_A301 Short chain dehydrogenase; structural genomics, se 93.01
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.01
4dqx_A277 Probable oxidoreductase protein; structural genomi 93.01
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
Probab=100.00  E-value=8.2e-67  Score=552.18  Aligned_cols=307  Identities=75%  Similarity=1.245  Sum_probs=287.3

Q ss_pred             CCCcEEEEcccHHHHHHHHHHHHCCCeEEEEeCChHHHHHHHHcccCCCCeeccCCHHHHHhhCCCCcEEEEecCCCchH
Q psy9637           3 AKGDIGLIGLAVMGQNLILNMNDHGFTVVAYNRTTAKVDSFLANEAKGTNIIGAHSLEELVKNLKKPRRVMMLVKAGSAV   82 (490)
Q Consensus         3 ~~~~IgiIGlG~MG~~lA~~L~~~G~~V~v~dr~~~~~~~l~~~g~~~~~i~~~~s~~e~v~~l~~~dvIil~vp~~~~v   82 (490)
                      .+|+|||||+|.||.+||++|+++||+|++|||++++++.+.+.+..+.++..+.+++++++.|+.+|+||+|||++.++
T Consensus         3 ~~~kIgiIGlG~MG~~lA~~L~~~G~~V~v~dr~~~~~~~l~~~g~~g~~i~~~~s~~e~v~~l~~aDvVil~Vp~~~~v   82 (484)
T 4gwg_A            3 AQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAV   82 (484)
T ss_dssp             CCBSEEEECCSHHHHHHHHHHHHTTCCEEEECSSTHHHHHHHHTTTTTSSCEECSSHHHHHHTBCSSCEEEECSCSSHHH
T ss_pred             CCCEEEEEChhHHHHHHHHHHHHCCCEEEEEeCCHHHHHHHHhcccCCCceeccCCHHHHHhhccCCCEEEEecCChHHH
Confidence            45799999999999999999999999999999999999999876543334556799999999888899999999998899


Q ss_pred             HHHHHhhcccCCCCCEEEcCCCCChHHHHHHHHHHHHccccccccCCCCCccccccCCccCCCCCcchHHHHHHHHHhhC
Q psy9637          83 DDFIDKLVPLLEKGDIIIDGGNSEYQDTDRRSKALEAKGLLYVGCGVSGGEDGARYGPSLMPGGNPAAWPALKPIFQKLN  162 (490)
Q Consensus        83 ~~vl~~l~~~l~~g~iiId~s~~~~~~~~~~~~~l~~~gi~~ld~~vsGg~~~a~~G~~im~GG~~~a~~~v~~ll~~l~  162 (490)
                      +++++++.+.+++|++|||+||+.|.++.++.+.+.++|++|+|+||+||+.++++|+++|+||+++++++++|+|+.++
T Consensus        83 ~~vl~~l~~~L~~g~iIId~st~~~~~t~~~~~~l~~~Gi~fvd~pVsGg~~gA~~G~~im~GG~~ea~~~v~pll~~ig  162 (484)
T 4gwg_A           83 DDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIA  162 (484)
T ss_dssp             HHHHHHHGGGCCTTCEEEECSCCCHHHHHHHHHHHHHTTCEEEEEEEESHHHHHHHCCEEEEEECGGGHHHHHHHHHHHS
T ss_pred             HHHHHHHHHhcCCCCEEEEcCCCCchHHHHHHHHHHhhccccccCCccCCHHHHhcCCeeecCCCHHHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999887


Q ss_pred             CceeeCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHhcccchhhHhHhHhHHhh
Q psy9637         163 PSFETSAPTPKPQRDKKEFLENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAF  242 (490)
Q Consensus       163 ~~~~~~g~~g~~~g~~a~~~Kll~n~l~~~~~~~~aE~~~la~~a~~~~~~Gld~~~v~~i~~~g~~~~s~~l~~i~~~~  242 (490)
                      .++                                                                             
T Consensus       163 ~~v-----------------------------------------------------------------------------  165 (484)
T 4gwg_A          163 AKV-----------------------------------------------------------------------------  165 (484)
T ss_dssp             CBC-----------------------------------------------------------------------------
T ss_pred             Ccc-----------------------------------------------------------------------------
Confidence            521                                                                             


Q ss_pred             ccCcccccccCChhHHHHHHHHHHHHHHHHHHHHHcCCCchHHHHHHHHHHHHHhCCChhhhHHHHHHhhcccccccccC
Q psy9637         243 DKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPANLLQAQRDYFGAHTYELLAA  322 (490)
Q Consensus       243 ~~~~~~~~~~~~~~f~~~l~~~~kDl~~~~~~A~~~gv~~P~~~aa~~~~~~~~~~g~~~~~~~a~rd~fgah~~~r~~~  322 (490)
                                                                                                      
T Consensus       166 --------------------------------------------------------------------------------  165 (484)
T 4gwg_A          166 --------------------------------------------------------------------------------  165 (484)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCceeecccCCCCCCccccCCCCCcceeecCCCCcchhHHhhhhHHHHHHHHHHHHHHHHHhhcCCChHHHHHHHHHhc
Q psy9637         323 PGKFVHTNWTGHGGNSIAAKVGSEPCCDWVGEQGAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWN  402 (490)
Q Consensus       323 ~~~~~h~~w~~~~~~~~~a~~~~~~c~~~~g~~g~gh~vkmvhngiey~~m~~~~E~~~~~~~~~~~~~~~~~~~~~~w~  402 (490)
                                          .+++|||.|+|+.|+|||||||||+|||++||+++|+|.|+++.+|++++++.++|+.||
T Consensus       166 --------------------~~~~~~~~~~G~~Gag~~vKmv~N~i~~~~m~~iaEa~~l~~~~~Gld~~~l~~v~~~w~  225 (484)
T 4gwg_A          166 --------------------GTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWN  225 (484)
T ss_dssp             --------------------TTSCBSBCCCEETTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHT
T ss_pred             --------------------cCCCceEEEECCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHc
Confidence                                135699999999999999999999999999999999999999768999999999999999


Q ss_pred             cCcchhHHHHHHHHHhcccCCCCCcchhhhccccCCCcchHHHHHHHHhcCCCchhhHHHHHHHhhccCchHHHHHHhhc
Q psy9637         403 KGELDSFLIEITKDILKFKDTDGAPLVEKIKDYAGQKGTGKWTAISALDYGVPVTLIGESVFSRCLSSLFDERQKASQVL  482 (490)
Q Consensus       403 ~g~~~s~l~~~~~~~~~~~~~~~~~~l~~i~~~~~~~g~g~w~~~~a~~~~~p~~~i~~a~~~r~~s~~~~~r~~~~~~~  482 (490)
                      +|+++|||+|++.++|.++|.+|.++||.|+|.++|||||+||+++|+++|||+|+|++|||+|++|++|++|++++++|
T Consensus       226 ~G~~~S~l~e~~~~~l~~~D~~g~~~ld~i~d~~~~kgtG~wt~~~A~~~gvp~p~i~~av~~R~~S~~k~~r~~a~~~l  305 (484)
T 4gwg_A          226 KTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKL  305 (484)
T ss_dssp             TTTTCBHHHHHHHHHHHCBCTTSSBSGGGSCCCCCSSCTTHHHHHHHHHHTCCCHHHHHHHHHHHHHHCHHHHHHHHTTC
T ss_pred             CCCccchHHHHHHHHHhcCCccCCccHHHHhccccCcchHHHHHHHHHHcCCCchHHHHHHHHHHHhhchHHHHHHHhhc
Confidence            99999999999999999888778899999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCC
Q psy9637         483 QGPN  486 (490)
Q Consensus       483 ~~~~  486 (490)
                      ++|.
T Consensus       306 ~~~~  309 (484)
T 4gwg_A          306 KGPQ  309 (484)
T ss_dssp             CCC-
T ss_pred             CCCC
Confidence            8885



>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3ulk_A Ketol-acid reductoisomerase; branched-chain amino acid biosynthesis, rossmann fold, acetolactate, oxidoreductase; HET: CSX NDP; 2.30A {Escherichia coli} PDB: 1yrl_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2b0j_A 5,10-methenyltetrahydromethanopterin hydrogenase; rossmann fold, helix bundle, oxidoreductase; 1.75A {Methanocaldococcus jannaschii} SCOP: a.100.1.11 c.2.1.6 PDB: 3f47_A* 3daf_A* 3dag_A* 3f46_A* 3h65_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 490
d2pgda1297 a.100.1.1 (A:177-473) 6-phosphogluconate dehydroge 2e-75
d2pgda1 297 a.100.1.1 (A:177-473) 6-phosphogluconate dehydroge 8e-60
d1pgja1 300 a.100.1.1 (A:179-478) 6-phosphogluconate dehydroge 2e-56
d1pgja1300 a.100.1.1 (A:179-478) 6-phosphogluconate dehydroge 3e-56
d2pgda2176 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase 1e-29
d1pgja2178 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase 1e-25
d1vpda2161 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase 3e-21
d3cuma2162 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase 4e-21
d2cvza2156 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase 1e-15
d1i36a2152 c.2.1.6 (A:1-152) Conserved hypothetical protein M 6e-10
d2f1ka2165 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {S 2e-04
d2i76a2153 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {The 0.001
d1bg6a2184 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvalin 0.003
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 297 Back     information, alignment and structure

class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain
domain: 6-phosphogluconate dehydrogenase (6PGD)
species: Sheep (Ovis orientalis aries) [TaxId: 9940]
 Score =  237 bits (605), Expect = 2e-75
 Identities = 127/214 (59%), Positives = 143/214 (66%), Gaps = 4/214 (1%)

Query: 126 GCGVSGGEDGARYG---PSLMPGGNPAAWPALKPIFQKLNPSFETSAPTPKPQRDKKEFL 182
           G G         YG     +          +LK    + +   +     P    DKK FL
Sbjct: 85  GTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQNIPFEG-DKKSFL 143

Query: 183 ENIRQALYASKIVSYAQGFMLMRQAAEIHGWKLNYGGIALMWRGGCIIRSVFLGNIKAAF 242
           E+IR+ALYASKI+SYAQGFML+RQAA   GW LNYGGIALMWRGGCIIRSVFLG IK AF
Sbjct: 144 EDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAF 203

Query: 243 DKNPALSNLLLDPFFKDAIHATQSSWRAVVSQSALLGIPTPAFATALAFYDGYRSKRLPA 302
           D+NP L NLLLD FFK A+   Q SWR  +S     GIP P F TAL+FYDGYR   LPA
Sbjct: 204 DRNPGLQNLLLDDFFKSAVENCQDSWRRAISTGVQAGIPMPCFTTALSFYDGYRHAMLPA 263

Query: 303 NLLQAQRDYFGAHTYELLAAPGKFVHTNWTGHGG 336
           NL+QAQRDYFGAHTYELLA PG+F+HTNWTGHGG
Sbjct: 264 NLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGG 297


>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 297 Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Length = 300 Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Length = 300 Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Length = 176 Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Length = 178 Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Length = 161 Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 162 Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 152 Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Length = 165 Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Length = 153 Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query490
d2pgda1 297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 100.0
d1pgja1 300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 100.0
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.97
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.97
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 99.97
d2pgda1297 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ov 99.97
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 99.96
d1pgja1300 6-phosphogluconate dehydrogenase (6PGD) {Trypanoso 99.95
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.95
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 99.86
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 99.84
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 99.79
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 99.77
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 99.72
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 99.61
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 99.61
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 99.54
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 99.54
d2b0ja2242 5,10-methenyltetrahydromethanopterin hydrogenase, 99.52
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 99.51
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 99.46
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 99.42
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 99.41
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 99.33
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 99.33
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 99.21
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 99.16
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 99.11
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 98.87
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 98.82
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 98.81
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 98.77
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 98.74
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 98.72
d3cuma1134 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 98.7
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.67
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 98.63
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 98.61
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 98.61
d1vpda1133 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 98.5
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.47
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.46
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 98.44
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.41
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.38
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 98.37
d2cvza1132 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 98.29
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 98.23
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.21
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 98.15
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 98.12
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 98.11
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.09
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 98.08
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 98.07
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 98.05
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.99
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.99
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.99
d1mv8a198 GDP-mannose 6-dehydrogenase, middle domain {Pseudo 97.96
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 97.9
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.9
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.84
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.83
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.79
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.78
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.75
d1dlja198 UDP-glucose dehydrogenase (UDPGDH), middle domain 97.74
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 97.74
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.7
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 97.64
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 97.64
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.63
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.62
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.62
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.62
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.61
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.6
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.54
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.47
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 97.46
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 97.38
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 97.37
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.34
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.23
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.22
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 97.21
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 97.18
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.16
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 97.1
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.1
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.06
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 97.01
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 96.96
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.95
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 96.93
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.91
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 96.91
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.89
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 96.85
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.84
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 96.75
d1id1a_153 Rck domain from putative potassium channel Kch {Es 96.73
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 96.69
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 96.65
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.63
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 96.58
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 96.53
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.46
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.41
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 96.4
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 96.31
d1mv8a3136 GDP-mannose 6-dehydrogenase, GDP-binding domain {P 96.31
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.29
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.21
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.2
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.2
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.2
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.19
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 96.15
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.12
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 95.96
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 95.94
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.79
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 95.68
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.65
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 95.56
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.51
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 95.45
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 95.44
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.43
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 95.42
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 95.42
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.4
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 95.36
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.35
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 95.33
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 95.29
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.27
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.22
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.2
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 95.16
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 95.06
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.05
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 95.02
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.0
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 94.97
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 94.96
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 94.93
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 94.92
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 94.91
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.85
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 94.85
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 94.82
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 94.82
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.8
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.77
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 94.75
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 94.74
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 94.73
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.72
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.67
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 94.66
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 94.63
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 94.57
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 94.55
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.52
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 94.48
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.45
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 94.44
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 94.43
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.42
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 94.41
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.37
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 94.32
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 94.28
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.26
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 94.26
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 94.25
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.19
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 94.16
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 94.1
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 94.02
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 93.99
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 93.97
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 93.95
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.94
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 93.93
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 93.93
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 93.89
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 93.84
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 93.81
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.79
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 93.61
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 93.56
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 93.55
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 93.55
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.55
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.53
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 93.49
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 93.42
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 93.35
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 93.34
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 93.32
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 93.28
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 93.22
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 93.21
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.15
d1yova1529 Amyloid beta precursor protein-binding protein 1, 93.14
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 93.13
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 93.09
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 93.07
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 92.98
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 92.96
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 92.9
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 92.89
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 92.86
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 92.85
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 92.82
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 92.72
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 92.63
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 92.54
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 92.53
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 92.53
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 92.5
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 92.48
d1ks9a1124 Ketopantoate reductase PanE {Escherichia coli [Tax 92.44
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 92.42
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 92.4
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 92.36
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 92.12
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 92.12
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 92.09
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 91.95
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 91.84
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 91.82
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 91.8
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 91.79
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 91.73
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 91.72
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 91.66
d1i36a1112 Conserved hypothetical protein MTH1747 {Archaeon M 91.47
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 91.37
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 91.26
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 91.25
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 91.2
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 91.19
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 91.12
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.08
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 91.05
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 91.04
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 90.7
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 90.42
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 90.32
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 90.19
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 90.15
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.02
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 89.66
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 89.63
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 89.53
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 89.44
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.38
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 89.24
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 88.97
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 88.75
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 88.69
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 88.67
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 88.64
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 88.54
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 88.48
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 88.41
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 88.23
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 88.13
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 88.12
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 87.96
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 87.83
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 87.67
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 87.44
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 87.19
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 86.84
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 86.61
d2h1qa1251 Hypothetical protein Dhaf_3308 {Desulfitobacterium 85.75
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 85.7
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 85.58
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 85.58
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 85.52
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 85.44
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 85.4
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 84.77
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 84.67
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 84.57
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 84.4
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 84.36
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 84.28
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 83.95
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 83.87
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 83.39
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 83.17
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 83.17
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 82.86
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 82.68
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 82.67
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 82.4
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 82.23
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 81.82
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 81.52
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 81.39
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 81.24
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.19
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 81.17
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 80.97
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 80.95
d1dlja3108 UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD 80.82
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 80.82
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 80.67
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 80.16
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 80.15
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 80.12
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
class: All alpha proteins
fold: 6-phosphogluconate dehydrogenase C-terminal domain-like
superfamily: 6-phosphogluconate dehydrogenase C-terminal domain-like
family: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain
domain: 6-phosphogluconate dehydrogenase (6PGD)
species: Sheep (Ovis orientalis aries) [TaxId: 9940]
Probab=100.00  E-value=3.9e-45  Score=358.88  Aligned_cols=131  Identities=76%  Similarity=1.242  Sum_probs=127.1

Q ss_pred             CCcchhHHhhhhHHHHHHHHHHHHHHHHHhhcCCChHHHHHHHHHhccCcchhHHHHHHHHHhcccCCCCCcchhhhccc
Q psy9637         356 GAGHFVKMVHNGIEYGDMQLICEAYHLMTGALGMSHDEMSAVFEDWNKGELDSFLIEITKDILKFKDTDGAPLVEKIKDY  435 (490)
Q Consensus       356 g~gh~vkmvhngiey~~m~~~~E~~~~~~~~~~~~~~~~~~~~~~w~~g~~~s~l~~~~~~~~~~~~~~~~~~l~~i~~~  435 (490)
                      |||||||||||||||||||+|||+|++|++.++++++||++||+.||+|.++|||+||++++|++||++++++||.|.|+
T Consensus         1 GsGH~vKMVHNgIEY~~mq~iaE~y~~l~~~~~~~~~~i~~vf~~w~~~~l~syLleit~~il~~kd~~~~~~ld~I~d~   80 (297)
T d2pgda1           1 GAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGLGHKEMAKAFEEWNKTELDSFLIEITASILKFQDADGKHLLPKIRDS   80 (297)
T ss_dssp             THHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCHHHHHHHHHHHTTTTTCBHHHHHHHHHHHCBCTTSSBSGGGSCCC
T ss_pred             CCchhhhhhccHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHhCCCccHHHHHHHHHHHhccCCCcCcchhhhhcc
Confidence            89999999999999999999999999999988999999999999999999999999999999998887788999999999


Q ss_pred             cCCCcchHHHHHHHHhcCCCchhhHHHHHHHhhccCchHHHHHHhhcCCCC
Q psy9637         436 AGQKGTGKWTAISALDYGVPVTLIGESVFSRCLSSLFDERQKASQVLQGPN  486 (490)
Q Consensus       436 ~~~~g~g~w~~~~a~~~~~p~~~i~~a~~~r~~s~~~~~r~~~~~~~~~~~  486 (490)
                      ++|||||+||+++|+++|||+|+|++||++|++|+.|++|++.++.++++.
T Consensus        81 a~~kGTG~Wt~~~Al~lgvp~p~I~~Av~aR~~S~~k~~R~~~~~~~~~~~  131 (297)
T d2pgda1          81 AGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQ  131 (297)
T ss_dssp             CCCCSHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHCHHHHHHHHHHCCCCC
T ss_pred             ccCCCchHHHHHHHHHcCCCchHHHHHHhhHhhcccHHHHHHhhhcccCcc
Confidence            999999999999999999999999999999999999999999999998764



>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2pgda1 a.100.1.1 (A:177-473) 6-phosphogluconate dehydrogenase (6PGD) {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1pgja1 a.100.1.1 (A:179-478) 6-phosphogluconate dehydrogenase (6PGD) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b0ja2 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Archaeon Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d3cuma1 a.100.1.1 (A:163-296) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpda1 a.100.1.1 (A:164-296) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cvza1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1mv8a1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1dlja1 a.100.1.4 (A:197-294) UDP-glucose dehydrogenase (UDPGDH), middle domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ks9a1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1i36a1 a.100.1.8 (A:153-264) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure