Psyllid ID: psy9643


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--
MAVYYIDAADAEMAELVEMEMRELLTEMGWKGDEVPFVKGSALCALEGKEPEIGIIPLYPNDKFEINKLNVFVPLINSRRGYAEKQVYSRDKPHCNIGTIGHVDHGKTTLTAAITKGLMEGMLGSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYIGEHQLNSTD
ccEEEEccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEcccccHHHHccccccEEcccccccccHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHccccEEEccccccccccccccccccEEEEEEEccEEEEEEEcccccccccccccccHHHHHHHHccccEEEEEccccccccccccccEEEEcccccccccccccccccccccccccccccccHHccHHHHHHHHHHHHHccccccccccEEEEccccccccHHHHHHHHHHcccccccccHHHHHHHHccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
ccEEEEcHHcHHHHHHHHHHHHHHHHHccccHHHccEEEccHHHHHccccccccHEEccccccEEEccccEEEEcccccccccHccEccccccEEEEEEEccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccEEEEEccccHHHHHHcEEEEEEEHHHccccccccccccccEEEEEEEccEEEEEEEccccHHHcccHHHHcHHHHHHHcccccEEEEEEEEEEcccccccccEEEEEEEEEHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEEEccccccccHHHHHHHHHccccEEEcccHHHHHHHHHcccEEEEEEEEEEEccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHcccc
MAVYYIDAADAEMAELVEMEMRELLTEMgwkgdevpfvkgsalcalegkepeigiiplypndkfeinklnvfvplinsrrgyaekqvysrdkphcnigtighvdhgktTLTAAITKGLMEGMLGSYTYELIQSIAKFLLDsisirpkigiicgsglstiadsitdrhifpydtipyfpvstvpghkgqlVFGLINGipimcmqgrfhyyegyplwkcampirVMKLVGVTHLLATnaagglnpdyevgdiMIIKDHINlmgfagnnpllgvnedrfgprfppmnkaYNKQLRAATLDIARDLNMSSIVKEGVYsviggpnfetVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLitnkcvtdyddhaeaNHEEVIQAGKLRGPMIKSMVTRIVSYIGehqlnstd
mavyyidaadaeMAELVEMEMRELLTEMGWKGDEVPFVKGSALCALEGKEPEIGIIPLYPNDKFEINKLNVFVPLINSRRGYAEKQVYSRDKPhcnigtighvdhgkTTLTAAITKGLMEGMLGSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNKCVTDYDDHAEANHEEViqagklrgpmIKSMVTRIVSYigehqlnstd
MAVYYIDAADAEMAELVEMEMRELLTEMGWKGDEVPFVKGSALCALEGKEPEIGIIPLYPNDKFEINKLNVFVPLINSRRGYAEKQVYSRDKPHCNIGTIGHVDHGKTTLTAAITKGLMEGMLGSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYIGEHQLNSTD
**VYYIDAADAEMAELVEMEMRELLTEMGWKGDEVPFVKGSALCALEGKEPEIGIIPLYPNDKFEINKLNVFVPLINSRRGYAEKQVYSRDKPHCNIGTIGHVDHGKTTLTAAITKGLMEGMLGSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYIG********
*AVYYIDAADAEMAELVEMEMRELLTEMGWKGDEVPFVKGSALCALEGKEPEIGIIPLYPNDKFEINKLNVFVPLINS*************************************************YELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIV************
MAVYYIDAADAEMAELVEMEMRELLTEMGWKGDEVPFVKGSALCALEGKEPEIGIIPLYPNDKFEINKLNVFVPLINSRRGYAEKQVYSRDKPHCNIGTIGHVDHGKTTLTAAITKGLMEGMLGSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYIGEHQLNSTD
MAVYYIDAADAEMAELVEMEMRELLTEMGWKGDEVPFVKGSALCALEGKEPEIGIIPLYPNDKFEINKLNVFVPLINSRRGYAEKQVYSRDKPHCNIGTIGHVDHGKTTLTAAITKGLMEGMLGSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYIGE*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVYYIDAADAEMAELVEMEMRELLTEMGWKGDEVPFVKGSALCALEGKEPEIGIIPLYPNDKFEINKLNVFVPLINSRRGYAEKQVYSRDKPHCNIGTIGHVDHGKTTLTAAITKGLMEGMLGSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYIGEHQLNSTD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query412 2.2.26 [Sep-21-2011]
P55859289 Purine nucleoside phospho yes N/A 0.684 0.975 0.531 4e-88
P00491289 Purine nucleoside phospho yes N/A 0.684 0.975 0.528 2e-85
P23492289 Purine nucleoside phospho yes N/A 0.684 0.975 0.510 4e-81
P85973289 Purine nucleoside phospho yes N/A 0.684 0.975 0.5 7e-79
P46354271 Purine nucleoside phospho yes N/A 0.628 0.955 0.474 2e-65
P77834274 Purine nucleoside phospho N/A N/A 0.597 0.897 0.505 7e-65
Q9UTG1315 Putative purine nucleosid yes N/A 0.628 0.822 0.449 3e-63
Q05788311 Purine nucleoside phospho yes N/A 0.618 0.819 0.435 2e-56
P45563277 Purine nucleoside phospho N/A N/A 0.570 0.848 0.425 5e-49
P46862268 Purine nucleoside phospho yes N/A 0.618 0.951 0.338 1e-33
>sp|P55859|PNPH_BOVIN Purine nucleoside phosphorylase OS=Bos taurus GN=PNP PE=1 SV=3 Back     alignment and function desciption
 Score =  325 bits (833), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 194/282 (68%)

Query: 122 MLGSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVST 181
           M   YTYE  Q  AK+LL     RP++ +ICGSGL  + + +T    F Y  IP FP ST
Sbjct: 1   MANGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPEST 60

Query: 182 VPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGL 241
           VPGH G+LVFG++NG   + MQGRFH YEGYP WK   P+RV +L+GV  L+ TNAAGGL
Sbjct: 61  VPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGL 120

Query: 242 NPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARD 301
           NP++EVGDIM+I+DHINL GF+G NPL G NE+RFG RFP M+ AY++ +R       + 
Sbjct: 121 NPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ 180

Query: 302 LNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSL 361
           +     ++EG Y ++GGPNFETVAE  +LR  G DAVGMSTV EVI A HCG+ V  FSL
Sbjct: 181 MGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSL 240

Query: 362 ITNKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYI 403
           ITNK + DY+   +ANHEEV++AGK     ++  V+ +++ I
Sbjct: 241 ITNKVIMDYESQGKANHEEVLEAGKQAAQKLEQFVSLLMASI 282





Bos taurus (taxid: 9913)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 1
>sp|P00491|PNPH_HUMAN Purine nucleoside phosphorylase OS=Homo sapiens GN=PNP PE=1 SV=2 Back     alignment and function description
>sp|P23492|PNPH_MOUSE Purine nucleoside phosphorylase OS=Mus musculus GN=Pnp PE=1 SV=2 Back     alignment and function description
>sp|P85973|PNPH_RAT Purine nucleoside phosphorylase OS=Rattus norvegicus GN=Pnp PE=1 SV=1 Back     alignment and function description
>sp|P46354|PUNA_BACSU Purine nucleoside phosphorylase 1 OS=Bacillus subtilis (strain 168) GN=punA PE=1 SV=1 Back     alignment and function description
>sp|P77834|PUNA_GEOSE Purine nucleoside phosphorylase 1 OS=Geobacillus stearothermophilus GN=punA PE=3 SV=1 Back     alignment and function description
>sp|Q9UTG1|PNPH_SCHPO Putative purine nucleoside phosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1805.16c PE=3 SV=1 Back     alignment and function description
>sp|Q05788|PNPH_YEAST Purine nucleoside phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PNP1 PE=1 SV=1 Back     alignment and function description
>sp|P45563|XAPA_ECOLI Purine nucleoside phosphorylase 2 OS=Escherichia coli (strain K12) GN=xapA PE=1 SV=2 Back     alignment and function description
>sp|P46862|PUNA_MYCLE Purine nucleoside phosphorylase OS=Mycobacterium leprae (strain TN) GN=punA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query412
307185201331 Purine nucleoside phosphorylase [Campono 0.669 0.833 0.674 1e-115
332017648332 Purine nucleoside phosphorylase [Acromyr 0.669 0.831 0.664 1e-114
383847084335 PREDICTED: purine nucleoside phosphoryla 0.669 0.823 0.653 1e-112
91079867308 PREDICTED: similar to AGAP005945-PB [Tri 0.686 0.918 0.636 1e-110
328784609327 PREDICTED: purine nucleoside phosphoryla 0.682 0.859 0.632 1e-109
389609203318 purine nucleoside phosphorylase [Papilio 0.679 0.880 0.642 1e-108
380029277332 PREDICTED: purine nucleoside phosphoryla 0.747 0.927 0.583 1e-108
156537211323 PREDICTED: purine nucleoside phosphoryla 0.682 0.869 0.615 1e-108
389611409324 purine nucleoside phosphorylase [Papilio 0.679 0.864 0.629 1e-106
357626311318 hypothetical protein KGM_22551 [Danaus p 0.669 0.867 0.619 1e-105
>gi|307185201|gb|EFN71333.1| Purine nucleoside phosphorylase [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 193/286 (67%), Positives = 234/286 (81%), Gaps = 10/286 (3%)

Query: 125 SYTYELIQSIAKFLLDSISIRPKIGIICGSGLST----------IADSITDRHIFPYDTI 174
           +YT+E++Q  A++LLD I IRPKIGIICGSG+ +          IA+S+ D+  FPY+ I
Sbjct: 34  TYTFEILQESAQYLLDRIKIRPKIGIICGSGMGSYVQNELCPGLIAESLVDKQCFPYEEI 93

Query: 175 PYFPVSTVPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLA 234
           P+FPVSTV GH GQ+VFG + G+P+MCMQGRFHYYEGYPLWKCAMP+RVMKLVGVTHL+A
Sbjct: 94  PHFPVSTVKGHTGQMVFGYLRGVPVMCMQGRFHYYEGYPLWKCAMPVRVMKLVGVTHLIA 153

Query: 235 TNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAA 294
           TNAAGGLNP Y VGDIMI+KDH+N+MGFAGNNPL G N+DRFGPRFPPMNKAYN  L   
Sbjct: 154 TNAAGGLNPTYNVGDIMIVKDHVNMMGFAGNNPLQGPNDDRFGPRFPPMNKAYNDTLIEI 213

Query: 295 TLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGM 354
              +A ++ +S+ V +GVY+ +GGPNFETVAEL MLR+ GVDAVGMSTVHEVITA HC +
Sbjct: 214 GSQVAEEMGISNTVHKGVYTCLGGPNFETVAELKMLRMIGVDAVGMSTVHEVITARHCDL 273

Query: 355 TVTAFSLITNKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIV 400
           TV AFSLITN+CVTDY++H EANHEEV+  GK R P+++  V+RIV
Sbjct: 274 TVFAFSLITNQCVTDYENHGEANHEEVMDVGKSRQPILQEFVSRIV 319




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332017648|gb|EGI58340.1| Purine nucleoside phosphorylase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383847084|ref|XP_003699185.1| PREDICTED: purine nucleoside phosphorylase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91079867|ref|XP_967070.1| PREDICTED: similar to AGAP005945-PB [Tribolium castaneum] gi|270004553|gb|EFA01001.1| hypothetical protein TcasGA2_TC003914 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328784609|ref|XP_391850.3| PREDICTED: purine nucleoside phosphorylase-like [Apis mellifera] Back     alignment and taxonomy information
>gi|389609203|dbj|BAM18213.1| purine nucleoside phosphorylase [Papilio xuthus] Back     alignment and taxonomy information
>gi|380029277|ref|XP_003698303.1| PREDICTED: purine nucleoside phosphorylase-like [Apis florea] Back     alignment and taxonomy information
>gi|156537211|ref|XP_001604902.1| PREDICTED: purine nucleoside phosphorylase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|389611409|dbj|BAM19316.1| purine nucleoside phosphorylase [Papilio polytes] Back     alignment and taxonomy information
>gi|357626311|gb|EHJ76442.1| hypothetical protein KGM_22551 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query412
FB|FBgn0035348356 CG16758 [Drosophila melanogast 0.674 0.780 0.585 2.3e-87
ZFIN|ZDB-GENE-040426-2553293 pnp5a "purine nucleoside phosp 0.686 0.965 0.563 2e-86
ZFIN|ZDB-GENE-040912-54294 pnp5b "purine nucleoside phosp 0.674 0.945 0.557 1.1e-80
UNIPROTKB|P55859289 PNP "Purine nucleoside phospho 0.684 0.975 0.531 1.8e-80
ZFIN|ZDB-GENE-040426-1800286 pnp6 "purine nucleoside phosph 0.669 0.965 0.536 2.6e-79
UNIPROTKB|P00491289 PNP "Purine nucleoside phospho 0.684 0.975 0.528 3.8e-78
UNIPROTKB|F1S8H8308 PNP "Purine nucleoside phospho 0.689 0.922 0.512 4.3e-77
ZFIN|ZDB-GENE-040426-1887304 pnp4b "purine nucleoside phosp 0.660 0.894 0.525 2.1e-75
MGI|MGI:97365289 Pnp "purine-nucleoside phospho 0.684 0.975 0.510 2.5e-74
ZFIN|ZDB-GENE-040625-83291 pnp4a "purine nucleoside phosp 0.665 0.941 0.518 6.5e-74
FB|FBgn0035348 CG16758 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 873 (312.4 bits), Expect = 2.3e-87, P = 2.3e-87
 Identities = 164/280 (58%), Positives = 206/280 (73%)

Query:   126 YTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGH 185
             Y YE+I+ IA F+     +RPKIGIICGSGL ++AD I D  IF Y+ IP FPVSTV GH
Sbjct:    72 YPYEVIEEIADFITKGSGMRPKIGIICGSGLGSLADMIQDPKIFEYEKIPNFPVSTVEGH 131

Query:   186 KGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDY 245
              G+LV G + G  +M MQGRFH+YEGYPL KC+MP+RVMKL GV +L ATNAAGG+NP +
Sbjct:   132 AGRLVVGTLEGATVMAMQGRFHFYEGYPLAKCSMPVRVMKLCGVEYLFATNAAGGINPRF 191

Query:   246 EVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMS 305
              VGDIM++ DH+N++GFAGN+PL G N+ RFGPRFP +  +YNK L    ++IA+ + + 
Sbjct:   192 AVGDIMLMHDHVNMLGFAGNSPLQGPNDPRFGPRFPALVNSYNKDLINKAIEIAKAMGIE 251

Query:   306 SIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNK 365
             S +  GVYS +GGPN+ET+AEL  LR+ GVDAVGMSTVHEVITA HC M V AFSLITNK
Sbjct:   252 SNIHVGVYSCLGGPNYETIAELKALRMMGVDAVGMSTVHEVITARHCDMKVFAFSLITNK 311

Query:   366 CVTDYDDHA--EANHEEVIQAGKLRGPMIKSMVTRIVSYI 403
             C T+Y D    EANH+EV+   K R      +V+R++  I
Sbjct:   312 CATEYSDKKDDEANHDEVMAVAKNRQKACCELVSRLIREI 351




GO:0004731 "purine-nucleoside phosphorylase activity" evidence=ISS
GO:0009116 "nucleoside metabolic process" evidence=IEA
ZFIN|ZDB-GENE-040426-2553 pnp5a "purine nucleoside phosphorylase 5a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-54 pnp5b "purine nucleoside phosphorylase 5b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P55859 PNP "Purine nucleoside phosphorylase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1800 pnp6 "purine nucleoside phosphorylase 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P00491 PNP "Purine nucleoside phosphorylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8H8 PNP "Purine nucleoside phosphorylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1887 pnp4b "purine nucleoside phosphorylase 4b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:97365 Pnp "purine-nucleoside phosphorylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-83 pnp4a "purine nucleoside phosphorylase 4a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0A539PUNA_MYCBO2, ., 4, ., 2, ., 10.32360.61890.9514yesN/A
P0A538PUNA_MYCTU2, ., 4, ., 2, ., 10.32360.61890.9514yesN/A
P46354PUNA_BACSU2, ., 4, ., 2, ., 10.47440.62860.9557yesN/A
P55859PNPH_BOVIN2, ., 4, ., 2, ., 10.53190.68440.9757yesN/A
P46862PUNA_MYCLE2, ., 4, ., 2, ., 10.33810.61890.9514yesN/A
Q9UTG1PNPH_SCHPO2, ., 4, ., 2, ., 10.44920.62860.8222yesN/A
P00491PNPH_HUMAN2, ., 4, ., 2, ., 10.52830.68440.9757yesN/A
P85973PNPH_RAT2, ., 4, ., 2, ., 10.50.68440.9757yesN/A
P23492PNPH_MOUSE2, ., 4, ., 2, ., 10.51060.68440.9757yesN/A
Q05788PNPH_YEAST2, ., 4, ., 2, ., 10.43540.61890.8199yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.4.2.10.824
3rd Layer2.4.20.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query412
PRK08202272 PRK08202, PRK08202, purine nucleoside phosphorylas 1e-124
TIGR01700249 TIGR01700, PNPH, purine nucleoside phosphorylase I 1e-113
TIGR01697248 TIGR01697, PNPH-PUNA-XAPA, inosine/guanosine/xanth 1e-113
COG0005262 COG0005, Pnp, Purine nucleoside phosphorylase [Nuc 8e-76
TIGR01699248 TIGR01699, XAPA, xanthosine phosphorylase 9e-62
TIGR01698237 TIGR01698, PUNP, purine nucleotide phosphorylase 6e-61
pfam01048232 pfam01048, PNP_UDP_1, Phosphorylase superfamily 1e-44
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 2e-17
TIGR01694241 TIGR01694, MTAP, 5'-deoxy-5'-methylthioadenosine p 3e-17
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 1e-16
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 2e-16
PRK08666261 PRK08666, PRK08666, 5'-methylthioadenosine phospho 2e-16
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 2e-16
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 4e-14
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 8e-14
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 1e-13
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisio 1e-13
COG0050394 COG0050, TufB, GTPases - translation elongation fa 2e-13
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 4e-13
CHL00071409 CHL00071, tufA, elongation factor Tu 4e-13
COG0050394 COG0050, TufB, GTPases - translation elongation fa 1e-12
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisio 7e-12
PRK09136245 PRK09136, PRK09136, 5'-methylthioadenosine phospho 7e-12
PRK08931289 PRK08931, PRK08931, 5'-methylthioadenosine phospho 9e-12
PRK08564267 PRK08564, PRK08564, 5'-methylthioadenosine phospho 9e-12
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 1e-11
PRK07432290 PRK07432, PRK07432, 5'-methylthioadenosine phospho 3e-10
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisio 5e-10
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 1e-09
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 4e-09
CHL00071409 CHL00071, tufA, elongation factor Tu 6e-09
PRK07823264 PRK07823, PRK07823, 5'-methylthioadenosine phospho 1e-07
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisio 2e-06
PRK04000411 PRK04000, PRK04000, translation initiation factor 2e-06
COG5257415 COG5257, GCD11, Translation initiation factor 2, g 2e-06
cd01888197 cd01888, eIF2_gamma, Gamma subunit of initiation f 4e-06
TIGR03680406 TIGR03680, eif2g_arch, translation initiation fact 1e-05
cd00881183 cd00881, GTP_translation_factor, GTP translation f 4e-05
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 1e-04
PRK12317 425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 1e-04
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 5e-04
COG5258527 COG5258, GTPBP1, GTPase [General function predicti 6e-04
PRK10512 614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific 6e-04
PTZ00327 460 PTZ00327, PTZ00327, eukaryotic translation initiat 6e-04
cd01885218 cd01885, EF2, Elongation Factor 2 (EF2) in archaea 0.002
COG0480 697 COG0480, FusA, Translation elongation factors (GTP 0.002
PRK07560 731 PRK07560, PRK07560, elongation factor EF-2; Review 0.002
cd01889192 cd01889, SelB_euk, SelB, the dedicated elongation 0.003
COG5256 428 COG5256, TEF1, Translation elongation factor EF-1a 0.004
>gnl|CDD|236183 PRK08202, PRK08202, purine nucleoside phosphorylase; Provisional Back     alignment and domain information
 Score =  359 bits (923), Expect = e-124
 Identities = 134/274 (48%), Positives = 176/274 (64%), Gaps = 8/274 (2%)

Query: 128 YELIQSIAKFLLDSISI-RPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHK 186
            E I+  A F+ +     +P+IG+I GSGL  +AD I +  + PY  IP FPVSTV GH 
Sbjct: 3   LEKIEEAAAFIREKTGAFKPEIGLILGSGLGALADEIENAVVIPYADIPGFPVSTVEGHA 62

Query: 187 GQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYE 246
           G+LV G + G P++ MQGRFHYYEGY +     P+RVMK +GV  L+ TNAAGGLNPD+ 
Sbjct: 63  GELVLGRLGGKPVLAMQGRFHYYEGYSMEAVTFPVRVMKALGVETLIVTNAAGGLNPDFG 122

Query: 247 VGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMSS 306
            GD+M+I DHINL    G NPL+G N+D FGPRFP M+ AY+ +LRA    +A++L +  
Sbjct: 123 PGDLMLISDHINLT---GRNPLIGPNDDEFGPRFPDMSDAYDPELRALAKKVAKELGIP- 178

Query: 307 IVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNKC 366
            ++EGVY  + GP++ET AE+ MLR  G DAVGMSTV EVI A HCG+ V   S ITN  
Sbjct: 179 -LQEGVYVGVSGPSYETPAEIRMLRTLGADAVGMSTVPEVIVARHCGLKVLGISCITNLA 237

Query: 367 VTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIV 400
               D     +HEEV++  +   P    +V  I+
Sbjct: 238 AGISD--EPLSHEEVLEVAERAAPKFGRLVKAIL 269


Length = 272

>gnl|CDD|233537 TIGR01700, PNPH, purine nucleoside phosphorylase I, inosine and guanosine-specific Back     alignment and domain information
>gnl|CDD|130758 TIGR01697, PNPH-PUNA-XAPA, inosine/guanosine/xanthosine phosphorylase family Back     alignment and domain information
>gnl|CDD|223084 COG0005, Pnp, Purine nucleoside phosphorylase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130760 TIGR01699, XAPA, xanthosine phosphorylase Back     alignment and domain information
>gnl|CDD|130759 TIGR01698, PUNP, purine nucleotide phosphorylase Back     alignment and domain information
>gnl|CDD|216264 pfam01048, PNP_UDP_1, Phosphorylase superfamily Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|233535 TIGR01694, MTAP, 5'-deoxy-5'-methylthioadenosine phosphorylase Back     alignment and domain information
>gnl|CDD|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|169548 PRK08666, PRK08666, 5'-methylthioadenosine phosphorylase; Validated Back     alignment and domain information
>gnl|CDD|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|236390 PRK09136, PRK09136, 5'-methylthioadenosine phosphorylase; Validated Back     alignment and domain information
>gnl|CDD|181584 PRK08931, PRK08931, 5'-methylthioadenosine phosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|236290 PRK08564, PRK08564, 5'-methylthioadenosine phosphorylase II; Reviewed Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|180977 PRK07432, PRK07432, 5'-methylthioadenosine phosphorylase; Provisional Back     alignment and domain information
>gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|236107 PRK07823, PRK07823, 5'-methylthioadenosine phosphorylase; Validated Back     alignment and domain information
>gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma) Back     alignment and domain information
>gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|227583 COG5258, GTPBP1, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>gnl|CDD|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed Back     alignment and domain information
>gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 412
KOG3984|consensus286 100.0
TIGR01698237 PUNP purine nucleotide phosphorylase. methylthioad 100.0
TIGR01699248 XAPA xanthosine phosphorylase. (TIGR01698, TIGR017 100.0
PRK08202272 purine nucleoside phosphorylase; Provisional 100.0
COG0005262 Pnp Purine nucleoside phosphorylase [Nucleotide tr 100.0
TIGR01700249 PNPH purine nucleoside phosphorylase I, inosine an 100.0
PRK08931289 5'-methylthioadenosine phosphorylase; Provisional 100.0
PRK07823264 5'-methylthioadenosine phosphorylase; Validated 100.0
PRK07432290 5'-methylthioadenosine phosphorylase; Provisional 100.0
PRK08564267 5'-methylthioadenosine phosphorylase II; Reviewed 100.0
PRK09136245 5'-methylthioadenosine phosphorylase; Validated 100.0
TIGR01697248 PNPH-PUNA-XAPA inosine guanosine and xanthosine ph 100.0
PRK08666261 5'-methylthioadenosine phosphorylase; Validated 100.0
KOG3985|consensus283 100.0
TIGR01694241 MTAP 5'-deoxy-5'-methylthioadenosine phosphorylase 100.0
KOG0460|consensus449 99.93
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.91
COG0050394 TufB GTPases - translation elongation factors [Tra 99.9
PF01048234 PNP_UDP_1: Phosphorylase superfamily; InterPro: IP 99.85
KOG0460|consensus449 99.84
PRK06714236 S-adenosylhomocysteine nucleosidase; Validated 99.83
PRK05584230 5'-methylthioadenosine/S-adenosylhomocysteine nucl 99.82
PRK14697233 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.81
PRK06698 459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.8
TIGR01704228 MTA/SAH-Nsdase 5'-methylthioadenosine/S-adenosylho 99.79
KOG0458|consensus 603 99.79
TIGR03468212 HpnG hopanoid-associated phosphorylase. The sequen 99.77
PRK07164218 5'-methylthioadenosine/S-adenosylhomocysteine nucl 99.73
COG0050394 TufB GTPases - translation elongation factors [Tra 99.73
COG0775234 Pfs Nucleoside phosphorylase [Nucleotide transport 99.71
PLN02584249 5'-methylthioadenosine nucleosidase 99.71
PRK13374233 purine nucleoside phosphorylase; Provisional 99.7
PLN00043 447 elongation factor 1-alpha; Provisional 99.7
TIGR00107232 deoD purine-nucleoside phosphorylase, family 1 (de 99.68
PRK05819235 deoD purine nucleoside phosphorylase; Reviewed 99.67
COG0813236 DeoD Purine-nucleoside phosphorylase [Nucleotide t 99.67
TIGR01718245 Uridine-psphlse uridine phosphorylase. Sequences f 99.65
PRK07115258 AMP nucleosidase; Provisional 99.65
PTZ00141 446 elongation factor 1- alpha; Provisional 99.64
TIGR03664222 fut_nucase futalosine nucleosidase. This enzyme ca 99.63
PRK07077238 hypothetical protein; Provisional 99.61
PRK11178251 uridine phosphorylase; Provisional 99.6
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.6
TIGR01705212 MTA/SAH-nuc-hyp 5'-methylthioadenosine/S-adenosylh 99.59
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 99.59
PRK08236212 hypothetical protein; Provisional 99.59
TIGR01721266 AMN-like AMP nucleosidase, putative. The sequences 99.58
PRK06026212 5'-methylthioadenosine/S-adenosylhomocysteine nucl 99.57
PLN03127447 Elongation factor Tu; Provisional 99.57
KOG0459|consensus501 99.56
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.54
TIGR01719287 euk_UDPppase uridine phosphorylase. This model rep 99.54
KOG0462|consensus 650 99.53
PRK12736394 elongation factor Tu; Reviewed 99.52
TIGR00485394 EF-Tu translation elongation factor TU. This align 99.52
PRK12735396 elongation factor Tu; Reviewed 99.52
PRK08292489 AMP nucleosidase; Provisional 99.51
PLN03126478 Elongation factor Tu; Provisional 99.5
COG5257415 GCD11 Translation initiation factor 2, gamma subun 99.5
PRK12317 425 elongation factor 1-alpha; Reviewed 99.49
TIGR01717477 AMP-nucleosdse AMP nucleosidase. This model repres 99.48
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 99.48
PRK00049396 elongation factor Tu; Reviewed 99.48
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.46
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.46
CHL00071409 tufA elongation factor Tu 99.45
KOG0052|consensus391 99.41
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 99.4
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.4
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.39
KOG0461|consensus 522 99.37
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.35
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.34
KOG0466|consensus 466 99.34
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.32
COG2820248 Udp Uridine phosphorylase [Nucleotide transport an 99.3
PRK05634185 nucleosidase; Provisional 99.26
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.26
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.25
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.12
COG3276 447 SelB Selenocysteine-specific translation elongatio 99.11
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.1
PRK07560 731 elongation factor EF-2; Reviewed 99.1
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.1
PRK04000411 translation initiation factor IF-2 subunit gamma; 99.09
PTZ00416 836 elongation factor 2; Provisional 99.06
KOG0465|consensus 721 99.03
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 99.02
PRK05433 600 GTP-binding protein LepA; Provisional 99.01
PRK00007 693 elongation factor G; Reviewed 99.0
PRK10218 607 GTP-binding protein; Provisional 98.99
PRK12739 691 elongation factor G; Reviewed 98.98
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 98.96
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.88
KOG0469|consensus 842 98.87
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 98.87
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 98.85
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.83
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 98.83
PRK00741 526 prfC peptide chain release factor 3; Provisional 98.79
KOG0464|consensus 753 98.79
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.78
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.76
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 98.74
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 98.72
TIGR00503 527 prfC peptide chain release factor 3. This translat 98.71
KOG0467|consensus 887 98.62
PRK13351 687 elongation factor G; Reviewed 98.56
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 98.55
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.4
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.4
KOG1145|consensus 683 98.37
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.33
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.33
PRK12740 668 elongation factor G; Reviewed 98.33
PRK05306 787 infB translation initiation factor IF-2; Validated 98.27
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 98.21
COG5258527 GTPBP1 GTPase [General function prediction only] 98.11
CHL00189 742 infB translation initiation factor 2; Provisional 98.1
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.09
PRK04004 586 translation initiation factor IF-2; Validated 97.81
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 97.75
KOG0468|consensus 971 97.65
cd04171164 SelB SelB subfamily. SelB is an elongation factor 97.55
cd00881189 GTP_translation_factor GTP translation factor fami 97.19
PRK00093435 GTP-binding protein Der; Reviewed 96.99
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 96.89
PLN03127447 Elongation factor Tu; Provisional 96.73
KOG1144|consensus 1064 96.65
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 96.6
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 96.58
PRK12736394 elongation factor Tu; Reviewed 96.52
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 96.49
PLN03126478 Elongation factor Tu; Provisional 96.4
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 96.25
TIGR00485394 EF-Tu translation elongation factor TU. This align 96.18
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 96.06
COG1159298 Era GTPase [General function prediction only] 95.99
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 95.97
PRK12735396 elongation factor Tu; Reviewed 95.89
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 95.8
PRK00049396 elongation factor Tu; Reviewed 95.66
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 95.6
CHL00071409 tufA elongation factor Tu 95.4
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 94.97
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 94.73
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 94.71
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 94.53
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 94.51
cd04105203 SR_beta Signal recognition particle receptor, beta 94.46
KOG0463|consensus 641 93.95
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 93.61
PRK00093 435 GTP-binding protein Der; Reviewed 93.61
TIGR00231161 small_GTP small GTP-binding protein domain. This m 93.58
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 93.54
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 93.36
PRK14845 1049 translation initiation factor IF-2; Provisional 93.32
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 93.23
PF1355562 AAA_29: P-loop containing region of AAA domain 93.11
PRK04213201 GTP-binding protein; Provisional 92.95
PRK00454196 engB GTP-binding protein YsxC; Reviewed 92.65
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 92.46
cd01878204 HflX HflX subfamily. A distinct conserved domain w 92.4
PRK03003472 GTP-binding protein Der; Reviewed 92.28
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 92.14
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 92.06
KOG1143|consensus 591 91.95
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 91.82
COG2229187 Predicted GTPase [General function prediction only 91.76
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 91.73
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 91.56
COG1084346 Predicted GTPase [General function prediction only 91.43
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 91.4
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 90.83
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 90.62
PRK13948182 shikimate kinase; Provisional 90.41
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 90.3
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 90.12
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 90.09
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 90.03
PRK00625173 shikimate kinase; Provisional 90.0
PRK15467158 ethanolamine utilization protein EutP; Provisional 89.97
PRK05057172 aroK shikimate kinase I; Reviewed 89.91
TIGR00235207 udk uridine kinase. Model contains a number of lon 89.72
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 89.57
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 89.54
PRK05480209 uridine/cytidine kinase; Provisional 89.41
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 89.29
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 89.22
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 89.17
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 88.99
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 88.74
COG1160444 Predicted GTPases [General function prediction onl 88.72
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 88.59
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 88.58
PRK06696223 uridine kinase; Validated 88.56
PRK13949169 shikimate kinase; Provisional 88.49
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 88.27
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 88.06
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 88.02
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 88.01
PRK08118167 topology modulation protein; Reviewed 87.95
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 87.95
COG1101263 PhnK ABC-type uncharacterized transport system, AT 87.93
PRK13947171 shikimate kinase; Provisional 87.8
PRK08099399 bifunctional DNA-binding transcriptional repressor 87.71
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 87.71
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 87.64
PLN03071219 GTP-binding nuclear protein Ran; Provisional 87.59
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 87.57
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 87.53
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 87.45
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 87.44
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 87.4
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 87.33
cd00154159 Rab Rab family. Rab GTPases form the largest famil 87.32
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 87.3
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 87.19
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 87.16
PF00005137 ABC_tran: ABC transporter This structure is on hol 87.11
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 86.84
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 86.82
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 86.77
COG4167267 SapF ABC-type antimicrobial peptide transport syst 86.77
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 86.75
PRK06217183 hypothetical protein; Validated 86.65
PRK03839180 putative kinase; Provisional 86.59
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 86.52
KOG1532|consensus366 86.51
PLN00043447 elongation factor 1-alpha; Provisional 86.25
cd00876160 Ras Ras family. The Ras family of the Ras superfam 86.23
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 86.22
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 86.21
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 86.18
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 86.15
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 86.14
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 86.12
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 85.96
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 85.94
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 85.9
PRK08233182 hypothetical protein; Provisional 85.87
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 85.7
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 85.69
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 85.67
COG1363355 FrvX Cellulase M and related proteins [Carbohydrat 85.46
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 85.44
KOG1423|consensus379 85.42
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 85.37
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 85.36
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 85.32
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 85.3
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 85.29
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 85.24
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 85.24
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 85.23
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 85.19
KOG1489|consensus366 84.89
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 84.85
PRK05541176 adenylylsulfate kinase; Provisional 84.84
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 84.77
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 84.72
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 84.51
cd03116159 MobB Molybdenum is an essential trace element in t 84.48
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 84.43
KOG0090|consensus238 84.39
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 84.38
PRK07667193 uridine kinase; Provisional 84.34
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 84.32
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 84.31
PLN02348395 phosphoribulokinase 84.3
PRK07261171 topology modulation protein; Provisional 84.28
COG0703172 AroK Shikimate kinase [Amino acid transport and me 84.22
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 84.2
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 84.19
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 84.15
PRK05439311 pantothenate kinase; Provisional 84.14
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 84.13
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 84.12
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 84.1
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 84.07
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 84.03
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 83.92
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 83.89
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 83.86
PLN02796347 D-glycerate 3-kinase 83.86
PRK00131175 aroK shikimate kinase; Reviewed 83.85
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 83.84
KOG1424|consensus562 83.7
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 83.7
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 83.68
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 83.64
cd03215182 ABC_Carb_Monos_II This family represents domain II 83.63
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 83.59
cd04123162 Rab21 Rab21 subfamily. The localization and functi 83.51
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 83.5
PRK13833323 conjugal transfer protein TrbB; Provisional 83.48
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 83.47
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 83.43
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 83.38
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 83.35
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 83.3
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 83.28
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 83.28
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 83.26
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 83.17
PRK14532188 adenylate kinase; Provisional 83.1
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 83.08
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 83.05
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 82.98
PRK13537306 nodulation ABC transporter NodI; Provisional 82.94
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 82.92
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 82.85
PRK00089292 era GTPase Era; Reviewed 82.84
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 82.82
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 82.82
PF09439181 SRPRB: Signal recognition particle receptor beta s 82.77
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 82.74
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 82.71
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 82.7
COG1160 444 Predicted GTPases [General function prediction onl 82.69
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 82.66
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 82.66
PRK13536340 nodulation factor exporter subunit NodI; Provision 82.65
COG4559259 ABC-type hemin transport system, ATPase component 82.64
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 82.63
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 82.63
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 82.58
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 82.58
PRK10908222 cell division protein FtsE; Provisional 82.44
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 82.44
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 82.41
PRK13946184 shikimate kinase; Provisional 82.41
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 82.37
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 82.36
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 82.35
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 82.33
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 82.26
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 82.24
PTZ00141446 elongation factor 1- alpha; Provisional 82.21
PLN03046460 D-glycerate 3-kinase; Provisional 82.2
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 82.19
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 82.18
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 82.0
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 81.98
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 81.96
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 81.96
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 81.95
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 81.93
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 81.9
PRK09270229 nucleoside triphosphate hydrolase domain-containin 81.9
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 81.89
cd03234226 ABCG_White The White subfamily represents ABC tran 81.89
PLN03108210 Rab family protein; Provisional 81.89
PRK07429327 phosphoribulokinase; Provisional 81.86
smart00382148 AAA ATPases associated with a variety of cellular 81.77
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 81.76
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 81.73
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 81.72
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 81.69
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 81.69
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 81.67
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 81.65
PRK14241258 phosphate transporter ATP-binding protein; Provisi 81.64
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 81.63
PRK15494339 era GTPase Era; Provisional 81.62
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 81.62
smart00178184 SAR Sar1p-like members of the Ras-family of small 81.58
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 81.54
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 81.52
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 81.51
PLN03118211 Rab family protein; Provisional 81.49
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 81.49
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 81.45
cd03269210 ABC_putative_ATPase This subfamily is involved in 81.43
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 81.37
PRK13851344 type IV secretion system protein VirB11; Provision 81.36
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 81.36
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 81.36
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 81.32
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 81.32
cd03246173 ABCC_Protease_Secretion This family represents the 81.29
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 81.18
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 81.09
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 81.09
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 81.09
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 80.98
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 80.96
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 80.85
PRK14237267 phosphate transporter ATP-binding protein; Provisi 80.79
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 80.79
PRK09563287 rbgA GTPase YlqF; Reviewed 80.78
PRK03695248 vitamin B12-transporter ATPase; Provisional 80.76
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 80.73
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 80.72
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 80.71
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 80.68
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 80.66
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 80.65
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 80.64
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 80.63
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 80.6
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 80.6
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 80.56
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 80.56
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 80.55
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 80.52
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 80.49
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 80.42
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 80.39
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 80.39
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 80.36
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 80.34
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 80.3
PRK14242253 phosphate transporter ATP-binding protein; Provisi 80.3
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 80.27
PRK12317425 elongation factor 1-alpha; Reviewed 80.27
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 80.26
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 80.25
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 80.15
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 80.13
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 80.13
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 80.12
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 80.11
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 80.11
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 80.03
TIGR00436270 era GTP-binding protein Era. Era is an essential G 80.02
>KOG3984|consensus Back     alignment and domain information
Probab=100.00  E-value=1.7e-66  Score=475.25  Aligned_cols=281  Identities=54%  Similarity=0.979  Sum_probs=270.0

Q ss_pred             chhhHHHHHHHHHHHhhhcCCCCceeEeeCcCcccccccccCceeeecCCCCCccccCCCCCceeEEEEeeCCeEEEEec
Q psy9643         124 GSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQ  203 (412)
Q Consensus       124 ~~~~~~~~~~~~~~i~~~~~~e~~~GIi~GsGl~~~~~~~~~~~~~~~~~~~~~~i~d~pGH~~~l~~G~~~g~~vv~~q  203 (412)
                      +.+.|+++.+.++||......+|++||||||||+++++.++++..+||+++|+||.+++|||++++++|.++|++++++|
T Consensus         3 ~p~~ye~~~~~a~~i~~~~~~rpk~gIICGSgLg~l~~~l~~p~i~pYedIP~Fp~s~vpghag~lvfG~l~G~pvv~mq   82 (286)
T KOG3984|consen    3 DPYPYEDVEEMAEYIVEQSHIRPKVGIICGSGLGGLADKLSQPVIVPYEDIPNFPVSTVPGHAGRLVFGTLGGAPVVAMQ   82 (286)
T ss_pred             CCchHHHHHHHHHHHHhccccCCceEEEecCCcchhhhhccCCEEecHhhCCCCCcccCCCCcccEEEEecCCceEEEEc
Confidence            44678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeeecCCCCccccHHHHHHHHcCCCEEEEEeccCCCCCCCCCccHHHHHHHHhhccCCCCCCCCCCCCCCCCCCCCCC
Q psy9643         204 GRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPM  283 (412)
Q Consensus       204 gr~H~yeg~~~~~v~~~i~ll~~lGv~~II~~n~~G~l~~~~~~Gd~vi~~d~i~~~~~~~~~pl~g~~~~~~g~~~~~~  283 (412)
                      ||+|.||||+..++++|+++++.+||+.+++||++|++|+.++.||+|++.||||+.++.|+||+.|+|+.+||.+|+.+
T Consensus        83 grfh~yegy~L~~~tfpvrVm~l~Gv~~lvvTnaAggin~~f~vgdiMli~DHin~~G~agq~pl~Gpnd~rfG~rf~a~  162 (286)
T KOG3984|consen   83 GRFHSYEGYPLAKCTFPVRVMQLLGVRILVVTNAAGGINPKFAVGDIMLIKDHINLPGLAGQNPLRGPNDPRFGVRFPAL  162 (286)
T ss_pred             ccccccCCccHHHhhhhHHHHHHcCceEEEEeccccCcCcccccccEEEEecccCCccccCCCCCCCCCcccccccccch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccHHHHHHHHHHHHHcCCCcceeeceEEEEecCccCCHHHHHHHHHcCCcEEeCchhHHHHHHHHcCCcEEEEEeee
Q psy9643         284 NKAYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLIT  363 (412)
Q Consensus       284 ~~~~d~~Lr~~~~~~a~~~g~~~~~~~Gvy~~~~GP~feT~AE~~~~~~~Gad~VgMe~~pEa~~A~~~Gi~~~~i~~VS  363 (412)
                      +++||.+||+++.++++++|+...+|+|+|+|+.||+|||+||.|++|.+|+|+||||++||+++||++|++++++++||
T Consensus       163 sdAYd~~lr~~a~~~~K~m~iqr~lheGvy~~vgGP~~eT~AE~rmlr~mg~dAVGMStvpEVivArHcG~kVlafslIT  242 (286)
T KOG3984|consen  163 SDAYDKDLRQKALEIGKAMGIQRTLHEGVYACVGGPIFETRAESRMLRTMGADAVGMSTVPEVIVARHCGLKVLAFSLIT  242 (286)
T ss_pred             hhhhhHHHHHHHHHHHHHhcccchhhcceEEEecCCccccHHHHHHHHHhCcccccccccchheeeccCCcEEEEEEEEe
Confidence            99999999999999999999987899999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCC--CCCCHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q psy9643         364 NKCVTDYDDH--AEANHEEVIQAGKLRGPMIKSMVTRIVSYIG  404 (412)
Q Consensus       364 d~a~~~~~~~--~~~s~~ev~~~~~~~~~~~~~ll~~~i~~l~  404 (412)
                      |.+..++...  .+.+|+|+++..+++++++.+++..++..|+
T Consensus       243 n~~~~d~s~sa~~ev~h~evl~v~~~a~~~~~~lVs~lm~~i~  285 (286)
T KOG3984|consen  243 NKAVVDESASADVEVDHDEVLEVGKQAAQACSDLVSRLMYEIH  285 (286)
T ss_pred             ccccccCchhccccCCHHHHHhhhHHHHHHHHHHHHHHHhhcc
Confidence            9997543333  5789999999999999999999999998775



>TIGR01698 PUNP purine nucleotide phosphorylase Back     alignment and domain information
>TIGR01699 XAPA xanthosine phosphorylase Back     alignment and domain information
>PRK08202 purine nucleoside phosphorylase; Provisional Back     alignment and domain information
>COG0005 Pnp Purine nucleoside phosphorylase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01700 PNPH purine nucleoside phosphorylase I, inosine and guanosine-specific Back     alignment and domain information
>PRK08931 5'-methylthioadenosine phosphorylase; Provisional Back     alignment and domain information
>PRK07823 5'-methylthioadenosine phosphorylase; Validated Back     alignment and domain information
>PRK07432 5'-methylthioadenosine phosphorylase; Provisional Back     alignment and domain information
>PRK08564 5'-methylthioadenosine phosphorylase II; Reviewed Back     alignment and domain information
>PRK09136 5'-methylthioadenosine phosphorylase; Validated Back     alignment and domain information
>TIGR01697 PNPH-PUNA-XAPA inosine guanosine and xanthosine phosphorylase family Back     alignment and domain information
>PRK08666 5'-methylthioadenosine phosphorylase; Validated Back     alignment and domain information
>KOG3985|consensus Back     alignment and domain information
>TIGR01694 MTAP 5'-deoxy-5'-methylthioadenosine phosphorylase Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01048 PNP_UDP_1: Phosphorylase superfamily; InterPro: IPR000845 Phosphorylases in this entry include: Purine nucleoside phosphorylase (2 Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>PRK06714 S-adenosylhomocysteine nucleosidase; Validated Back     alignment and domain information
>PRK05584 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; Validated Back     alignment and domain information
>PRK14697 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>TIGR01704 MTA/SAH-Nsdase 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>TIGR03468 HpnG hopanoid-associated phosphorylase Back     alignment and domain information
>PRK07164 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; Provisional Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0775 Pfs Nucleoside phosphorylase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02584 5'-methylthioadenosine nucleosidase Back     alignment and domain information
>PRK13374 purine nucleoside phosphorylase; Provisional Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>TIGR00107 deoD purine-nucleoside phosphorylase, family 1 (deoD) Back     alignment and domain information
>PRK05819 deoD purine nucleoside phosphorylase; Reviewed Back     alignment and domain information
>COG0813 DeoD Purine-nucleoside phosphorylase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01718 Uridine-psphlse uridine phosphorylase Back     alignment and domain information
>PRK07115 AMP nucleosidase; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>TIGR03664 fut_nucase futalosine nucleosidase Back     alignment and domain information
>PRK07077 hypothetical protein; Provisional Back     alignment and domain information
>PRK11178 uridine phosphorylase; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01705 MTA/SAH-nuc-hyp 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase, putative Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01721 AMN-like AMP nucleosidase, putative Back     alignment and domain information
>PRK06026 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; Validated Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>TIGR01719 euk_UDPppase uridine phosphorylase Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK08292 AMP nucleosidase; Provisional Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>TIGR01717 AMP-nucleosdse AMP nucleosidase Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>KOG0052|consensus Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>COG2820 Udp Uridine phosphorylase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05634 nucleosidase; Provisional Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1363 FrvX Cellulase M and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query412
2p4s_A373 Structure Of Purine Nucleoside Phosphorylase From A 1e-102
1lv8_A289 Crystal Structure Of Calf Spleen Purine Nucleoside 3e-89
1b8n_A284 Purine Nucleoside Phosphorylase Length = 284 4e-89
1v48_A289 Calf Spleen Purine Nucleoside Phosphorylase (Pnp) B 4e-89
1vfn_A281 Purine Nucleoside Phosphorylase Length = 281 7e-89
2qpl_A282 Crystal Structure Of Calf Spleen Purine Nucleoside 7e-89
1a9q_A282 Bovine Purine Nucleoside Phosphorylase Complexed Wi 2e-88
1pbn_A289 Purine Nucleoside Phosphorylase Length = 289 3e-88
1a9o_A289 Bovine Purine Nucleoside Phosphorylase Complexed Wi 3e-88
1fxu_A289 Purine Nucleoside Phosphorylase From Calf Spleen In 3e-88
1a9t_A284 Bovine Purine Nucleoside Phosphorylase Complexed Wi 3e-88
3phb_E324 Crystal Structure Of Human Purine Nucleoside Phosph 8e-87
1pf7_E289 Crystal Structure Of Human Pnp Complexed With Immuc 1e-86
1m73_E288 Crystal Structure Of Human Pnp At 2.3a Resolution L 2e-86
3gb9_A311 Human Purine Nucleoside Phosphorylase Double Mutant 9e-86
2a0x_A289 Structure Of Human Purine Nucleoside Phosphorylase 9e-86
2a0y_A289 Structure Of Human Purine Nucleoside Phosphorylase 1e-85
2a0w_A289 Structure Of Human Purine Nucleoside Phosphorylase 1e-85
4ear_A324 Crystal Structure Of Purine Nucleoside Phosphorylas 1e-84
4eb8_A324 Crystal Structure Of Purine Nucleoside Phosphorylas 1e-84
3khs_A285 Crystal Structure Of Grouper Iridovirus Purine Nucl 9e-72
1tcu_A287 Crystal Structure Of The Purine Nucleoside Phosphor 3e-68
3odg_A287 Crystal Structure Of Xanthosine Phosphorylase Bound 9e-53
1yqq_A277 Escherichia Coli Purine Nucleoside Phosphorylase Ii 4e-50
3la8_A303 The Crystal Structure Of Smu.1229 From Streptococcu 3e-49
1vmk_A277 Crystal Structure Of Purine Nucleoside Phosphorylas 4e-48
1g2o_A268 Crystal Structure Of Purine Nucleoside Phosphorylas 1e-32
1c3x_A266 Purine Nucleoside Phosphorylase From Cellulomonas S 3e-24
1cb0_A283 Structure Of Human 5'-deoxy-5'-methylthioadenosine 5e-14
1d2e_A397 Crystal Structure Of Mitochondrial Ef-Tu In Complex 4e-13
1d2e_A397 Crystal Structure Of Mitochondrial Ef-Tu In Complex 3e-08
1xb2_A409 Crystal Structure Of Bos Taurus Mitochondrial Elong 2e-12
1xb2_A409 Crystal Structure Of Bos Taurus Mitochondrial Elong 5e-11
3mmp_A678 Structure Of The Qb Replicase, An Rna-Dependent Rna 3e-09
3agp_A 1289 Structure Of Viral Polymerase Form I Length = 1289 5e-09
1v4n_A281 Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosph 2e-08
1ob2_A393 E. Coli Elongation Factor Ef-Tu Complexed With The 4e-08
1efc_A393 Intact Elongation Factor From E.Coli Length = 393 4e-08
1dg1_G394 Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Len 4e-08
3u6b_A394 Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 4e-08
1d8t_A393 Crystal Structure Of Elongation Factor, Tu (Ef-Tu-M 4e-08
1efm_A379 Structure Of The Gdp Domain Of Ef-Tu And Location O 4e-08
2a8y_A270 Crystal Structure Of 5'-Deoxy-5'methylthioadenosine 6e-08
2c78_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 3e-07
2wrn_Z406 The Crystal Structure Of The 70s Ribosome Bound To 3e-07
4abr_Z405 Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kir 3e-07
2y0y_Z405 The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bo 3e-07
1aip_A405 Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt 4e-07
1eft_A405 The Crystal Structure Of Elongation Factor Ef-Tu Fr 4e-07
1ttt_A405 Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Com 4e-07
2y0u_Z405 The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bou 4e-07
1exm_A405 Crystal Structure Of Thermus Thermophilus Elongatio 4e-07
2c77_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 5e-07
1efu_A385 Elongation Factor Complex Ef-TuEF-Ts From Escherich 2e-06
2hcj_A37 "trypsin-Modified Elongation Factor Tu In Complex W 2e-06
1mj1_A405 Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIB 2e-06
1wta_A275 Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosin 7e-06
3ozb_A259 Crystal Structure Of 5'-Methylthioinosine Phosphory 2e-05
4glf_A297 Crystal Structure Of Methylthioadenosine Phosphoryl 7e-05
3pen_A403 Structure Of Archaeal Initiation Factor Aif2gamma S 3e-04
2pmd_A415 The Structures Of Aif2gamma Subunit From The Archae 4e-04
3sjz_A409 The Structure Of Aif2gamma Subunit Delta 41-45 From 4e-04
2aho_A414 Structure Of The Archaeal Initiation Factor Eif2 Al 4e-04
>pdb|2P4S|A Chain A, Structure Of Purine Nucleoside Phosphorylase From Anopheles Gambiae In Complex With Dadme-immh Length = 373 Back     alignment and structure

Iteration: 1

Score = 367 bits (943), Expect = e-102, Method: Compositional matrix adjust. Identities = 169/278 (60%), Positives = 212/278 (76%) Query: 126 YTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGH 185 YTY+ +Q IA +LL+ +RPK+GIICGSGL T+A+ +TD F Y+TIP+FPVSTV GH Sbjct: 90 YTYDTLQEIATYLLERTELRPKVGIICGSGLGTLAEQLTDVDSFDYETIPHFPVSTVAGH 149 Query: 186 KGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDY 245 G+LVFG + G+P+MCMQGRFH+YEGYPL KCAMP+RVM L+G THL+ATNAAGG NP Y Sbjct: 150 VGRLVFGYLAGVPVMCMQGRFHHYEGYPLAKCAMPVRVMHLIGCTHLIATNAAGGANPKY 209 Query: 246 EVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNMS 305 VGDIM+IKDHINLMGFAGNNPL G N++RFGPRF M Y+ +L IAR + + Sbjct: 210 RVGDIMLIKDHINLMGFAGNNPLQGPNDERFGPRFFGMANTYDPKLNQQAKVIARQIGIE 269 Query: 306 SIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNK 365 + ++EGVY+ +GGPNFETVAE+ ML + GVDA+GMSTVHE+ITA HCGMT AFSLITN Sbjct: 270 NELREGVYTCLGGPNFETVAEVKMLSMLGVDAIGMSTVHEIITARHCGMTCFAFSLITNM 329 Query: 366 CVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYI 403 C Y++ E H+ ++ GK R + V+RIV +I Sbjct: 330 CTMSYEEEEEHCHDSIVGVGKNREKTLGEFVSRIVKHI 367
>pdb|1LV8|A Chain A, Crystal Structure Of Calf Spleen Purine Nucleoside Phosphorylase In A New Space Group With Full Trimer In The Asymmetric Unit Length = 289 Back     alignment and structure
>pdb|1B8N|A Chain A, Purine Nucleoside Phosphorylase Length = 284 Back     alignment and structure
>pdb|1V48|A Chain A, Calf Spleen Purine Nucleoside Phosphorylase (Pnp) Binary Complex With 9-(5,5-Difluoro-5-Phosphonopenthyl)guanine Length = 289 Back     alignment and structure
>pdb|1VFN|A Chain A, Purine Nucleoside Phosphorylase Length = 281 Back     alignment and structure
>pdb|2QPL|A Chain A, Crystal Structure Of Calf Spleen Purine Nucleoside Phosphorylase Complexed To A Novel Purine Analogue Length = 282 Back     alignment and structure
>pdb|1A9Q|A Chain A, Bovine Purine Nucleoside Phosphorylase Complexed With Inosine Length = 282 Back     alignment and structure
>pdb|1PBN|A Chain A, Purine Nucleoside Phosphorylase Length = 289 Back     alignment and structure
>pdb|1A9O|A Chain A, Bovine Purine Nucleoside Phosphorylase Complexed With Phosphate Length = 289 Back     alignment and structure
>pdb|1FXU|A Chain A, Purine Nucleoside Phosphorylase From Calf Spleen In Complex With N(7)- Acycloguanosine Inhibitor And A Phosphate Ion Length = 289 Back     alignment and structure
>pdb|1A9T|A Chain A, Bovine Purine Nucleoside Phosphorylase Complexed With 9-Deazainosine And Phosphate Length = 284 Back     alignment and structure
>pdb|3PHB|E Chain E, Crystal Structure Of Human Purine Nucleoside Phosphorylase In Complex With Dadme-Immg Length = 324 Back     alignment and structure
>pdb|1PF7|E Chain E, Crystal Structure Of Human Pnp Complexed With Immucillin H Length = 289 Back     alignment and structure
>pdb|1M73|E Chain E, Crystal Structure Of Human Pnp At 2.3a Resolution Length = 288 Back     alignment and structure
>pdb|3GB9|A Chain A, Human Purine Nucleoside Phosphorylase Double Mutant E201q,n243d Complexed With 2-fluoroadenine Length = 311 Back     alignment and structure
>pdb|2A0X|A Chain A, Structure Of Human Purine Nucleoside Phosphorylase H257f Mutant Length = 289 Back     alignment and structure
>pdb|2A0Y|A Chain A, Structure Of Human Purine Nucleoside Phosphorylase H257d Mutant Length = 289 Back     alignment and structure
>pdb|2A0W|A Chain A, Structure Of Human Purine Nucleoside Phosphorylase H257g Mutant Length = 289 Back     alignment and structure
>pdb|4EAR|A Chain A, Crystal Structure Of Purine Nucleoside Phosphorylase (w16y, W94y, W178y, H257w) Mutant From Human Complexed With Dadme-immg And Phosphate Length = 324 Back     alignment and structure
>pdb|4EB8|A Chain A, Crystal Structure Of Purine Nucleoside Phosphorylase (w16y, W94y, W178y, H257w) Mutant From Human Complexed With Dadme-immg And Phosphate Length = 324 Back     alignment and structure
>pdb|3KHS|A Chain A, Crystal Structure Of Grouper Iridovirus Purine Nucleoside Phosphorylase Length = 285 Back     alignment and structure
>pdb|1TCU|A Chain A, Crystal Structure Of The Purine Nucleoside Phosphorylase From Schistosoma Mansoni In Complex With Phosphate And Acetate Length = 287 Back     alignment and structure
>pdb|3ODG|A Chain A, Crystal Structure Of Xanthosine Phosphorylase Bound With Xanthine From Yersinia Pseudotuberculosis Length = 287 Back     alignment and structure
>pdb|1YQQ|A Chain A, Escherichia Coli Purine Nucleoside Phosphorylase Ii, The Product Of The Xapa Gene Length = 277 Back     alignment and structure
>pdb|3LA8|A Chain A, The Crystal Structure Of Smu.1229 From Streptococcus Mutans Ua159 Length = 303 Back     alignment and structure
>pdb|1VMK|A Chain A, Crystal Structure Of Purine Nucleoside Phosphorylase (Tm1596) From Thermotoga Maritima At 2.01 A Resolution Length = 277 Back     alignment and structure
>pdb|1G2O|A Chain A, Crystal Structure Of Purine Nucleoside Phosphorylase From Mycobacterium Tuberculosis In Complex With A Transition- State Inhibitor Length = 268 Back     alignment and structure
>pdb|1C3X|A Chain A, Purine Nucleoside Phosphorylase From Cellulomonas Sp. In Complex With 8-Iodo-Guanine Length = 266 Back     alignment and structure
>pdb|1CB0|A Chain A, Structure Of Human 5'-deoxy-5'-methylthioadenosine Phosphorylase At 1.7 A Resolution Length = 283 Back     alignment and structure
>pdb|1D2E|A Chain A, Crystal Structure Of Mitochondrial Ef-Tu In Complex With Gdp Length = 397 Back     alignment and structure
>pdb|1D2E|A Chain A, Crystal Structure Of Mitochondrial Ef-Tu In Complex With Gdp Length = 397 Back     alignment and structure
>pdb|1XB2|A Chain A, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 409 Back     alignment and structure
>pdb|1XB2|A Chain A, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 409 Back     alignment and structure
>pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 Back     alignment and structure
>pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 Back     alignment and structure
>pdb|1V4N|A Chain A, Structure Of 5'-Deoxy-5'-Methylthioadenosine Phosphorylase Homologue From Sulfolobus Tokodaii Length = 281 Back     alignment and structure
>pdb|1OB2|A Chain A, E. Coli Elongation Factor Ef-Tu Complexed With The Antibiotic Kirromycin, A Gtp Analog, And Phe-Trna Length = 393 Back     alignment and structure
>pdb|1EFC|A Chain A, Intact Elongation Factor From E.Coli Length = 393 Back     alignment and structure
>pdb|1DG1|G Chain G, Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Length = 394 Back     alignment and structure
>pdb|3U6B|A Chain A, Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 Length = 394 Back     alignment and structure
>pdb|1D8T|A Chain A, Crystal Structure Of Elongation Factor, Tu (Ef-Tu-Mggdp) Complexed With Ge2270a, A Thiazolyl Peptide Antibiotic Length = 393 Back     alignment and structure
>pdb|1EFM|A Chain A, Structure Of The Gdp Domain Of Ef-Tu And Location Of The Amino Acids Homologous To Ras Oncogene Proteins Length = 379 Back     alignment and structure
>pdb|2A8Y|A Chain A, Crystal Structure Of 5'-Deoxy-5'methylthioadenosine Phosphorylase Complexed With 5'-Deoxy- 5'methylthioadenosine And Sulfate Length = 270 Back     alignment and structure
>pdb|2C78|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Pulvomycin Length = 405 Back     alignment and structure
>pdb|2WRN|Z Chain Z, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu And Trna (Part 1 Of 4). Length = 406 Back     alignment and structure
>pdb|4ABR|Z Chain Z, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin With The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|2Y0Y|Z Chain Z, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1AIP|A Chain A, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 405 Back     alignment and structure
>pdb|1EFT|A Chain A, The Crystal Structure Of Elongation Factor Ef-Tu From Thermus Aquaticus In The Gtp Conformation Length = 405 Back     alignment and structure
>pdb|1TTT|A Chain A, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex Length = 405 Back     alignment and structure
>pdb|2Y0U|Z Chain Z, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1EXM|A Chain A, Crystal Structure Of Thermus Thermophilus Elongation Factor Tu (Ef-Tu) In Complex With The Gtp Analogue Gppnhp. Length = 405 Back     alignment and structure
>pdb|2C77|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Ge2270 A Length = 405 Back     alignment and structure
>pdb|1EFU|A Chain A, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 385 Back     alignment and structure
>pdb|2HCJ|A Chain A, "trypsin-Modified Elongation Factor Tu In Complex With Tetracycline" Length = 37 Back     alignment and structure
>pdb|1MJ1|A Chain A, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL PROTEINS Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1WTA|A Chain A, Crystal Structure Of 5'-Deoxy-5'-Methylthioadenosine From Aeropyrum Pernix (R32 Form) Length = 275 Back     alignment and structure
>pdb|3OZB|A Chain A, Crystal Structure Of 5'-Methylthioinosine Phosphorylase From Psedomonas Aeruginosa In Complex With Hypoxanthine Length = 259 Back     alignment and structure
>pdb|4GLF|A Chain A, Crystal Structure Of Methylthioadenosine Phosphorylase Sourced From An Antarctic Soil Metagenomic Library Length = 297 Back     alignment and structure
>pdb|3PEN|A Chain A, Structure Of Archaeal Initiation Factor Aif2gamma Subunit Delta 37-47 From Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 403 Back     alignment and structure
>pdb|2PMD|A Chain A, The Structures Of Aif2gamma Subunit From The Archaeon Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 415 Back     alignment and structure
>pdb|3SJZ|A Chain A, The Structure Of Aif2gamma Subunit Delta 41-45 From Archaeon Sulfolobus Solfataricus Complexed With Gdp And Gdpnp Length = 409 Back     alignment and structure
>pdb|2AHO|A Chain A, Structure Of The Archaeal Initiation Factor Eif2 Alpha- Gamma Heterodimer From Sulfolobus Solfataricus Complexed With Gdpnp Length = 414 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query412
2p4s_A373 Purine nucleoside phosphorylase; transferase; HET: 1e-154
3fuc_A284 Purine nucleoside phosphorylase; recombinant, glyc 1e-154
3khs_A285 Purine nucleoside phosphorylase; alpha-beta struct 1e-153
1tcv_A287 Purine-nucleoside phosphorylase; transferase; HET: 1e-153
3phb_E324 Purine nucleoside phosphorylase; PNP,immucillin, t 1e-153
3odg_A287 Xanthosine phosphorylase; structural genomics, PSI 1e-142
1vmk_A277 Purine nucleoside phosphorylase; TM1596, structura 1e-141
3la8_A303 SMU.1229, putative purine nucleoside phosphorylase 1e-140
1g2o_A268 Purine nucleoside phosphorylase; trimer, transitio 1e-131
1qe5_A266 Pentosyltransferase; enzyme, purine nucleoside pho 1e-126
1cb0_A283 Protein (5'-deoxy-5'-methylthioadenosine phosphor; 3e-33
3ozb_A259 Methylthioadenosine phosphorylase; 5'-methylthioin 4e-33
2a8y_A270 5'-methylthioadenosine phosphorylase (MTAP); alpha 2e-31
1wta_A275 5'-methylthioadenosine phosphorylase; A/B structur 9e-30
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 2e-19
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 4e-16
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 8e-18
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 1e-15
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 5e-17
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 7e-16
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 3e-14
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 2e-04
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 8e-14
1wb1_A 482 Translation elongation factor SELB; selenocysteine 3e-13
1wb1_A482 Translation elongation factor SELB; selenocysteine 5e-08
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 4e-13
2elf_A370 Protein translation elongation factor 1A; tRNA, py 4e-11
2elf_A370 Protein translation elongation factor 1A; tRNA, py 3e-07
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 5e-05
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 1e-04
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 2e-04
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 2e-04
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 3e-04
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 3e-04
>2p4s_A Purine nucleoside phosphorylase; transferase; HET: DIH; 2.20A {Anopheles gambiae} Length = 373 Back     alignment and structure
 Score =  439 bits (1132), Expect = e-154
 Identities = 169/281 (60%), Positives = 212/281 (75%)

Query: 125 SYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPG 184
            YTY+ +Q IA +LL+   +RPK+GIICGSGL T+A+ +TD   F Y+TIP+FPVSTV G
Sbjct: 89  GYTYDTLQEIATYLLERTELRPKVGIICGSGLGTLAEQLTDVDSFDYETIPHFPVSTVAG 148

Query: 185 HKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPD 244
           H G+LVFG + G+P+MCMQGRFH+YEGYPL KCAMP+RVM L+G THL+ATNAAGG NP 
Sbjct: 149 HVGRLVFGYLAGVPVMCMQGRFHHYEGYPLAKCAMPVRVMHLIGCTHLIATNAAGGANPK 208

Query: 245 YEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARDLNM 304
           Y VGDIM+IKDHINLMGFAGNNPL G N++RFGPRF  M   Y+ +L      IAR + +
Sbjct: 209 YRVGDIMLIKDHINLMGFAGNNPLQGPNDERFGPRFFGMANTYDPKLNQQAKVIARQIGI 268

Query: 305 SSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITN 364
            + ++EGVY+ +GGPNFETVAE+ ML + GVDA+GMSTVHE+ITA HCGMT  AFSLITN
Sbjct: 269 ENELREGVYTCLGGPNFETVAEVKMLSMLGVDAIGMSTVHEIITARHCGMTCFAFSLITN 328

Query: 365 KCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYIGE 405
            C   Y++  E  H+ ++  GK R   +   V+RIV +I  
Sbjct: 329 MCTMSYEEEEEHCHDSIVGVGKNREKTLGEFVSRIVKHIHY 369


>3fuc_A Purine nucleoside phosphorylase; recombinant, glycosyltransferase, transferase, 9-deazaguanine, multisubstrate analogue inhibitors, nucleoside-binding; HET: 9D9 9DG; 1.45A {Bos taurus} PDB: 1b8n_A* 1b8o_A* 2ai2_A* 1v48_A* 2ai1_A* 2ai3_A* 1lvu_A* 1lv8_A* 1a9o_A 1a9p_A* 1a9s_A* 1fxu_A* 2qpl_A* 1a9t_A* 3pnp_A 1pbn_A 4pnp_A 1a9q_A* 1a9r_A* 1vfn_A* ... Length = 284 Back     alignment and structure
>3khs_A Purine nucleoside phosphorylase; alpha-beta structure, mixed beta-barrel, hydrolase; 2.38A {Grouper iridovirus} Length = 285 Back     alignment and structure
>1tcv_A Purine-nucleoside phosphorylase; transferase; HET: NDS; 1.75A {Schistosoma mansoni} PDB: 1tcu_A* 1td1_A 3djf_A* 3e0q_A* 3e9r_A* 3e9z_A* 3f8w_A* 3faz_A* 3fb1_A* 3fnq_A* 3iex_A* Length = 287 Back     alignment and structure
>3phb_E Purine nucleoside phosphorylase; PNP,immucillin, transferase-transferase inhibitor complex; HET: IM5; 2.30A {Homo sapiens} Length = 324 Back     alignment and structure
>3odg_A Xanthosine phosphorylase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; HET: XAN; 1.64A {Yersinia pseudotuberculosis} PDB: 1yqq_A* 1yqu_A* 1yr3_A* Length = 287 Back     alignment and structure
>1vmk_A Purine nucleoside phosphorylase; TM1596, structural genomics protein structure initiative, PSI, joint center for structu genomics; HET: GUN; 2.01A {Thermotoga maritima} SCOP: c.56.2.1 Length = 277 Back     alignment and structure
>3la8_A SMU.1229, putative purine nucleoside phosphorylase; PUNA, glycosyltransferase, transferase; 1.80A {Streptococcus mutans} PDB: 3lba_A* Length = 303 Back     alignment and structure
>1g2o_A Purine nucleoside phosphorylase; trimer, transition-state complex, transferase; HET: IMH; 1.75A {Mycobacterium tuberculosis} SCOP: c.56.2.1 PDB: 1i80_A* 1n3i_A* 3iom_A* Length = 268 Back     alignment and structure
>1qe5_A Pentosyltransferase; enzyme, purine nucleoside phosphorylase; 2.20A {Cellulomonas SP} SCOP: c.56.2.1 PDB: 1c3x_A Length = 266 Back     alignment and structure
>1cb0_A Protein (5'-deoxy-5'-methylthioadenosine phosphor; methylthioadenosine phosphorylase, purine nucleoside phospho purine salvage, adenine; HET: ADE; 1.70A {Homo sapiens} SCOP: c.56.2.1 PDB: 1cg6_A* 1k27_A* 1sd1_A* 1sd2_A* 3ozc_A* 3ozd_A* 3oze_A Length = 283 Back     alignment and structure
>3ozb_A Methylthioadenosine phosphorylase; 5'-methylthioinosine,phosphorylase, transferase; HET: HPA; 2.80A {Pseudomonas aeruginosa} Length = 259 Back     alignment and structure
>2a8y_A 5'-methylthioadenosine phosphorylase (MTAP); alpha/beta, beta sheet, beta barrel, transferase; HET: MTA; 1.45A {Sulfolobus solfataricus} PDB: 3t94_A* 1v4n_A Length = 270 Back     alignment and structure
>1wta_A 5'-methylthioadenosine phosphorylase; A/B structure, transferase; HET: ADE; 1.78A {Aeropyrum pernix} Length = 275 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Length = 405 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Length = 405 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Length = 397 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Length = 397 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query412
3fuc_A284 Purine nucleoside phosphorylase; recombinant, glyc 100.0
3khs_A285 Purine nucleoside phosphorylase; alpha-beta struct 100.0
3phb_E324 Purine nucleoside phosphorylase; PNP,immucillin, t 100.0
3la8_A303 SMU.1229, putative purine nucleoside phosphorylase 100.0
3odg_A287 Xanthosine phosphorylase; structural genomics, PSI 100.0
1vmk_A277 Purine nucleoside phosphorylase; TM1596, structura 100.0
1tcv_A287 Purine-nucleoside phosphorylase; transferase; HET: 100.0
2p4s_A373 Purine nucleoside phosphorylase; transferase; HET: 100.0
1g2o_A268 Purine nucleoside phosphorylase; trimer, transitio 100.0
1qe5_A266 Pentosyltransferase; enzyme, purine nucleoside pho 100.0
3ozb_A259 Methylthioadenosine phosphorylase; 5'-methylthioin 100.0
1wta_A275 5'-methylthioadenosine phosphorylase; A/B structur 100.0
2a8y_A270 5'-methylthioadenosine phosphorylase (MTAP); alpha 100.0
1cb0_A283 Protein (5'-deoxy-5'-methylthioadenosine phosphor; 100.0
3nm6_B230 MTA/SAH nucleosidase; hydrolase; HET: ADE; 1.60A { 99.93
3o4v_A234 MTA/SAH nucleosidase; mixed alpha/beta dimer, hydr 99.92
3dp9_A231 MTA/SAH nucleosidase; vibrio cholerae 5'-methylthi 99.92
2h8g_A267 5'-methylthioadenosine nucleosidase; protein-adeni 99.92
3bsf_A254 AT4G34840, nucleosidase; alpha-beta, hydrolase; HE 99.92
3eei_A233 5-methylthioadenosine nucleosidase/S- adenosylhomo 99.91
4g41_A236 MTA/SAH nucleosidase; mixed alpha/beta, hydrolase, 99.91
3bl6_A230 5'-methylthioadenosine nucleosidase/S- adenosylhom 99.91
1zos_A230 5'-methylthioadenosine / S-adenosylhomocysteine nu 99.9
1odk_A235 Purine nucleoside phosphorylase; alpha-beta protei 99.89
1z34_A235 Purine nucleoside phosphorylase; alpha-beta-alpha 99.88
2b94_A267 Purine nucleoside phosphorylase; SGPP, structural 99.88
1je0_A236 MTAP;, 5'-methylthioadenosine phosphorylase; alpha 99.88
1vhw_A253 Purine nucleoside phosphorylase; structural genomi 99.88
3uaw_A235 PNP, purine nucleoside phosphorylase DEOD-type; ne 99.88
3u40_A242 Pnpase, purine nucleoside phosphorylase; structura 99.87
1ybf_A268 AMP nucleosidase; structural genomics, protein str 99.87
3phc_A275 Purine nucleoside phosphorylase; PNP,immucillin, t 99.86
3ddo_A253 Urdpase, upase, uridine phosphorylase; transferase 99.86
3qpb_A282 Uridine phosphorylase; hexamer, NP-I superfamily, 99.85
3mb8_A279 Purine nucleoside phosphorylase; PNP, immucillin H 99.83
1t8s_A484 AMP nucleosidase; alpha-beta-alpha sandwich, alpha 99.77
3bje_A349 Nucleoside phosphorylase, putative; uridine phosph 99.56
3euf_A328 Uridine phosphorylase 1; nucleoside phosphorylase, 99.56
3p0f_A297 Uridine phosphorylase 2; transferase; HET: BAU; 1. 99.55
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.53
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 99.48
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 99.44
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 99.43
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.34
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 99.22
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.21
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.17
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.07
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.06
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 99.06
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.01
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 98.99
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 98.97
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.96
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.96
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.95
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.94
1wb1_A 482 Translation elongation factor SELB; selenocysteine 98.9
2elf_A370 Protein translation elongation factor 1A; tRNA, py 98.72
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 98.72
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 98.62
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 98.55
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.52
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 98.48
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 98.41
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 98.3
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 98.27
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 98.11
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 98.05
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 97.93
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 97.46
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 96.68
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 96.62
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 96.53
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 96.53
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 96.43
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 96.31
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 96.26
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 96.13
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 96.09
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 96.07
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 96.06
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 95.98
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 95.96
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 95.95
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 95.78
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 95.57
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 95.39
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 95.36
3o47_A329 ADP-ribosylation factor GTPase-activating protein 95.35
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 94.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 94.55
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 94.36
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 94.1
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 93.65
2fh5_B214 SR-beta, signal recognition particle receptor beta 93.6
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 93.51
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 93.4
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 93.38
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 93.36
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 93.31
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 93.22
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 93.21
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 93.18
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 93.11
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 93.09
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 93.03
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 92.98
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 92.9
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 92.59
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 92.58
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 92.55
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 92.5
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 92.49
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 92.39
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 92.33
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 92.32
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 92.28
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 92.14
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 92.12
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 92.07
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 92.0
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 91.97
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 91.95
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 91.95
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 91.95
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 91.85
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 91.83
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 91.82
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 91.76
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 91.74
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 91.68
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 91.65
3lxw_A247 GTPase IMAP family member 1; immunity, structural 91.63
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 91.61
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 91.57
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 91.56
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 91.54
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 91.46
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 91.38
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 91.3
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 91.26
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 91.18
3lxx_A239 GTPase IMAP family member 4; structural genomics c 91.15
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 91.05
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 91.01
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 90.95
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 90.91
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 90.87
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 90.86
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 90.84
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 90.75
2wji_A165 Ferrous iron transport protein B homolog; membrane 90.72
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 90.67
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 90.63
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 90.59
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 90.49
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 90.41
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 90.37
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 90.36
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 90.29
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 90.29
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 90.22
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 90.21
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 90.16
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 90.15
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 90.1
3t1o_A198 Gliding protein MGLA; G domain containing protein, 90.08
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 90.07
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 90.04
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 90.02
1nrj_B218 SR-beta, signal recognition particle receptor beta 89.99
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 89.95
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 89.85
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 89.84
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 89.75
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 89.74
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 89.71
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 89.71
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 89.68
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 89.48
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.37
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 89.35
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 89.31
2ged_A193 SR-beta, signal recognition particle receptor beta 89.11
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 89.09
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 89.03
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 89.02
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 89.02
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 89.01
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 88.93
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 88.89
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 88.73
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 88.71
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 88.7
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 88.52
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 88.41
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 88.39
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 88.29
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 88.26
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 88.2
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 88.2
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 88.12
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 88.04
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 87.97
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 87.87
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 87.87
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 87.78
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 87.73
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 87.72
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 87.64
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 87.57
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 87.53
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 87.5
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 87.33
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 87.44
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 87.41
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 87.4
2hf9_A226 Probable hydrogenase nickel incorporation protein 87.32
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 87.28
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 87.11
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 86.98
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 86.93
3vaa_A199 Shikimate kinase, SK; structural genomics, center 86.92
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 86.83
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 86.62
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 86.58
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 86.52
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 86.52
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 86.5
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 86.48
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 86.44
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 86.44
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 86.27
1g6h_A257 High-affinity branched-chain amino acid transport 86.25
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 86.24
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 86.16
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 85.78
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 85.74
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 85.53
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 85.5
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 85.46
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 85.46
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 85.41
1ji0_A240 ABC transporter; ATP binding protein, structural g 85.41
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 85.38
1b0u_A262 Histidine permease; ABC transporter, transport pro 85.28
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 85.25
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 85.22
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 85.21
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 85.06
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 85.05
2ghi_A260 Transport protein; multidrug resistance protein, M 85.03
3llu_A196 RAS-related GTP-binding protein C; structural geno 84.98
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 84.96
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 84.81
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 84.74
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 84.72
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 84.69
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 84.68
3iby_A256 Ferrous iron transport protein B; G protein, G dom 84.64
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 84.61
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 84.55
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 84.42
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 84.4
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 84.35
1sgw_A214 Putative ABC transporter; structural genomics, P p 84.1
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 84.07
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 83.72
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 83.7
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 83.65
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 83.64
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 83.63
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 83.63
1via_A175 Shikimate kinase; structural genomics, transferase 83.63
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 83.58
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 83.49
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 83.45
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 83.45
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 83.39
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 83.32
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 83.29
1f60_A458 Elongation factor EEF1A; protein-protein complex, 83.25
2www_A349 Methylmalonic aciduria type A protein, mitochondri 83.13
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 83.09
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 83.06
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 83.05
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 82.99
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 82.88
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 82.84
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 82.8
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 82.78
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 82.72
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 82.69
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 82.6
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 82.55
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 82.49
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 82.4
1xjc_A169 MOBB protein homolog; structural genomics, midwest 82.38
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 82.38
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 82.27
3kta_A182 Chromosome segregation protein SMC; structural mai 82.17
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 82.05
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 82.01
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 81.98
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 81.98
2vli_A183 Antibiotic resistance protein; transferase, tunica 81.96
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 81.92
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 81.84
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 81.76
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 81.73
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 81.55
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 81.46
2oap_1511 GSPE-2, type II secretion system protein; hexameri 81.38
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 81.24
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 81.23
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 81.13
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 81.1
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 81.01
4a74_A231 DNA repair and recombination protein RADA; hydrola 80.79
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 80.69
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 80.66
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 80.64
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 80.45
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 80.39
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 80.19
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 80.13
>3fuc_A Purine nucleoside phosphorylase; recombinant, glycosyltransferase, transferase, 9-deazaguanine, multisubstrate analogue inhibitors, nucleoside-binding; HET: 9D9 9DG; 1.45A {Bos taurus} SCOP: c.56.2.1 PDB: 1b8n_A* 1b8o_A* 2ai2_A* 1v48_A* 2ai1_A* 2ai3_A* 1lvu_A* 1lv8_A* 1a9o_A 1a9p_A* 1a9s_A* 1fxu_A* 2qpl_A* 1a9t_A* 3pnp_A 1pbn_A 4pnp_A 1a9q_A* 1a9r_A* 1vfn_A* ... Back     alignment and structure
Probab=100.00  E-value=4.9e-65  Score=494.18  Aligned_cols=279  Identities=53%  Similarity=0.965  Sum_probs=259.1

Q ss_pred             hhHHHHHHHHHHHhhhcCCCCceeEeeCcCcccccccccCceeeecCCCCCccccCCCCCceeEEEEeeCCeEEEEecce
Q psy9643         126 YTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQGR  205 (412)
Q Consensus       126 ~~~~~~~~~~~~i~~~~~~e~~~GIi~GsGl~~~~~~~~~~~~~~~~~~~~~~i~d~pGH~~~l~~G~~~g~~vv~~qgr  205 (412)
                      +.+++++++++||+++++.+|++|||+||||+++++.+++...++|+++|+||.++++||++++++|+++|++|+++|||
T Consensus         5 ~~~~~~~~~~~~i~~~~~~~p~igiI~GSGl~~l~~~~~~~~~~~y~~ipgfp~stv~gh~g~l~~G~l~G~~Vv~~~Gr   84 (284)
T 3fuc_A            5 YTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGR   84 (284)
T ss_dssp             CCHHHHHHHHHHHHHHCCCCCSEEEEECTTCGGGGGGCEEEEEEEGGGSTTCC--------CEEEEEEETTEEEEEEESC
T ss_pred             hHHHHHHHHHHHHHHhcCCCCcEEEEecCchhHhhhhccCcEEEeccCCCCCCCCCccCCcccEEEEEECCEEEEEEeCC
Confidence            45788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeecCCCCccccHHHHHHHHcCCCEEEEEeccCCCCCCCCCccHHHHHHHHhhccCCCCCCCCCCCCCCCCCCCCCCcc
Q psy9643         206 FHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNK  285 (412)
Q Consensus       206 ~H~yeg~~~~~v~~~i~ll~~lGv~~II~~n~~G~l~~~~~~Gd~vi~~d~i~~~~~~~~~pl~g~~~~~~g~~~~~~~~  285 (412)
                      .|.||||+|++++|++++++.+||+.||++|++|++++++++||+|+++||||++++++.+|+.|.+...+|++|+++++
T Consensus        85 ~H~yeg~~~~~v~~~~~~l~~lGv~~iI~tgaaGgl~~~~~~GDlVi~~d~i~~t~~~~~~~~~g~~~~~~g~~~~~~~~  164 (284)
T 3fuc_A           85 FHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSD  164 (284)
T ss_dssp             CCGGGTCCHHHHTHHHHHHHHHTCCEEEEEEEEEECSTTCCTTCEEEEEEEEEHHHHTTCCTTCSSCCTTTCCSSCCCTT
T ss_pred             ccccCCCChHHHHHHHHHHHHcCCCEEEEecceecCCCCCCCCCEEEehHHhcccCCcCCCCCcCccccccCCCcCCCCc
Confidence            99999999999999999999999999999999999999999999999999999987667999999888888999999999


Q ss_pred             cccHHHHHHHHHHHHHcCCCcceeeceEEEEecCccCCHHHHHHHHHcCCcEEeCchhHHHHHHHHcCCcEEEEEeeecc
Q psy9643         286 AYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLITNK  365 (412)
Q Consensus       286 ~~d~~Lr~~~~~~a~~~g~~~~~~~Gvy~~~~GP~feT~AE~~~~~~~Gad~VgMe~~pEa~~A~~~Gi~~~~i~~VSd~  365 (412)
                      +||++||+.+.++|+++|++..+++|+|++++||+|+|+||++++|+||+|+||||++||+++|+++|+||++|++|||+
T Consensus       165 ~~d~~L~~~~~~~a~~~gi~~~~~~Gvy~~~~Gp~feT~AE~~~~r~~Gad~VgMe~~pea~lAr~~gi~~~~I~~VTd~  244 (284)
T 3fuc_A          165 AYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNK  244 (284)
T ss_dssp             CSCHHHHHHHHHHHHHHTCSSCCEEEEEEECCCSSCCCHHHHHHHHHTTCSEEESSSHHHHHHHHHTTCEEEEEEEEEEE
T ss_pred             CCCHHHHHHHHHHHHHcCCCcceEeeEEEEecCCEEcCHHHHHHHHHcCCcEEecCHHHHHHHHHHcCCCEEEEEEEecc
Confidence            99999999999999999987238999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q psy9643         366 CVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYIG  404 (412)
Q Consensus       366 a~~~~~~~~~~s~~ev~~~~~~~~~~~~~ll~~~i~~l~  404 (412)
                      ++|.++++++++|+||++.+++++.++.+||.++|++|+
T Consensus       245 a~~~~~~~~~~s~eev~~~~~~~~~~~~~l~~~~i~~l~  283 (284)
T 3fuc_A          245 VIMDYESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIP  283 (284)
T ss_dssp             CCCCSSCCCCCCHHHHHHHHHHHHHHHHHHHHHHGGGSC
T ss_pred             cccccCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            987545788999999999999999999999999999875



>3khs_A Purine nucleoside phosphorylase; alpha-beta structure, mixed beta-barrel, hydrolase; 2.38A {Grouper iridovirus} SCOP: c.56.2.0 Back     alignment and structure
>3phb_E Purine nucleoside phosphorylase; PNP,immucillin, transferase-transferase inhibitor complex; HET: IM5; 2.30A {Homo sapiens} Back     alignment and structure
>3la8_A SMU.1229, putative purine nucleoside phosphorylase; PUNA, glycosyltransferase, transferase; 1.80A {Streptococcus mutans} PDB: 3lba_A* Back     alignment and structure
>3odg_A Xanthosine phosphorylase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; HET: XAN; 1.64A {Yersinia pseudotuberculosis} PDB: 1yqq_A* 1yqu_A* 1yr3_A* Back     alignment and structure
>1vmk_A Purine nucleoside phosphorylase; TM1596, structural genomics protein structure initiative, PSI, joint center for structu genomics; HET: GUN; 2.01A {Thermotoga maritima} SCOP: c.56.2.1 Back     alignment and structure
>1tcv_A Purine-nucleoside phosphorylase; transferase; HET: NDS; 1.75A {Schistosoma mansoni} PDB: 1tcu_A* 1td1_A 3djf_A* 3e0q_A* 3e9r_A* 3e9z_A* 3f8w_A* 3faz_A* 3fb1_A* 3fnq_A* 3iex_A* Back     alignment and structure
>2p4s_A Purine nucleoside phosphorylase; transferase; HET: DIH; 2.20A {Anopheles gambiae} Back     alignment and structure
>1g2o_A Purine nucleoside phosphorylase; trimer, transition-state complex, transferase; HET: IMH; 1.75A {Mycobacterium tuberculosis} SCOP: c.56.2.1 PDB: 1i80_A* 1n3i_A* 3iom_A* Back     alignment and structure
>1qe5_A Pentosyltransferase; enzyme, purine nucleoside phosphorylase; 2.20A {Cellulomonas SP} SCOP: c.56.2.1 PDB: 1c3x_A Back     alignment and structure
>3ozb_A Methylthioadenosine phosphorylase; 5'-methylthioinosine,phosphorylase, transferase; HET: HPA; 2.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1wta_A 5'-methylthioadenosine phosphorylase; A/B structure, transferase; HET: ADE; 1.78A {Aeropyrum pernix} Back     alignment and structure
>2a8y_A 5'-methylthioadenosine phosphorylase (MTAP); alpha/beta, beta sheet, beta barrel, transferase; HET: MTA; 1.45A {Sulfolobus solfataricus} PDB: 3t94_A* 1v4n_A Back     alignment and structure
>1cb0_A Protein (5'-deoxy-5'-methylthioadenosine phosphor; methylthioadenosine phosphorylase, purine nucleoside phospho purine salvage, adenine; HET: ADE; 1.70A {Homo sapiens} SCOP: c.56.2.1 PDB: 1cg6_A* 1k27_A* 1sd1_A* 1sd2_A* 3ozc_A* 3ozd_A* 3oze_A Back     alignment and structure
>3nm6_B MTA/SAH nucleosidase; hydrolase; HET: ADE; 1.60A {Helicobacter pylori} SCOP: c.56.2.0 PDB: 3nm5_A* 3nm4_A* 4ffs_A* Back     alignment and structure
>3o4v_A MTA/SAH nucleosidase; mixed alpha/beta dimer, hydrolase; HET: 4CT; 1.75A {Escherichia coli} SCOP: c.56.2.1 PDB: 1jys_A* 1nc1_A* 1nc3_A* 1y6q_A* 1y6r_A* 1z5p_A* 3df9_A* 1z5n_A* 1z5o_A* 4g89_A* Back     alignment and structure
>3dp9_A MTA/SAH nucleosidase; vibrio cholerae 5'-methylthioadenosine/S-adenosyl homocystei nucleosidase, butylthio dadme immucillin A, MTAN, hydrolase; HET: BIG; 2.30A {Vibrio cholerae} SCOP: c.56.2.1 Back     alignment and structure
>2h8g_A 5'-methylthioadenosine nucleosidase; protein-adenine complex, hydrolase; HET: ADE; 1.50A {Arabidopsis thaliana} PDB: 2qsu_A 2qtg_A* 2qtt_A* 3lgs_A* Back     alignment and structure
>3bsf_A AT4G34840, nucleosidase; alpha-beta, hydrolase; HET: ADE; 2.90A {Arabidopsis thaliana} Back     alignment and structure
>3eei_A 5-methylthioadenosine nucleosidase/S- adenosylhomocysteine nucleosidase; MTAN; HET: MTM; 1.78A {Neisseria meningitidis serogroup B} SCOP: c.56.2.1 Back     alignment and structure
>4g41_A MTA/SAH nucleosidase; mixed alpha/beta, hydrolase, S-adenosylhomocysteine, cleavag; HET: MTA; 1.45A {Streptococcus pyogenes} Back     alignment and structure
>3bl6_A 5'-methylthioadenosine nucleosidase/S- adenosylhomocysteine nucleosidase; MTAN, alpha and beta proteins, hydrolase; HET: FMC; 1.70A {Staphylococcus aureus} Back     alignment and structure
>1zos_A 5'-methylthioadenosine / S-adenosylhomocysteine nucleosidase; transition state, inhibitor, hydrolase; HET: MTM; 1.60A {Streptococcus pneumoniae R6} PDB: 3mms_A* Back     alignment and structure
>1odk_A Purine nucleoside phosphorylase; alpha-beta protein, transferase, riken structural genomics/proteomics initiative, RSGI; 1.9A {Thermus thermophilus} SCOP: c.56.2.1 PDB: 1odj_A* 1odi_A 1odl_A Back     alignment and structure
>1z34_A Purine nucleoside phosphorylase; alpha-beta-alpha sandwich, transferase; HET: 2FD; 2.40A {Trichomonas vaginalis} PDB: 1z33_A* 1z35_A* 1z36_A* 1z37_A* 1z38_A* 1z39_A* 2i4t_A* 2isc_A* Back     alignment and structure
>2b94_A Purine nucleoside phosphorylase; SGPP, structural genomics, PSI, protein structure initiative UDP, ontario/toronto SGC; 1.85A {Plasmodium knowlesi} PDB: 3emv_A 1sq6_A 2bsx_A* 3enz_A* Back     alignment and structure
>1je0_A MTAP;, 5'-methylthioadenosine phosphorylase; alpha-beta protein, transferase; 1.60A {Sulfolobus solfataricus} SCOP: c.56.2.1 PDB: 1jdt_A* 1jdu_A 1jdv_A* 1jdz_A* 1jds_A 1je1_A* 1jp7_A 1jpv_A Back     alignment and structure
>1vhw_A Purine nucleoside phosphorylase; structural genomics, transferase; HET: ADN; 1.54A {Vibrio cholerae} SCOP: c.56.2.1 PDB: 1vhj_A* 3of3_A* 3occ_A* 1pw7_A* 1pr1_A* 1pr2_A* 1pr4_A* 1pr5_A* 1pr0_A* 1pr6_A* 3onv_A 1pk7_A* 1k9s_A* 1pke_A* 1pk9_A 3ooe_A 3ooh_A 1ecp_A 1a69_A 1oty_A* ... Back     alignment and structure
>3uaw_A PNP, purine nucleoside phosphorylase DEOD-type; necleoside phosphorylase I (NP-I) family, transferase; HET: ADN GOL; 1.20A {Bacillus cereus} PDB: 2ac7_A 3uav_A* 3uax_A* 1xe3_A 3uay_A* 3uaz_A* 4d8y_A 4d8x_A 4d8v_A 4d98_A 4d9h_A* 4da0_A* 4da6_A* 4da7_A* 4da8_A* 4dab_A* 4dae_A* 4dan_A* 4dao_A* 4dar_A* Back     alignment and structure
>3u40_A Pnpase, purine nucleoside phosphorylase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: ADN; 2.05A {Entamoeba histolytica} SCOP: c.56.2.0 PDB: 3tl6_A* Back     alignment and structure
>1ybf_A AMP nucleosidase; structural genomics, protein structure initiative, PSI, NEW research center for structural genomics, nysgxrc; 2.90A {Bacteroides thetaiotaomicron} SCOP: c.56.2.1 Back     alignment and structure
>3phc_A Purine nucleoside phosphorylase; PNP,immucillin, transferase-transferase inhibitor complex; HET: IM5; 2.00A {Plasmodium falciparum} PDB: 1q1g_A* 1nw4_A* 3fow_A* Back     alignment and structure
>3ddo_A Urdpase, upase, uridine phosphorylase; transferase, cytoplasm, glycosyltransferase; 1.50A {Salmonella typhimurium} SCOP: c.56.2.1 PDB: 1ryz_A 1sj9_A* 1y1q_A* 1y1s_A 1y1r_A 1zl2_A* 2hn9_A 1y1t_A* 2hsw_A 2hwu_A* 2pga_A* 2hrd_A 3dps_A 3fwp_A* 3nsr_A* 3c74_A* 2qdk_A 2iq5_A 2oec_A* 2i8a_A ... Back     alignment and structure
>3qpb_A Uridine phosphorylase; hexamer, NP-I superfamily, pyrimidine salvage pathway, uridi phosphorylase, transition state; HET: R1P; 1.82A {Streptococcus pyogenes serotype M6} Back     alignment and structure
>3mb8_A Purine nucleoside phosphorylase; PNP, immucillin H, IMMH, TR; HET: IMH; 1.90A {Toxoplasma gondii} Back     alignment and structure
>1t8s_A AMP nucleosidase; alpha-beta-alpha sandwich, alpha-beta fold, hydrolase; HET: FMP; 2.60A {Escherichia coli} SCOP: c.56.2.1 PDB: 1t8r_A* 1t8w_A 1t8y_A 2guw_A Back     alignment and structure
>3bje_A Nucleoside phosphorylase, putative; uridine phosphorylase, structural medical structural genomics of pathogenic protozoa consorti MSGPP; HET: R1P; 1.44A {Trypanosoma brucei} Back     alignment and structure
>3euf_A Uridine phosphorylase 1; nucleoside phosphorylase, uridine rescue, 5- benzylacyclouridine, alternative splicing, glycosyltransferase, transferase; HET: BAU; 1.90A {Homo sapiens} PDB: 3eue_A* 3nbq_A 3ku4_A 3kuk_A* 3kvr_A 3kvy_A Back     alignment and structure
>3p0f_A Uridine phosphorylase 2; transferase; HET: BAU; 1.54A {Homo sapiens} PDB: 3p0e_A* 2xrf_A Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 412
d3pnpa_284 c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP 6e-92
d1vmka_265 c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP 9e-78
d1g2oa_262 c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP 2e-77
d1qe5a_266 c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP 2e-70
d1cb0a_273 c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phos 3e-57
d1v4na_266 c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phos 8e-49
d1odka_234 c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP 1e-13
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 4e-12
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 1e-08
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 4e-12
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 1e-11
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 2e-04
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 1e-11
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 3e-10
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 3e-10
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 2e-09
d1wb1a4179 c.37.1.8 (A:1-179) Elongation factor SelB, N-termi 2e-08
d1vhwa_237 c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP 9e-08
d1ybfa_246 c.56.2.1 (A:) AMP nucleosidase {Bacteroides thetai 1e-07
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 2e-07
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 8e-07
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 1e-06
d1jysa_230 c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhom 1e-06
d1t8sa_477 c.56.2.1 (A:) AMP nucleosidase {Escherichia coli [ 6e-06
d2dy1a2267 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t 1e-05
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 6e-05
d2ac7a1231 c.56.2.1 (A:2-232) Purine nucleoside phosphorylase 4e-04
>d3pnpa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Purine and uridine phosphorylases
family: Purine and uridine phosphorylases
domain: Purine nucleoside phosphorylase, PNP
species: Cow (Bos taurus) [TaxId: 9913]
 Score =  276 bits (707), Expect = 6e-92
 Identities = 149/282 (52%), Positives = 193/282 (68%)

Query: 122 MLGSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVST 181
           M   YTYE  Q  AK+LL     RP++ +ICGSGL  + + +T    F Y  IP FP ST
Sbjct: 1   MANGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPEST 60

Query: 182 VPGHKGQLVFGLINGIPIMCMQGRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGL 241
           VPGH G+LVFG++NG   + MQGRFH YEGYP WK   P+RV +L+GV  L+ TNAAGGL
Sbjct: 61  VPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGL 120

Query: 242 NPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPMNKAYNKQLRAATLDIARD 301
           NP++EVGDIM+I+DHINL GF+G NPL G NE+RFG RFP M+ AY++ +R       + 
Sbjct: 121 NPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQ 180

Query: 302 LNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSL 361
           +     ++EG Y ++GGPNFETVAE  +LR  G DAVGMSTV EVI A HCG+ V  FSL
Sbjct: 181 MGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSL 240

Query: 362 ITNKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYI 403
           ITNK + D +   +ANHEEV++AGK     ++  V+ +++ I
Sbjct: 241 ITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASI 282


>d1vmka_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Thermotoga maritima [TaxId: 2336]} Length = 265 Back     information, alignment and structure
>d1g2oa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Mycobacterium tuberculosis [TaxId: 1773]} Length = 262 Back     information, alignment and structure
>d1qe5a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cellulomonas sp. [TaxId: 40001]} Length = 266 Back     information, alignment and structure
>d1cb0a_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1v4na_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus tokodaii [TaxId: 111955]} Length = 266 Back     information, alignment and structure
>d1odka_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Thermus thermophilus [TaxId: 274]} Length = 234 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Length = 179 Back     information, alignment and structure
>d1vhwa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Vibrio cholerae [TaxId: 666]} Length = 237 Back     information, alignment and structure
>d1ybfa_ c.56.2.1 (A:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 246 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1jysa_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]} Length = 230 Back     information, alignment and structure
>d1t8sa_ c.56.2.1 (A:) AMP nucleosidase {Escherichia coli [TaxId: 562]} Length = 477 Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d2ac7a1 c.56.2.1 (A:2-232) Purine nucleoside phosphorylase, PNP {Bacillus anthracis [TaxId: 1392]} Length = 231 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query412
d3pnpa_284 Purine nucleoside phosphorylase, PNP {Cow (Bos tau 100.0
d1vmka_265 Purine nucleoside phosphorylase, PNP {Thermotoga m 100.0
d1g2oa_262 Purine nucleoside phosphorylase, PNP {Mycobacteriu 100.0
d1qe5a_266 Purine nucleoside phosphorylase, PNP {Cellulomonas 100.0
d1cb0a_273 5'-deoxy-5'-methylthioadenosine phosphorylase {Hum 100.0
d1v4na_266 5'-deoxy-5'-methylthioadenosine phosphorylase {Sul 100.0
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.86
d1jysa_230 5'-Methylthioadenosine/S-Adenosylhomocysteine nucl 99.81
d1odka_234 Purine nucleoside phosphorylase, PNP {Thermus ther 99.79
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.78
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.77
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.75
d1vhwa_237 Purine nucleoside phosphorylase, PNP {Vibrio chole 99.74
d1rxya_250 Uridine phosphorylase {Escherichia coli [TaxId: 56 99.74
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.73
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.73
d1je0a_234 5'-deoxy-5'-methylthioadenosine phosphorylase {Arc 99.73
d2ac7a1231 Purine nucleoside phosphorylase, PNP {Bacillus ant 99.71
d1ybfa_246 AMP nucleosidase {Bacteroides thetaiotaomicron [Ta 99.66
d1q1ga_243 Putative uridine phosphorylase {Plasmodium falcipa 99.65
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.55
d1t8sa_477 AMP nucleosidase {Escherichia coli [TaxId: 562]} 99.48
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.45
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.43
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.35
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.29
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 98.95
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 98.9
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.16
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.74
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 96.44
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 96.15
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.77
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 95.51
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.23
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.88
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 94.47
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 93.81
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.63
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 93.62
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 93.14
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.97
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 92.93
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 92.75
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.49
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.48
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.2
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 92.14
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.09
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 91.97
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.75
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.39
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.29
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.28
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 91.26
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 90.91
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 90.84
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 90.68
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.27
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 89.93
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 89.58
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 89.35
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.26
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 89.0
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 88.65
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 88.53
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 88.51
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 88.29
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 88.2
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 87.58
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 87.52
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 87.46
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 87.23
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 87.21
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.17
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 87.09
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 87.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 86.91
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 86.85
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 86.77
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 86.68
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 86.63
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 86.56
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 86.45
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 86.22
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 86.18
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 86.13
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 86.12
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 86.04
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 86.03
d1g2912240 Maltose transport protein MalK, N-terminal domain 85.93
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 85.85
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 85.46
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 85.38
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 85.38
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 85.01
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 84.83
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 84.49
d2awna2232 Maltose transport protein MalK, N-terminal domain 84.25
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 83.92
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 83.86
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 83.86
d2hyda1255 Putative multidrug export ATP-binding/permease pro 83.49
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 83.23
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 83.16
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 82.97
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 82.65
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 82.58
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 82.08
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 82.03
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 81.78
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 81.68
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 81.63
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 81.57
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 81.44
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 81.33
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 81.28
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 80.87
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 80.64
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 80.5
>d3pnpa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Purine and uridine phosphorylases
family: Purine and uridine phosphorylases
domain: Purine nucleoside phosphorylase, PNP
species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00  E-value=5e-66  Score=497.30  Aligned_cols=281  Identities=53%  Similarity=0.948  Sum_probs=251.6

Q ss_pred             chhhHHHHHHHHHHHhhhcCCCCceeEeeCcCcccccccccCceeeecCCCCCccccCCCCCceeEEEEeeCCeEEEEec
Q psy9643         124 GSYTYELIQSIAKFLLDSISIRPKIGIICGSGLSTIADSITDRHIFPYDTIPYFPVSTVPGHKGQLVFGLINGIPIMCMQ  203 (412)
Q Consensus       124 ~~~~~~~~~~~~~~i~~~~~~e~~~GIi~GsGl~~~~~~~~~~~~~~~~~~~~~~i~d~pGH~~~l~~G~~~g~~vv~~q  203 (412)
                      +.+.+++++++++||+++++..|++|||+||||+++++.+++..+++|+++|+||.++++||+++++.|.++|++|+++|
T Consensus         3 ~~~~~~~~~~~~~~i~~~~~~~p~igII~GSGL~~l~~~i~~~~~i~y~~ip~fp~stv~gh~g~lv~G~~~g~~v~~~~   82 (284)
T d3pnpa_           3 NGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQ   82 (284)
T ss_dssp             CCCCHHHHHHHHHHHHTTCSCCCSEEEEECTTCGGGGGGCEEEEEEEGGGSTTCCCCCSTTCCCEEEEEEETTEEEEEEE
T ss_pred             CCccHHHHHHHHHHHHHhCCCCCcEEEEecCCHHHHHhhhcCcEEEecccCCCCCCCCcCCCCCCEEEEEECCceEEEeC
Confidence            34678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeeecCCCCccccHHHHHHHHcCCCEEEEEeccCCCCCCCCCccHHHHHHHHhhccCCCCCCCCCCCCCCCCCCCCCC
Q psy9643         204 GRFHYYEGYPLWKCAMPIRVMKLVGVTHLLATNAAGGLNPDYEVGDIMIIKDHINLMGFAGNNPLLGVNEDRFGPRFPPM  283 (412)
Q Consensus       204 gr~H~yeg~~~~~v~~~i~ll~~lGv~~II~~n~~G~l~~~~~~Gd~vi~~d~i~~~~~~~~~pl~g~~~~~~g~~~~~~  283 (412)
                      ||.|.|||++|+.+++++++++.+||++||.+|++|++|++++|||+|+++||||++++++.|||.|.+++.++.+|+++
T Consensus        83 gr~H~yeg~~~~~v~~~i~~~~~lGv~~ii~tnavGsl~~~~~pGdlv~~~d~Id~t~~~~~~~~~g~~~~~~~~~~~~~  162 (284)
T d3pnpa_          83 GRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAM  162 (284)
T ss_dssp             SCCCGGGTCCHHHHTHHHHHHHHHTCCEEEEEEEEEECSTTCCTTCEEEEEEEEEHHHHTTCCTTCSSCCTTTCCSSCCC
T ss_pred             CCCcCCCCCCHHHhhhHHHHHHHcCCCeEEEeccccccCccCCccceeeccceeeccccCCCCCccCccccccccccccC
Confidence            99999999999999999999999999999999999999999999999999999999988899999999888899999999


Q ss_pred             cccccHHHHHHHHHHHHHcCCCcceeeceEEEEecCccCCHHHHHHHHHcCCcEEeCchhHHHHHHHHcCCcEEEEEeee
Q psy9643         284 NKAYNKQLRAATLDIARDLNMSSIVKEGVYSVIGGPNFETVAELNMLRICGVDAVGMSTVHEVITAHHCGMTVTAFSLIT  363 (412)
Q Consensus       284 ~~~~d~~Lr~~~~~~a~~~g~~~~~~~Gvy~~~~GP~feT~AE~~~~~~~Gad~VgMe~~pEa~~A~~~Gi~~~~i~~VS  363 (412)
                      .++||++||+.+.++|++++....+++|||+++.||+|||+||++++|++|||+||||++||+.+|+++||||++|++||
T Consensus       163 ~~~y~~~lr~~~~~~a~~~~~~~~~~~GvY~~~~GP~fET~AEir~~r~~GaDvVGMS~vPEa~lArelgi~~a~is~VT  242 (284)
T d3pnpa_         163 SDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLIT  242 (284)
T ss_dssp             TTCSCHHHHHHHHHHHHHTTCSSCCEEEEEEECCCSSCCCHHHHHHHHHTTCSEEESSSHHHHHHHHHTTCEEEEEEEEE
T ss_pred             cchhhHHHHHHHHHHHHHhCCccccCceEEEEecCCcccchHHHHHHHHccCCcccCCccHHHHHHHHcCCCEEEEEEEe
Confidence            99999999999999999998874578999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q psy9643         364 NKCVTDYDDHAEANHEEVIQAGKLRGPMIKSMVTRIVSYIG  404 (412)
Q Consensus       364 d~a~~~~~~~~~~s~~ev~~~~~~~~~~~~~ll~~~i~~l~  404 (412)
                      |+|+|.+++..++||+||++.++++.+++.+++.++|++|+
T Consensus       243 N~A~~~g~~~~~lsheeVl~~~~~~~~~~~~li~~~i~~lP  283 (284)
T d3pnpa_         243 NKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIP  283 (284)
T ss_dssp             EEC---------------------CHHHHHHHHHHHGGGSC
T ss_pred             chhhccCcCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHhCC
Confidence            99987666778999999999999999999999999999986



>d1vmka_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g2oa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qe5a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Cellulomonas sp. [TaxId: 40001]} Back     information, alignment and structure
>d1cb0a_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v4na_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jysa_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odka_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1vhwa_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rxya_ c.56.2.1 (A:) Uridine phosphorylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1je0a_ c.56.2.1 (A:) 5'-deoxy-5'-methylthioadenosine phosphorylase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ac7a1 c.56.2.1 (A:2-232) Purine nucleoside phosphorylase, PNP {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1ybfa_ c.56.2.1 (A:) AMP nucleosidase {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1q1ga_ c.56.2.1 (A:) Putative uridine phosphorylase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1t8sa_ c.56.2.1 (A:) AMP nucleosidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure