Psyllid ID: psy9646
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| 403182633 | 751 | AAEL017378-PA [Aedes aegypti] | 0.488 | 0.137 | 0.902 | 2e-48 | |
| 157119079 | 463 | elongation factor tu (ef-tu) [Aedes aegy | 0.488 | 0.222 | 0.902 | 4e-48 | |
| 170047901 | 462 | elongation factor Tu [Culex quinquefasci | 0.488 | 0.222 | 0.893 | 1e-47 | |
| 193665787 | 482 | PREDICTED: elongation factor Tu, mitocho | 0.488 | 0.213 | 0.883 | 1e-47 | |
| 158286472 | 466 | AGAP006996-PA [Anopheles gambiae str. PE | 0.488 | 0.221 | 0.893 | 1e-47 | |
| 312373151 | 310 | hypothetical protein AND_18233 [Anophele | 0.488 | 0.332 | 0.893 | 2e-47 | |
| 215259883 | 310 | elongation factor Tu [Culex tarsalis] | 0.488 | 0.332 | 0.893 | 2e-47 | |
| 289740121 | 488 | mitochondrial translation elongation fac | 0.488 | 0.211 | 0.883 | 2e-47 | |
| 307191010 | 399 | Elongation factor Tu, mitochondrial [Cam | 0.492 | 0.260 | 0.846 | 5e-47 | |
| 195400541 | 487 | GJ19676 [Drosophila virilis] gi|19415622 | 0.488 | 0.211 | 0.873 | 7e-47 |
| >gi|403182633|gb|EJY57527.1| AAEL017378-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 197 bits (501), Expect = 2e-48, Method: Compositional matrix adjust.
Identities = 93/103 (90%), Positives = 98/103 (95%)
Query: 108 VLADKKLAKVKQYADIDNAPEEKARGITINVAHVEYATENRHYSHTDCPGHADYIKNMIT 167
VLADK LA+ K+YADIDNAPEEKARGITINVAH+EY TENRHY HTDCPGHADYIKNMIT
Sbjct: 368 VLADKDLAESKKYADIDNAPEEKARGITINVAHIEYQTENRHYGHTDCPGHADYIKNMIT 427
Query: 168 GTSQMDGAILVVAATDGAMPQTREHLLLAKQIGVTNIVVFINK 210
GT+QMDGAILVVAATDGAMPQTREHLLLAKQIGV +IVVFINK
Sbjct: 428 GTAQMDGAILVVAATDGAMPQTREHLLLAKQIGVNHIVVFINK 470
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157119079|ref|XP_001659326.1| elongation factor tu (ef-tu) [Aedes aegypti] gi|108875477|gb|EAT39702.1| AAEL008517-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170047901|ref|XP_001851443.1| elongation factor Tu [Culex quinquefasciatus] gi|167870141|gb|EDS33524.1| elongation factor Tu [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|193665787|ref|XP_001948492.1| PREDICTED: elongation factor Tu, mitochondrial-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|158286472|ref|XP_308774.4| AGAP006996-PA [Anopheles gambiae str. PEST] gi|157020484|gb|EAA04167.4| AGAP006996-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|312373151|gb|EFR20958.1| hypothetical protein AND_18233 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|215259883|gb|ACJ64433.1| elongation factor Tu [Culex tarsalis] | Back alignment and taxonomy information |
|---|
| >gi|289740121|gb|ADD18808.1| mitochondrial translation elongation factor Tu [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|307191010|gb|EFN74764.1| Elongation factor Tu, mitochondrial [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|195400541|ref|XP_002058875.1| GJ19676 [Drosophila virilis] gi|194156226|gb|EDW71410.1| GJ19676 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 211 | ||||||
| FB|FBgn0024556 | 489 | EfTuM "Elongation factor Tu mi | 0.488 | 0.210 | 0.864 | 1.5e-44 | |
| ZFIN|ZDB-GENE-050320-73 | 448 | tufm "Tu translation elongatio | 0.488 | 0.229 | 0.786 | 9.6e-41 | |
| UNIPROTKB|F1RFI1 | 452 | TUFM "Elongation factor Tu" [S | 0.488 | 0.227 | 0.747 | 1.4e-39 | |
| TIGR_CMR|CHY_2327 | 400 | CHY_2327 "translation elongati | 0.488 | 0.257 | 0.747 | 6.1e-39 | |
| MGI|MGI:1923686 | 452 | Tufm "Tu translation elongatio | 0.488 | 0.227 | 0.737 | 9.9e-39 | |
| RGD|1305501 | 452 | Tufm "Tu translation elongatio | 0.488 | 0.227 | 0.737 | 9.9e-39 | |
| UNIPROTKB|P85834 | 452 | Tufm "Elongation factor Tu, mi | 0.488 | 0.227 | 0.737 | 9.9e-39 | |
| TIGR_CMR|CHY_2312 | 400 | CHY_2312 "translation elongati | 0.488 | 0.257 | 0.737 | 1.3e-38 | |
| UNIPROTKB|P49410 | 452 | TUFM "Elongation factor Tu, mi | 0.488 | 0.227 | 0.728 | 2.1e-38 | |
| UNIPROTKB|E2RSU3 | 452 | TUFM "Elongation factor Tu" [C | 0.488 | 0.227 | 0.728 | 2.1e-38 |
| FB|FBgn0024556 EfTuM "Elongation factor Tu mitochondrial" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 469 (170.2 bits), Expect = 1.5e-44, P = 1.5e-44
Identities = 89/103 (86%), Positives = 97/103 (94%)
Query: 108 VLADKKLAKVKQYADIDNAPEEKARGITINVAHVEYATENRHYSHTDCPGHADYIKNMIT 167
VLADK+LA+ K+Y +IDNAPEEKARGITINVAHVEY TE RHY HTDCPGHADYIKNMIT
Sbjct: 105 VLADKQLAESKKYNEIDNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMIT 164
Query: 168 GTSQMDGAILVVAATDGAMPQTREHLLLAKQIGVTNIVVFINK 210
GT+QMDGAILVVAATDGAMPQTREH+LLAKQIG+ +IVVFINK
Sbjct: 165 GTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVVFINK 207
|
|
| ZFIN|ZDB-GENE-050320-73 tufm "Tu translation elongation factor, mitochondrial" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RFI1 TUFM "Elongation factor Tu" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_2327 CHY_2327 "translation elongation factor Tu" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1923686 Tufm "Tu translation elongation factor, mitochondrial" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305501 Tufm "Tu translation elongation factor, mitochondrial" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P85834 Tufm "Elongation factor Tu, mitochondrial" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_2312 CHY_2312 "translation elongation factor Tu" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49410 TUFM "Elongation factor Tu, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RSU3 TUFM "Elongation factor Tu" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| cd01884 | 195 | cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b | 1e-76 | |
| PRK00049 | 396 | PRK00049, PRK00049, elongation factor Tu; Reviewed | 2e-71 | |
| PRK12735 | 396 | PRK12735, PRK12735, elongation factor Tu; Reviewed | 2e-70 | |
| PRK12736 | 394 | PRK12736, PRK12736, elongation factor Tu; Reviewed | 2e-67 | |
| CHL00071 | 409 | CHL00071, tufA, elongation factor Tu | 2e-67 | |
| COG0050 | 394 | COG0050, TufB, GTPases - translation elongation fa | 1e-63 | |
| TIGR00485 | 394 | TIGR00485, EF-Tu, translation elongation factor TU | 1e-59 | |
| PLN03127 | 447 | PLN03127, PLN03127, Elongation factor Tu; Provisio | 3e-57 | |
| pfam00009 | 184 | pfam00009, GTP_EFTU, Elongation factor Tu GTP bind | 9e-51 | |
| PRK00049 | 396 | PRK00049, PRK00049, elongation factor Tu; Reviewed | 1e-50 | |
| PLN03126 | 478 | PLN03126, PLN03126, Elongation factor Tu; Provisio | 4e-50 | |
| PRK12735 | 396 | PRK12735, PRK12735, elongation factor Tu; Reviewed | 9e-50 | |
| PRK12736 | 394 | PRK12736, PRK12736, elongation factor Tu; Reviewed | 1e-48 | |
| cd03697 | 87 | cd03697, EFTU_II, EFTU_II: Elongation factor Tu do | 6e-45 | |
| COG0050 | 394 | COG0050, TufB, GTPases - translation elongation fa | 1e-44 | |
| TIGR00485 | 394 | TIGR00485, EF-Tu, translation elongation factor TU | 2e-42 | |
| PLN03127 | 447 | PLN03127, PLN03127, Elongation factor Tu; Provisio | 3e-42 | |
| CHL00071 | 409 | CHL00071, tufA, elongation factor Tu | 2e-40 | |
| cd01883 | 219 | cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1 | 2e-37 | |
| PRK12317 | 425 | PRK12317, PRK12317, elongation factor 1-alpha; Rev | 1e-34 | |
| PLN03126 | 478 | PLN03126, PLN03126, Elongation factor Tu; Provisio | 1e-33 | |
| cd00881 | 183 | cd00881, GTP_translation_factor, GTP translation f | 2e-33 | |
| COG5256 | 428 | COG5256, TEF1, Translation elongation factor EF-1a | 4e-30 | |
| TIGR00483 | 426 | TIGR00483, EF-1_alpha, translation elongation fact | 6e-28 | |
| cd04171 | 170 | cd04171, SelB, SelB, the dedicated elongation fact | 3e-25 | |
| PTZ00141 | 446 | PTZ00141, PTZ00141, elongation factor 1- alpha; Pr | 5e-25 | |
| cd04166 | 209 | cd04166, CysN_ATPS, CysN, together with protein Cy | 4e-22 | |
| TIGR00475 | 581 | TIGR00475, selB, selenocysteine-specific elongatio | 2e-21 | |
| COG3276 | 447 | COG3276, SelB, Selenocysteine-specific translation | 1e-20 | |
| COG2895 | 431 | COG2895, CysN, GTPases - Sulfate adenylate transfe | 2e-20 | |
| COG5256 | 428 | COG5256, TEF1, Translation elongation factor EF-1a | 1e-19 | |
| PRK05506 | 632 | PRK05506, PRK05506, bifunctional sulfate adenylylt | 3e-19 | |
| TIGR02034 | 406 | TIGR02034, CysN, sulfate adenylyltransferase, larg | 2e-18 | |
| cd03696 | 83 | cd03696, selB_II, selB_II: this subfamily represen | 9e-18 | |
| PRK10512 | 614 | PRK10512, PRK10512, selenocysteinyl-tRNA-specific | 2e-17 | |
| PRK05124 | 474 | PRK05124, cysN, sulfate adenylyltransferase subuni | 2e-17 | |
| pfam03144 | 70 | pfam03144, GTP_EFTU_D2, Elongation factor Tu domai | 5e-17 | |
| PLN00043 | 447 | PLN00043, PLN00043, elongation factor 1-alpha; Pro | 1e-16 | |
| PRK12317 | 425 | PRK12317, PRK12317, elongation factor 1-alpha; Rev | 3e-16 | |
| cd03693 | 91 | cd03693, EF1_alpha_II, EF1_alpha_II: this family r | 3e-16 | |
| PTZ00141 | 446 | PTZ00141, PTZ00141, elongation factor 1- alpha; Pr | 5e-16 | |
| cd01342 | 83 | cd01342, Translation_Factor_II_like, Translation_F | 7e-16 | |
| TIGR00483 | 426 | TIGR00483, EF-1_alpha, translation elongation fact | 9e-16 | |
| PRK04000 | 411 | PRK04000, PRK04000, translation initiation factor | 3e-15 | |
| COG3276 | 447 | COG3276, SelB, Selenocysteine-specific translation | 2e-14 | |
| cd01888 | 197 | cd01888, eIF2_gamma, Gamma subunit of initiation f | 2e-14 | |
| TIGR03680 | 406 | TIGR03680, eif2g_arch, translation initiation fact | 2e-14 | |
| cd01889 | 192 | cd01889, SelB_euk, SelB, the dedicated elongation | 2e-14 | |
| PLN00043 | 447 | PLN00043, PLN00043, elongation factor 1-alpha; Pro | 9e-14 | |
| COG5257 | 415 | COG5257, GCD11, Translation initiation factor 2, g | 9e-14 | |
| cd04168 | 237 | cd04168, TetM_like, Tet(M)-like family includes Te | 2e-13 | |
| COG0480 | 697 | COG0480, FusA, Translation elongation factors (GTP | 8e-13 | |
| COG5258 | 527 | COG5258, GTPBP1, GTPase [General function predicti | 4e-12 | |
| PTZ00327 | 460 | PTZ00327, PTZ00327, eukaryotic translation initiat | 9e-12 | |
| TIGR00490 | 720 | TIGR00490, aEF-2, translation elongation factor aE | 7e-11 | |
| cd01887 | 169 | cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk | 1e-10 | |
| PRK12740 | 668 | PRK12740, PRK12740, elongation factor G; Reviewed | 1e-10 | |
| PRK07560 | 731 | PRK07560, PRK07560, elongation factor EF-2; Review | 2e-10 | |
| cd01891 | 194 | cd01891, TypA_BipA, Tyrosine phosphorylated protei | 5e-10 | |
| COG1217 | 603 | COG1217, TypA, Predicted membrane GTPase involved | 1e-09 | |
| TIGR01394 | 594 | TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip | 3e-09 | |
| TIGR00487 | 587 | TIGR00487, IF-2, translation initiation factor IF- | 4e-09 | |
| cd04170 | 268 | cd04170, EF-G_bact, Elongation factor G (EF-G) fam | 6e-09 | |
| TIGR00475 | 581 | TIGR00475, selB, selenocysteine-specific elongatio | 1e-08 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 4e-08 | |
| cd03694 | 87 | cd03694, GTPBP_II, Domain II of the GP-1 family of | 6e-08 | |
| COG0532 | 509 | COG0532, InfB, Translation initiation factor 2 (IF | 7e-08 | |
| cd01885 | 218 | cd01885, EF2, Elongation Factor 2 (EF2) in archaea | 1e-07 | |
| PRK13351 | 687 | PRK13351, PRK13351, elongation factor G; Reviewed | 3e-07 | |
| CHL00189 | 742 | CHL00189, infB, translation initiation factor 2; P | 5e-07 | |
| cd04167 | 213 | cd04167, Snu114p, Snu114p, a spliceosome protein, | 1e-06 | |
| PRK10218 | 607 | PRK10218, PRK10218, GTP-binding protein; Provision | 1e-06 | |
| TIGR00484 | 689 | TIGR00484, EF-G, translation elongation factor EF- | 4e-06 | |
| cd01886 | 270 | cd01886, EF-G, Elongation factor G (EF-G) family i | 8e-06 | |
| TIGR01394 | 594 | TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip | 3e-05 | |
| cd01890 | 179 | cd01890, LepA, LepA also known as Elongation Facto | 3e-05 | |
| COG5257 | 415 | COG5257, GCD11, Translation initiation factor 2, g | 9e-05 | |
| TIGR03680 | 406 | TIGR03680, eif2g_arch, translation initiation fact | 1e-04 | |
| COG5258 | 527 | COG5258, GTPBP1, GTPase [General function predicti | 2e-04 | |
| TIGR00503 | 527 | TIGR00503, prfC, peptide chain release factor 3 | 2e-04 | |
| TIGR01393 | 595 | TIGR01393, lepA, GTP-binding protein LepA | 4e-04 | |
| COG1217 | 603 | COG1217, TypA, Predicted membrane GTPase involved | 7e-04 | |
| cd04169 | 268 | cd04169, RF3, Release Factor 3 (RF3) protein invol | 8e-04 | |
| PTZ00416 | 836 | PTZ00416, PTZ00416, elongation factor 2; Provision | 0.001 | |
| PRK04000 | 411 | PRK04000, PRK04000, translation initiation factor | 0.002 | |
| cd03695 | 81 | cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamil | 0.002 | |
| COG4108 | 528 | COG4108, PrfC, Peptide chain release factor RF-3 [ | 0.002 | |
| PRK10512 | 614 | PRK10512, PRK10512, selenocysteinyl-tRNA-specific | 0.003 | |
| TIGR01393 | 595 | TIGR01393, lepA, GTP-binding protein LepA | 0.003 | |
| COG0481 | 603 | COG0481, LepA, Membrane GTPase LepA [Cell envelope | 0.003 | |
| PRK12739 | 691 | PRK12739, PRK12739, elongation factor G; Reviewed | 0.003 | |
| cd03698 | 83 | cd03698, eRF3_II_like, eRF3_II_like: domain simila | 0.004 |
| >gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins | Back alignment and domain information |
|---|
Score = 228 bits (583), Expect = 1e-76
Identities = 81/103 (78%), Positives = 89/103 (86%)
Query: 108 VLADKKLAKVKQYADIDNAPEEKARGITINVAHVEYATENRHYSHTDCPGHADYIKNMIT 167
VLA K AK K+Y +ID APEEKARGITIN AHVEY T NRHY+H DCPGHADYIKNMIT
Sbjct: 25 VLAKKGGAKAKKYDEIDKAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYIKNMIT 84
Query: 168 GTSQMDGAILVVAATDGAMPQTREHLLLAKQIGVTNIVVFINK 210
G +QMDGAILVV+ATDG MPQTREHLLLA+Q+GV IVVF+NK
Sbjct: 85 GAAQMDGAILVVSATDGPMPQTREHLLLARQVGVPYIVVFLNK 127
|
EF-Tu subfamily. This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts. It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors. The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family. EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation. Length = 195 |
| >gnl|CDD|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177010 CHL00071, tufA, elongation factor Tu | Back alignment and domain information |
|---|
| >gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU | Back alignment and domain information |
|---|
| >gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239668 cd03697, EFTU_II, EFTU_II: Elongation factor Tu domain II | Back alignment and domain information |
|---|
| >gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU | Back alignment and domain information |
|---|
| >gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177010 CHL00071, tufA, elongation factor Tu | Back alignment and domain information |
|---|
| >gnl|CDD|206670 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1-alpha) protein family | Back alignment and domain information |
|---|
| >gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors | Back alignment and domain information |
|---|
| >gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome | Back alignment and domain information |
|---|
| >gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex | Back alignment and domain information |
|---|
| >gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|239667 cd03696, selB_II, selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu | Back alignment and domain information |
|---|
| >gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235349 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 | Back alignment and domain information |
|---|
| >gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239664 cd03693, EF1_alpha_II, EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages | Back alignment and domain information |
|---|
| >gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma) | Back alignment and domain information |
|---|
| >gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome | Back alignment and domain information |
|---|
| >gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|227583 COG5258, GTPBP1, GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family | Back alignment and domain information |
|---|
| >gnl|CDD|237186 PRK12740, PRK12740, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236047 PRK07560, PRK07560, elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >gnl|CDD|232995 TIGR00487, IF-2, translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >gnl|CDD|206733 cd04170, EF-G_bact, Elongation factor G (EF-G) family | Back alignment and domain information |
|---|
| >gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239665 cd03694, GTPBP_II, Domain II of the GP-1 family of GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|206672 cd01885, EF2, Elongation Factor 2 (EF2) in archaea and eukarya | Back alignment and domain information |
|---|
| >gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177089 CHL00189, infB, translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206730 cd04167, Snu114p, Snu114p, a spliceosome protein, is a GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G | Back alignment and domain information |
|---|
| >gnl|CDD|206673 cd01886, EF-G, Elongation factor G (EF-G) family involved in both the elongation and ribosome recycling phases of protein synthesis | Back alignment and domain information |
|---|
| >gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >gnl|CDD|206677 cd01890, LepA, LepA also known as Elongation Factor 4 (EF4) | Back alignment and domain information |
|---|
| >gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >gnl|CDD|227583 COG5258, GTPBP1, GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|129594 TIGR00503, prfC, peptide chain release factor 3 | Back alignment and domain information |
|---|
| >gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA | Back alignment and domain information |
|---|
| >gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|206732 cd04169, RF3, Release Factor 3 (RF3) protein involved in the terminal step of translocation in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|240409 PTZ00416, PTZ00416, elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|239666 cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu | Back alignment and domain information |
|---|
| >gnl|CDD|226593 COG4108, PrfC, Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130460 TIGR01393, lepA, GTP-binding protein LepA | Back alignment and domain information |
|---|
| >gnl|CDD|223557 COG0481, LepA, Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|237185 PRK12739, PRK12739, elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239669 cd03698, eRF3_II_like, eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| KOG0460|consensus | 449 | 99.93 | ||
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 99.91 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 99.91 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 99.9 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 99.9 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 99.9 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 99.9 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 99.9 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 99.89 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 99.89 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 99.89 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 99.89 | |
| cd03693 | 91 | EF1_alpha_II EF1_alpha_II: this family represents | 99.89 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 99.89 | |
| CHL00071 | 409 | tufA elongation factor Tu | 99.88 | |
| cd03698 | 83 | eRF3_II_like eRF3_II_like: domain similar to domai | 99.87 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 99.87 | |
| COG5258 | 527 | GTPBP1 GTPase [General function prediction only] | 99.87 | |
| cd04089 | 82 | eRF3_II eRF3_II: domain II of the eukaryotic class | 99.86 | |
| cd03694 | 87 | GTPBP_II Domain II of the GP-1 family of GTPase. T | 99.86 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 99.85 | |
| cd03697 | 87 | EFTU_II EFTU_II: Elongation factor Tu domain II. E | 99.84 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 99.84 | |
| cd03696 | 83 | selB_II selB_II: this subfamily represents the dom | 99.83 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 99.83 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 99.82 | |
| cd03695 | 81 | CysN_NodQ_II CysN_NodQ_II: This subfamily represen | 99.81 | |
| COG3276 | 447 | SelB Selenocysteine-specific translation elongatio | 99.81 | |
| KOG0460|consensus | 449 | 99.81 | ||
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 99.8 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 99.79 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 99.79 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 99.79 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 99.79 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 99.78 | |
| KOG0459|consensus | 501 | 99.77 | ||
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 99.77 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 99.77 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 99.76 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 99.76 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 99.75 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 99.74 | |
| KOG0458|consensus | 603 | 99.74 | ||
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 99.73 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 99.73 | |
| KOG0458|consensus | 603 | 99.73 | ||
| PRK12736 | 394 | elongation factor Tu; Reviewed | 99.72 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 99.72 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 99.71 | |
| CHL00071 | 409 | tufA elongation factor Tu | 99.71 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 99.71 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 99.71 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 99.71 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 99.7 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 99.69 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 99.69 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 99.69 | |
| KOG0463|consensus | 641 | 99.67 | ||
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 99.66 | |
| KOG0462|consensus | 650 | 99.66 | ||
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 99.66 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 99.66 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 99.66 | |
| KOG0461|consensus | 522 | 99.65 | ||
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 99.65 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 99.65 | |
| COG3276 | 447 | SelB Selenocysteine-specific translation elongatio | 99.64 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 99.64 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 99.63 | |
| cd03688 | 113 | eIF2_gamma_II eIF2_gamma_II: this subfamily repres | 99.63 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 99.62 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 99.6 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 99.6 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 99.59 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 99.59 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 99.59 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 99.58 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 99.57 | |
| KOG1145|consensus | 683 | 99.56 | ||
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 99.55 | |
| KOG0459|consensus | 501 | 99.55 | ||
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 99.54 | |
| KOG0465|consensus | 721 | 99.54 | ||
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 99.53 | |
| COG5257 | 415 | GCD11 Translation initiation factor 2, gamma subun | 99.53 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 99.53 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 99.51 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 99.51 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 99.5 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 99.5 | |
| KOG0467|consensus | 887 | 99.5 | ||
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 99.5 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 99.49 | |
| KOG0468|consensus | 971 | 99.49 | ||
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 99.48 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 99.45 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 99.45 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 99.45 | |
| cd03692 | 84 | mtIF2_IVc mtIF2_IVc: this family represents the C2 | 99.44 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 99.44 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 99.43 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 99.43 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 99.42 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 99.41 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 99.41 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 99.41 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 99.4 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 99.4 | |
| KOG0464|consensus | 753 | 99.4 | ||
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 99.39 | |
| KOG1143|consensus | 591 | 99.38 | ||
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 99.37 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 99.34 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 99.34 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 99.32 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 99.32 | |
| KOG0469|consensus | 842 | 99.31 | ||
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 99.28 | |
| KOG0461|consensus | 522 | 99.28 | ||
| KOG0052|consensus | 391 | 99.25 | ||
| cd01342 | 83 | Translation_Factor_II_like Translation_Factor_II_l | 99.21 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 99.19 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 99.18 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 99.18 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 99.17 | |
| PF03144 | 74 | GTP_EFTU_D2: Elongation factor Tu domain 2; InterP | 99.17 | |
| KOG1144|consensus | 1064 | 99.16 | ||
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 99.15 | |
| COG5257 | 415 | GCD11 Translation initiation factor 2, gamma subun | 99.14 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 99.12 | |
| KOG0462|consensus | 650 | 99.09 | ||
| PF14578 | 81 | GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 | 99.07 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 99.06 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 98.99 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 98.98 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 98.96 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 98.94 | |
| COG5258 | 527 | GTPBP1 GTPase [General function prediction only] | 98.93 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 98.92 | |
| COG2229 | 187 | Predicted GTPase [General function prediction only | 98.91 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 98.9 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 98.88 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 98.86 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 98.86 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 98.85 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 98.85 | |
| cd03690 | 85 | Tet_II Tet_II: This subfamily represents domain II | 98.85 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 98.84 | |
| KOG0466|consensus | 466 | 98.84 | ||
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 98.83 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 98.8 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 98.78 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 98.77 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 98.76 | |
| cd03691 | 86 | BipA_TypA_II BipA_TypA_II: domain II of BipA (also | 98.76 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 98.74 | |
| cd04092 | 83 | mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri | 98.73 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 98.72 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 98.71 | |
| cd04088 | 83 | EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen | 98.69 | |
| cd03699 | 86 | lepA_II lepA_II: This subfamily represents the dom | 98.68 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 98.67 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 98.65 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 98.64 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 98.64 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 98.64 | |
| KOG1143|consensus | 591 | 98.62 | ||
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 98.6 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 98.6 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 98.58 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 98.57 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 98.57 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 98.54 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 98.53 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 98.53 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 98.53 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 98.52 | |
| cd03689 | 85 | RF3_II RF3_II: this subfamily represents the domai | 98.52 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 98.52 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 98.52 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 98.51 | |
| TIGR00437 | 591 | feoB ferrous iron transporter FeoB. FeoB (773 amin | 98.5 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 98.5 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 98.5 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 98.49 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 98.48 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 98.47 | |
| cd04091 | 81 | mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri | 98.46 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 98.44 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 98.42 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 98.39 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 98.39 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 98.39 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 98.38 | |
| KOG0463|consensus | 641 | 98.38 | ||
| COG0218 | 200 | Predicted GTPase [General function prediction only | 98.38 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 98.38 | |
| KOG1423|consensus | 379 | 98.37 | ||
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 98.37 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 98.37 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 98.36 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 98.36 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 98.36 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 98.36 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 98.36 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 98.34 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 98.34 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 98.34 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 98.33 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 98.33 | |
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 98.31 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 98.31 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 98.3 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 98.29 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 98.28 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 98.28 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 98.28 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 98.26 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 98.26 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 98.26 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 98.26 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 98.25 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 98.23 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 98.23 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 98.22 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 98.21 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 98.2 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 98.19 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 98.19 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 98.17 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 98.17 | |
| cd03700 | 93 | eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami | 98.16 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 98.16 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 98.16 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 98.15 | |
| COG0480 | 697 | FusA Translation elongation factors (GTPases) [Tra | 98.13 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 98.12 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 98.11 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 98.1 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 98.1 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 98.09 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 98.08 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 98.07 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 98.07 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 98.07 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 98.05 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 98.05 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 98.04 | |
| smart00176 | 200 | RAN Ran (Ras-related nuclear proteins) /TC4 subfam | 98.04 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 98.04 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 98.04 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 98.03 | |
| PTZ00099 | 176 | rab6; Provisional | 98.03 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 98.02 | |
| PF00350 | 168 | Dynamin_N: Dynamin family; InterPro: IPR001401 Mem | 98.01 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 98.01 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 98.01 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 98.01 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 98.0 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 98.0 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 97.99 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 97.99 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 97.99 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 97.99 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 97.98 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 97.98 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 97.98 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 97.97 | |
| cd04090 | 94 | eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina | 97.97 | |
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 97.97 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 97.96 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 97.96 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 97.95 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 97.95 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 97.94 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 97.94 | |
| PLN03118 | 211 | Rab family protein; Provisional | 97.93 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 97.92 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 97.92 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 97.9 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 97.89 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 97.88 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 97.88 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 97.87 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 97.87 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 97.86 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 97.86 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 97.85 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 97.85 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 97.84 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 97.83 | |
| KOG1191|consensus | 531 | 97.83 | ||
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 97.83 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 97.8 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 97.8 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 97.79 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 97.76 | |
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 97.76 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 97.75 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 97.75 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 97.74 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 97.73 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 97.73 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 97.73 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 97.72 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 97.71 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 97.7 | |
| KOG0466|consensus | 466 | 97.69 | ||
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 97.62 | |
| PLN03108 | 210 | Rab family protein; Provisional | 97.59 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 97.57 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 97.56 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 97.54 | |
| PRK13768 | 253 | GTPase; Provisional | 97.52 | |
| cd04133 | 176 | Rop_like Rop subfamily. The Rop (Rho-related prote | 97.5 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 97.48 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 97.47 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 97.47 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 97.45 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 97.42 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 97.37 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 97.35 | |
| cd03702 | 95 | IF2_mtIF2_II This family represents the domain II | 97.33 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 97.31 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 97.3 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 97.3 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 97.3 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 97.29 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 97.28 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 97.28 | |
| COG0370 | 653 | FeoB Fe2+ transport system protein B [Inorganic io | 97.26 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 97.18 | |
| PLN00023 | 334 | GTP-binding protein; Provisional | 97.12 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 97.1 | |
| cd01896 | 233 | DRG The developmentally regulated GTP-binding prot | 97.09 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 97.02 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 97.02 | |
| KOG0090|consensus | 238 | 97.01 | ||
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 96.84 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 96.83 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 96.82 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 96.79 | |
| cd03111 | 106 | CpaE_like This protein family consists of proteins | 96.7 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 96.69 | |
| cd03701 | 95 | IF2_IF5B_II IF2_IF5B_II: This family represents th | 96.65 | |
| cd03703 | 110 | aeIF5B_II aeIF5B_II: This family represents the do | 96.59 | |
| TIGR02836 | 492 | spore_IV_A stage IV sporulation protein A. A compa | 96.58 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 96.56 | |
| KOG0465|consensus | 721 | 96.53 | ||
| cd01873 | 195 | RhoBTB RhoBTB subfamily. Members of the RhoBTB sub | 96.52 | |
| cd00066 | 317 | G-alpha G protein alpha subunit. The alpha subunit | 96.45 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 96.43 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 96.38 | |
| KOG0052|consensus | 391 | 96.29 | ||
| smart00275 | 342 | G_alpha G protein alpha subunit. Subunit of G prot | 96.24 | |
| PF04670 | 232 | Gtr1_RagA: Gtr1/RagA G protein conserved region; I | 96.24 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 96.21 | |
| KOG1954|consensus | 532 | 96.19 | ||
| KOG0078|consensus | 207 | 96.18 | ||
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 96.14 | |
| KOG0092|consensus | 200 | 96.12 | ||
| KOG0084|consensus | 205 | 96.0 | ||
| KOG0073|consensus | 185 | 95.99 | ||
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 95.99 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 95.94 | |
| PF06858 | 58 | NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte | 95.88 | |
| KOG0075|consensus | 186 | 95.8 | ||
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 95.74 | |
| cd02038 | 139 | FleN-like FleN is a member of the Fer4_NifH superf | 95.72 | |
| PF04548 | 212 | AIG1: AIG1 family; InterPro: IPR006703 This entry | 95.71 | |
| TIGR01007 | 204 | eps_fam capsular exopolysaccharide family. This mo | 95.69 | |
| KOG1144|consensus | 1064 | 95.69 | ||
| PTZ00258 | 390 | GTP-binding protein; Provisional | 95.46 | |
| KOG0094|consensus | 221 | 95.4 | ||
| TIGR01969 | 251 | minD_arch cell division ATPase MinD, archaeal. Thi | 95.37 | |
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 95.3 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 95.26 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 95.23 | |
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 95.23 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 95.22 | |
| KOG0469|consensus | 842 | 95.16 | ||
| TIGR01968 | 261 | minD_bact septum site-determining protein MinD. Th | 95.13 | |
| cd01900 | 274 | YchF YchF subfamily. YchF is a member of the Obg f | 95.12 | |
| KOG1489|consensus | 366 | 95.07 | ||
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 94.99 | |
| CHL00175 | 281 | minD septum-site determining protein; Validated | 94.98 | |
| KOG0087|consensus | 222 | 94.98 | ||
| PRK09601 | 364 | GTP-binding protein YchF; Reviewed | 94.91 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 94.82 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 94.78 | |
| KOG0070|consensus | 181 | 94.69 | ||
| PRK01889 | 356 | GTPase RsgA; Reviewed | 94.43 | |
| KOG0093|consensus | 193 | 94.39 | ||
| KOG2484|consensus | 435 | 94.33 | ||
| KOG1486|consensus | 364 | 94.26 | ||
| PRK12289 | 352 | GTPase RsgA; Reviewed | 94.18 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 94.16 | |
| KOG1532|consensus | 366 | 94.1 | ||
| COG4917 | 148 | EutP Ethanolamine utilization protein [Amino acid | 94.09 | |
| KOG0098|consensus | 216 | 94.09 | ||
| KOG0395|consensus | 196 | 94.03 | ||
| KOG0076|consensus | 197 | 93.99 | ||
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 93.78 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 93.76 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 93.76 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 93.68 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 93.61 | |
| PRK13849 | 231 | putative crown gall tumor protein VirC1; Provision | 93.6 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 93.11 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 93.07 | |
| KOG2486|consensus | 320 | 93.01 | ||
| KOG0082|consensus | 354 | 92.68 | ||
| KOG0095|consensus | 213 | 92.41 | ||
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 92.06 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 92.0 | |
| smart00785 | 83 | AARP2CN AARP2CN (NUC121) domain. This domain is th | 91.96 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 91.81 | |
| PF08142 | 85 | AARP2CN: AARP2CN (NUC121) domain; InterPro: IPR012 | 91.65 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 91.61 | |
| KOG0394|consensus | 210 | 91.56 | ||
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 91.42 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 91.39 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 91.38 | |
| KOG0080|consensus | 209 | 90.99 | ||
| KOG1424|consensus | 562 | 90.86 | ||
| TIGR03029 | 274 | EpsG chain length determinant protein tyrosine kin | 90.8 | |
| KOG0077|consensus | 193 | 90.78 | ||
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 90.74 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 90.28 | |
| PRK10818 | 270 | cell division inhibitor MinD; Provisional | 90.23 | |
| KOG2423|consensus | 572 | 90.22 | ||
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 90.14 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 90.11 | |
| cd01899 | 318 | Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg | 90.02 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 90.01 | |
| KOG0448|consensus | 749 | 89.95 | ||
| KOG0079|consensus | 198 | 89.82 | ||
| KOG1490|consensus | 620 | 89.75 | ||
| PRK14974 | 336 | cell division protein FtsY; Provisional | 89.72 | |
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 89.7 | |
| CHL00072 | 290 | chlL photochlorophyllide reductase subunit L | 89.5 | |
| KOG1145|consensus | 683 | 89.43 | ||
| PRK09602 | 396 | translation-associated GTPase; Reviewed | 89.34 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 89.28 | |
| PRK10037 | 250 | cell division protein; Provisional | 89.24 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 89.23 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 89.02 | |
| PF00503 | 389 | G-alpha: G-protein alpha subunit; InterPro: IPR001 | 88.98 | |
| COG0455 | 262 | flhG Antiactivator of flagellar biosynthesis FleN, | 88.46 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 87.91 | |
| PRK11670 | 369 | antiporter inner membrane protein; Provisional | 87.79 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 87.07 | |
| KOG0083|consensus | 192 | 86.2 | ||
| TIGR03371 | 246 | cellulose_yhjQ cellulose synthase operon protein Y | 85.87 | |
| PF10609 | 81 | ParA: ParA/MinD ATPase like; InterPro: IPR019591 T | 85.86 | |
| COG0536 | 369 | Obg Predicted GTPase [General function prediction | 85.29 | |
| PF00735 | 281 | Septin: Septin; InterPro: IPR000038 Septins consti | 85.24 | |
| KOG0086|consensus | 214 | 84.74 | ||
| PRK09841 | 726 | cryptic autophosphorylating protein tyrosine kinas | 84.43 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 84.4 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 84.25 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 84.0 | |
| PRK00090 | 222 | bioD dithiobiotin synthetase; Reviewed | 83.55 | |
| TIGR00347 | 166 | bioD dethiobiotin synthase. Dethiobiotin synthase | 82.96 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 82.92 | |
| KOG2485|consensus | 335 | 82.64 | ||
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 82.08 | |
| KOG0088|consensus | 218 | 81.93 | ||
| KOG0074|consensus | 185 | 81.88 | ||
| PRK11519 | 719 | tyrosine kinase; Provisional | 80.79 | |
| TIGR03018 | 207 | pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t | 80.68 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 80.65 |
| >KOG0460|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.2e-26 Score=186.00 Aligned_cols=133 Identities=58% Similarity=0.917 Sum_probs=119.3
Q ss_pred hHHHHHhhhCCCCCCCCCCCeeEEEeeEEeecCCcEEEEEEEEEEEEecCCEEEEeecCceeeEEEEEEEecceecceec
Q psy9646 2 ELLNQIDTYIPQPVRDLDKPFYLPVEHTYSIPGRGTVVTGRLERGIVKKGMECEFTGYGRQFKTTVTGIEMFHKILDEAQ 81 (211)
Q Consensus 2 ~ll~~l~~~i~~p~~~~~~p~~~~v~~~~~~~~~G~v~~G~v~~G~i~~g~~v~i~p~~~~~~~~v~~i~~~~~~~~~a~ 81 (211)
.|||++|+++|.|.|+.+.||.|||.++|.++|+|||++|+++.|.+|+||++.+...++..+..|+.||+|++.+++|.
T Consensus 235 kLldavDsyip~P~R~~~~pFl~pie~vfsI~GRGTVvtGrlERG~lKkG~e~eivG~~~~lkttvtgiemF~K~ld~a~ 314 (449)
T KOG0460|consen 235 KLLDAVDSYIPTPERDLDKPFLLPIEDVFSIPGRGTVVTGRLERGVLKKGDEVEIVGHNKTLKTTVTGIEMFRKSLDEAQ 314 (449)
T ss_pred HHHHHHhccCCCcccccCCCceeehhheeeecCCceEEEEEEeecccccCCEEEEeccCcceeeEeehHHHHHHHHHhcc
Confidence 69999999999999999999999999999999999999999999999999999998888778999999999999999999
Q ss_pred ccCceehhccCCCcccccccccccccchhhhhhhhcccccccccchhhcccceEE
Q psy9646 82 AGDQLGALVKGMKRDEVNRGLIMAKPVLADKKLAKVKQYADIDNAPEEKARGITI 136 (211)
Q Consensus 82 ~G~~v~~~l~~~~~~~v~~G~ii~~~~~~~~~~~~f~~~i~~~~~~~e~~rg~tv 136 (211)
|||++++++++++.++++||++++.+.. .....+|++.+++.+ +.|-+|...+
T Consensus 315 AGDn~G~LlRGik~~dvkRGmvl~~pGs-vk~~~k~ea~~YiLs-k~EGGR~~pf 367 (449)
T KOG0460|consen 315 AGDNLGALLRGIKREDVKRGMVLAKPGS-VKPHNKFEAQLYILS-KEEGGRHKPF 367 (449)
T ss_pred cccceehhhhcCCHHHHhcccEEecCCc-ccccceeeEEEEEEE-hhhCCCccch
Confidence 9999999999999999999999998875 555677887775543 4556665443
|
|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG5258 GTPBP1 GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) | Back alignment and domain information |
|---|
| >cd03694 GTPBP_II Domain II of the GP-1 family of GTPase | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu | Back alignment and domain information |
|---|
| >COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0460|consensus | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >KOG0459|consensus | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >KOG0458|consensus | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >KOG0458|consensus | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >KOG0463|consensus | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >KOG0462|consensus | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >KOG0461|consensus | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >KOG1145|consensus | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >KOG0459|consensus | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >KOG0465|consensus | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >KOG0467|consensus | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >KOG0468|consensus | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >KOG0464|consensus | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >KOG1143|consensus | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >KOG0469|consensus | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >KOG0461|consensus | Back alignment and domain information |
|---|
| >KOG0052|consensus | Back alignment and domain information |
|---|
| >cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] | Back alignment and domain information |
|---|
| >KOG1144|consensus | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >KOG0462|consensus | Back alignment and domain information |
|---|
| >PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >COG5258 GTPBP1 GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >COG2229 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >KOG0466|consensus | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >KOG1143|consensus | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >TIGR00437 feoB ferrous iron transporter FeoB | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >KOG0463|consensus | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >KOG1423|consensus | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >PTZ00099 rab6; Provisional | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >KOG1191|consensus | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >KOG0466|consensus | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04133 Rop_like Rop subfamily | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >PLN00023 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0090|consensus | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B | Back alignment and domain information |
|---|
| >cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B | Back alignment and domain information |
|---|
| >TIGR02836 spore_IV_A stage IV sporulation protein A | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >KOG0465|consensus | Back alignment and domain information |
|---|
| >cd01873 RhoBTB RhoBTB subfamily | Back alignment and domain information |
|---|
| >cd00066 G-alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >KOG0052|consensus | Back alignment and domain information |
|---|
| >smart00275 G_alpha G protein alpha subunit | Back alignment and domain information |
|---|
| >PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1954|consensus | Back alignment and domain information |
|---|
| >KOG0078|consensus | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >KOG0092|consensus | Back alignment and domain information |
|---|
| >KOG0084|consensus | Back alignment and domain information |
|---|
| >KOG0073|consensus | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) | Back alignment and domain information |
|---|
| >KOG0075|consensus | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria | Back alignment and domain information |
|---|
| >TIGR01007 eps_fam capsular exopolysaccharide family | Back alignment and domain information |
|---|
| >KOG1144|consensus | Back alignment and domain information |
|---|
| >PTZ00258 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0094|consensus | Back alignment and domain information |
|---|
| >TIGR01969 minD_arch cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >KOG0469|consensus | Back alignment and domain information |
|---|
| >TIGR01968 minD_bact septum site-determining protein MinD | Back alignment and domain information |
|---|
| >cd01900 YchF YchF subfamily | Back alignment and domain information |
|---|
| >KOG1489|consensus | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >CHL00175 minD septum-site determining protein; Validated | Back alignment and domain information |
|---|
| >KOG0087|consensus | Back alignment and domain information |
|---|
| >PRK09601 GTP-binding protein YchF; Reviewed | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >KOG0070|consensus | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >KOG0093|consensus | Back alignment and domain information |
|---|
| >KOG2484|consensus | Back alignment and domain information |
|---|
| >KOG1486|consensus | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >KOG1532|consensus | Back alignment and domain information |
|---|
| >COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0098|consensus | Back alignment and domain information |
|---|
| >KOG0395|consensus | Back alignment and domain information |
|---|
| >KOG0076|consensus | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK13849 putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >KOG2486|consensus | Back alignment and domain information |
|---|
| >KOG0082|consensus | Back alignment and domain information |
|---|
| >KOG0095|consensus | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00785 AARP2CN AARP2CN (NUC121) domain | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF08142 AARP2CN: AARP2CN (NUC121) domain; InterPro: IPR012948 This domain is the central domain of AARP2 (asparagine and aspartate rich protein 2) | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >KOG0394|consensus | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >KOG0080|consensus | Back alignment and domain information |
|---|
| >KOG1424|consensus | Back alignment and domain information |
|---|
| >TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG | Back alignment and domain information |
|---|
| >KOG0077|consensus | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >PRK10818 cell division inhibitor MinD; Provisional | Back alignment and domain information |
|---|
| >KOG2423|consensus | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >cd01899 Ygr210 Ygr210 subfamily | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0448|consensus | Back alignment and domain information |
|---|
| >KOG0079|consensus | Back alignment and domain information |
|---|
| >KOG1490|consensus | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >CHL00072 chlL photochlorophyllide reductase subunit L | Back alignment and domain information |
|---|
| >KOG1145|consensus | Back alignment and domain information |
|---|
| >PRK09602 translation-associated GTPase; Reviewed | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10037 cell division protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] | Back alignment and domain information |
|---|
| >COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >PRK11670 antiporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG0083|consensus | Back alignment and domain information |
|---|
| >TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >PF10609 ParA: ParA/MinD ATPase like; InterPro: IPR019591 This entry represents ATPases involved in plasmid partitioning [] | Back alignment and domain information |
|---|
| >COG0536 Obg Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] | Back alignment and domain information |
|---|
| >KOG0086|consensus | Back alignment and domain information |
|---|
| >PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK00090 bioD dithiobiotin synthetase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00347 bioD dethiobiotin synthase | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG2485|consensus | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >KOG0088|consensus | Back alignment and domain information |
|---|
| >KOG0074|consensus | Back alignment and domain information |
|---|
| >PRK11519 tyrosine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 211 | ||||
| 1d2e_A | 397 | Crystal Structure Of Mitochondrial Ef-Tu In Complex | 7e-42 | ||
| 2wrn_Z | 406 | The Crystal Structure Of The 70s Ribosome Bound To | 6e-41 | ||
| 1aip_A | 405 | Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt | 6e-41 | ||
| 2y0y_Z | 405 | The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bo | 6e-41 | ||
| 2c78_A | 405 | Ef-Tu Complexed With A Gtp Analog And The Antibioti | 6e-41 | ||
| 1eft_A | 405 | The Crystal Structure Of Elongation Factor Ef-Tu Fr | 6e-41 | ||
| 4abr_Z | 405 | Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kir | 6e-41 | ||
| 1ttt_A | 405 | Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Com | 6e-41 | ||
| 1exm_A | 405 | Crystal Structure Of Thermus Thermophilus Elongatio | 6e-41 | ||
| 2y0u_Z | 405 | The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bou | 7e-41 | ||
| 2c77_A | 405 | Ef-Tu Complexed With A Gtp Analog And The Antibioti | 7e-41 | ||
| 1xb2_A | 409 | Crystal Structure Of Bos Taurus Mitochondrial Elong | 2e-40 | ||
| 3mmp_A | 678 | Structure Of The Qb Replicase, An Rna-Dependent Rna | 2e-39 | ||
| 3agp_A | 1289 | Structure Of Viral Polymerase Form I Length = 1289 | 2e-39 | ||
| 1efc_A | 393 | Intact Elongation Factor From E.Coli Length = 393 | 2e-39 | ||
| 1dg1_G | 394 | Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Len | 2e-39 | ||
| 1d8t_A | 393 | Crystal Structure Of Elongation Factor, Tu (Ef-Tu-M | 2e-39 | ||
| 1ob2_A | 393 | E. Coli Elongation Factor Ef-Tu Complexed With The | 2e-39 | ||
| 3u6b_A | 394 | Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 | 2e-39 | ||
| 1efu_A | 385 | Elongation Factor Complex Ef-TuEF-Ts From Escherich | 3e-39 | ||
| 1mj1_A | 405 | Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIB | 4e-39 | ||
| 1efm_A | 379 | Structure Of The Gdp Domain Of Ef-Tu And Location O | 2e-33 | ||
| 2hdn_B | 335 | Trypsin-Modified Elongation Factor Tu In Complex Wi | 2e-32 | ||
| 2hcj_B | 335 | "trypsin-Modified Elongation Factor Tu In Complex W | 3e-31 | ||
| 2hcj_B | 335 | "trypsin-Modified Elongation Factor Tu In Complex W | 4e-31 | ||
| 3agj_A | 437 | Crystal Structure Of Archaeal Pelota And Gtp-bound | 9e-19 | ||
| 3vmf_A | 440 | Archaeal Protein Length = 440 | 1e-18 | ||
| 1jny_A | 435 | Crystal Structure Of Sulfolobus Solfataricus Elonga | 1e-18 | ||
| 1f60_A | 458 | Crystal Structure Of The Yeast Elongation Factor Co | 5e-16 | ||
| 3j2k_7 | 439 | Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associ | 1e-15 | ||
| 1r5b_A | 467 | Crystal Structure Analysis Of Sup35 Length = 467 | 1e-15 | ||
| 3mca_A | 592 | Structure Of The Dom34-Hbs1 Complex And Implication | 1e-14 | ||
| 3p26_A | 483 | Crystal Structure Of S. Cerevisiae Hbs1 Protein (Ap | 2e-14 | ||
| 3izq_1 | 611 | Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To | 3e-14 | ||
| 3p27_A | 483 | Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gd | 9e-14 | ||
| 1zun_B | 434 | Crystal Structure Of A Gtp-Regulated Atp Sulfurylas | 2e-13 | ||
| 4ac9_A | 482 | Crystal Structure Of Translation Elongation Factor | 2e-11 | ||
| 3j25_A | 638 | Structural Basis For Tetm-Mediated Tetracycline Res | 2e-10 | ||
| 1kjz_A | 410 | Structure Of The Large Gamma Subunit Of Initiation | 2e-10 | ||
| 1kk3_A | 410 | Structure Of The Wild-Type Large Gamma Subunit Of I | 2e-10 | ||
| 2d74_A | 419 | Crystal Structure Of Translation Initiation Factor | 2e-10 | ||
| 2pmd_A | 415 | The Structures Of Aif2gamma Subunit From The Archae | 1e-09 | ||
| 2aho_A | 414 | Structure Of The Archaeal Initiation Factor Eif2 Al | 1e-09 | ||
| 3pen_A | 403 | Structure Of Archaeal Initiation Factor Aif2gamma S | 1e-09 | ||
| 3sjz_A | 409 | The Structure Of Aif2gamma Subunit Delta 41-45 From | 1e-09 | ||
| 1s0u_A | 408 | Eif2gamma Apo Length = 408 | 1e-09 | ||
| 1kk0_A | 410 | Structure Of The Large Gamma Subunit Of Initiation | 4e-08 | ||
| 2lkc_A | 178 | Free B.St If2-G2 Length = 178 | 1e-06 | ||
| 3vqt_A | 548 | Crystal Structure Analysis Of The Translation Facto | 1e-06 | ||
| 1zo1_I | 501 | If2, If1, And Trna Fitted To Cryo-Em Data Of E. Col | 5e-06 | ||
| 2p8w_S | 35 | Fitted Structure Of Eef2 In The 80s:eef2:gdpnp Cryo | 8e-06 | ||
| 3tr5_A | 528 | Structure Of A Peptide Chain Release Factor 3 (Prfc | 1e-05 | ||
| 2bm0_A | 691 | Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R | 2e-05 | ||
| 2h5e_A | 529 | Crystal Structure Of E.Coli Polypeptide Release Fac | 2e-05 | ||
| 3uoq_W | 534 | Crystal Structure Of Release Factor Rf3 Trapped In | 3e-05 | ||
| 2bv3_A | 691 | Crystal Structure Of A Mutant Elongation Factor G T | 3e-05 | ||
| 2j7k_A | 691 | Crystal Structure Of The T84a Mutant Ef-G:gdpcp Com | 3e-05 | ||
| 4fn5_A | 709 | Elongation Factor G 1 (Pseudomonas Aeruginosa) In C | 3e-05 | ||
| 2bm1_A | 691 | Ribosomal Elongation Factor G (Ef-G) Fusidic Acid R | 3e-05 | ||
| 1ktv_A | 691 | Crystal Structure Of Elongation Factor G Dimer With | 3e-05 | ||
| 1efg_A | 691 | The Crystal Structure Of Elongation Factor G Comple | 3e-05 | ||
| 1fnm_A | 691 | Structure Of Thermus Thermophilus Ef-G H573a Length | 3e-05 | ||
| 3izp_E | 688 | Conformation Of Ef-G During Translocation Length = | 3e-05 | ||
| 3izy_P | 537 | Mammalian Mitochondrial Translation Initiation Fact | 2e-04 | ||
| 3zz0_A | 693 | Crystal Structure Of Ribosomal Elongation Factor (E | 3e-04 | ||
| 2xex_A | 693 | Crystal Structure Of Staphylococcus Aureus Elongati | 3e-04 | ||
| 2rdo_7 | 704 | 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = | 6e-04 | ||
| 3j0e_H | 702 | Models For The T. Thermophilus Ribosome Recycling F | 6e-04 |
| >pdb|1D2E|A Chain A, Crystal Structure Of Mitochondrial Ef-Tu In Complex With Gdp Length = 397 | Back alignment and structure |
|
| >pdb|2WRN|Z Chain Z, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu And Trna (Part 1 Of 4). Length = 406 | Back alignment and structure |
| >pdb|1AIP|A Chain A, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 405 | Back alignment and structure |
| >pdb|2Y0Y|Z Chain Z, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 | Back alignment and structure |
| >pdb|2C78|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Pulvomycin Length = 405 | Back alignment and structure |
| >pdb|1EFT|A Chain A, The Crystal Structure Of Elongation Factor Ef-Tu From Thermus Aquaticus In The Gtp Conformation Length = 405 | Back alignment and structure |
| >pdb|4ABR|Z Chain Z, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin With The 70s Ribosome Length = 405 | Back alignment and structure |
| >pdb|1TTT|A Chain A, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex Length = 405 | Back alignment and structure |
| >pdb|1EXM|A Chain A, Crystal Structure Of Thermus Thermophilus Elongation Factor Tu (Ef-Tu) In Complex With The Gtp Analogue Gppnhp. Length = 405 | Back alignment and structure |
| >pdb|2Y0U|Z Chain Z, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 | Back alignment and structure |
| >pdb|2C77|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Ge2270 A Length = 405 | Back alignment and structure |
| >pdb|1XB2|A Chain A, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 409 | Back alignment and structure |
| >pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 | Back alignment and structure |
| >pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 | Back alignment and structure |
| >pdb|1EFC|A Chain A, Intact Elongation Factor From E.Coli Length = 393 | Back alignment and structure |
| >pdb|1DG1|G Chain G, Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Length = 394 | Back alignment and structure |
| >pdb|1D8T|A Chain A, Crystal Structure Of Elongation Factor, Tu (Ef-Tu-Mggdp) Complexed With Ge2270a, A Thiazolyl Peptide Antibiotic Length = 393 | Back alignment and structure |
| >pdb|1OB2|A Chain A, E. Coli Elongation Factor Ef-Tu Complexed With The Antibiotic Kirromycin, A Gtp Analog, And Phe-Trna Length = 393 | Back alignment and structure |
| >pdb|3U6B|A Chain A, Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 Length = 394 | Back alignment and structure |
| >pdb|1EFU|A Chain A, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 385 | Back alignment and structure |
| >pdb|1MJ1|A Chain A, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL PROTEINS Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome Length = 405 | Back alignment and structure |
| >pdb|1EFM|A Chain A, Structure Of The Gdp Domain Of Ef-Tu And Location Of The Amino Acids Homologous To Ras Oncogene Proteins Length = 379 | Back alignment and structure |
| >pdb|2HDN|B Chain B, Trypsin-Modified Elongation Factor Tu In Complex With Tetracycline At 2.8 Angstrom Resolution Length = 335 | Back alignment and structure |
| >pdb|2HCJ|B Chain B, "trypsin-Modified Elongation Factor Tu In Complex With Tetracycline" Length = 335 | Back alignment and structure |
| >pdb|2HCJ|B Chain B, "trypsin-Modified Elongation Factor Tu In Complex With Tetracycline" Length = 335 | Back alignment and structure |
| >pdb|3AGJ|A Chain A, Crystal Structure Of Archaeal Pelota And Gtp-bound Ef1 Alpha Complex Length = 437 | Back alignment and structure |
| >pdb|3VMF|A Chain A, Archaeal Protein Length = 440 | Back alignment and structure |
| >pdb|1JNY|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Elongation Factor 1 Alpha In Complex With Gdp Length = 435 | Back alignment and structure |
| >pdb|1F60|A Chain A, Crystal Structure Of The Yeast Elongation Factor Complex Eef1a:eef1ba Length = 458 | Back alignment and structure |
| >pdb|3J2K|7 Chain 7, Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associated Termination Complex Length = 439 | Back alignment and structure |
| >pdb|1R5B|A Chain A, Crystal Structure Analysis Of Sup35 Length = 467 | Back alignment and structure |
| >pdb|3MCA|A Chain A, Structure Of The Dom34-Hbs1 Complex And Implications For Its Role In No-Go Decay Length = 592 | Back alignment and structure |
| >pdb|3P26|A Chain A, Crystal Structure Of S. Cerevisiae Hbs1 Protein (Apo-Form), A Translational Gtpase Involved In Rna Quality Control Pathways And Interacting With Dom34PELOTA Length = 483 | Back alignment and structure |
| >pdb|3IZQ|1 Chain 1, Structure Of The Dom34-Hbs1-Gdpnp Complex Bound To A Translating Ribosome Length = 611 | Back alignment and structure |
| >pdb|3P27|A Chain A, Crystal Structure Of S. Cerevisiae Hbs1 Protein (Gdp-Bound Form), A Translational Gtpase Involved In Rna Quality Control Pathways And Interacting With Dom34PELOTA Length = 483 | Back alignment and structure |
| >pdb|1ZUN|B Chain B, Crystal Structure Of A Gtp-Regulated Atp Sulfurylase Heterodimer From Pseudomonas Syringae Length = 434 | Back alignment and structure |
| >pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 | Back alignment and structure |
| >pdb|3J25|A Chain A, Structural Basis For Tetm-Mediated Tetracycline Resistance Length = 638 | Back alignment and structure |
| >pdb|1KJZ|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi-G235d Mutant Length = 410 | Back alignment and structure |
| >pdb|1KK3|A Chain A, Structure Of The Wild-Type Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Complexed With Gdp-Mg2+ Length = 410 | Back alignment and structure |
| >pdb|2D74|A Chain A, Crystal Structure Of Translation Initiation Factor Aif2betagamma Heterodimer Length = 419 | Back alignment and structure |
| >pdb|2PMD|A Chain A, The Structures Of Aif2gamma Subunit From The Archaeon Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 415 | Back alignment and structure |
| >pdb|2AHO|A Chain A, Structure Of The Archaeal Initiation Factor Eif2 Alpha- Gamma Heterodimer From Sulfolobus Solfataricus Complexed With Gdpnp Length = 414 | Back alignment and structure |
| >pdb|3PEN|A Chain A, Structure Of Archaeal Initiation Factor Aif2gamma Subunit Delta 37-47 From Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 403 | Back alignment and structure |
| >pdb|3SJZ|A Chain A, The Structure Of Aif2gamma Subunit Delta 41-45 From Archaeon Sulfolobus Solfataricus Complexed With Gdp And Gdpnp Length = 409 | Back alignment and structure |
| >pdb|1S0U|A Chain A, Eif2gamma Apo Length = 408 | Back alignment and structure |
| >pdb|1KK0|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Length = 410 | Back alignment and structure |
| >pdb|2LKC|A Chain A, Free B.St If2-G2 Length = 178 | Back alignment and structure |
| >pdb|3VQT|A Chain A, Crystal Structure Analysis Of The Translation Factor Rf3 Length = 548 | Back alignment and structure |
| >pdb|1ZO1|I Chain I, If2, If1, And Trna Fitted To Cryo-Em Data Of E. Coli 70s Initiation Complex Length = 501 | Back alignment and structure |
| >pdb|2P8W|S Chain S, Fitted Structure Of Eef2 In The 80s:eef2:gdpnp Cryo-Em Reconstruction Length = 35 | Back alignment and structure |
| >pdb|3TR5|A Chain A, Structure Of A Peptide Chain Release Factor 3 (Prfc) From Coxiella Burnetii Length = 528 | Back alignment and structure |
| >pdb|2BM0|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant T84a Length = 691 | Back alignment and structure |
| >pdb|2H5E|A Chain A, Crystal Structure Of E.Coli Polypeptide Release Factor Rf3 Length = 529 | Back alignment and structure |
| >pdb|3UOQ|W Chain W, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp State On A Rotated Conformation Of The Ribosome (Without Viomycin) Length = 534 | Back alignment and structure |
| >pdb|2BV3|A Chain A, Crystal Structure Of A Mutant Elongation Factor G Trapped With A Gtp Analogue Length = 691 | Back alignment and structure |
| >pdb|2J7K|A Chain A, Crystal Structure Of The T84a Mutant Ef-G:gdpcp Complex Length = 691 | Back alignment and structure |
| >pdb|4FN5|A Chain A, Elongation Factor G 1 (Pseudomonas Aeruginosa) In Complex With Argyrin B Length = 709 | Back alignment and structure |
| >pdb|2BM1|A Chain A, Ribosomal Elongation Factor G (Ef-G) Fusidic Acid Resistant Mutant G16v Length = 691 | Back alignment and structure |
| >pdb|1KTV|A Chain A, Crystal Structure Of Elongation Factor G Dimer Without Nucleotide Length = 691 | Back alignment and structure |
| >pdb|1EFG|A Chain A, The Crystal Structure Of Elongation Factor G Complexed With Gdp, At 2.7 Angstroms Resolution Length = 691 | Back alignment and structure |
| >pdb|1FNM|A Chain A, Structure Of Thermus Thermophilus Ef-G H573a Length = 691 | Back alignment and structure |
| >pdb|3IZP|E Chain E, Conformation Of Ef-G During Translocation Length = 688 | Back alignment and structure |
| >pdb|3IZY|P Chain P, Mammalian Mitochondrial Translation Initiation Factor 2 Length = 537 | Back alignment and structure |
| >pdb|3ZZ0|A Chain A, Crystal Structure Of Ribosomal Elongation Factor (Ef)-G From Staphylococcus Aureus With A Fusidic Acid Hyper-Sensitivity Mutation M16i Length = 693 | Back alignment and structure |
| >pdb|2XEX|A Chain A, Crystal Structure Of Staphylococcus Aureus Elongation Factor G Length = 693 | Back alignment and structure |
| >pdb|2RDO|7 Chain 7, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound Length = 704 | Back alignment and structure |
| >pdb|3J0E|H Chain H, Models For The T. Thermophilus Ribosome Recycling Factor And The E. Coli Elongation Factor G Bound To The E. Coli Post-Termination Complex Length = 702 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 211 | |||
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 7e-76 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 2e-57 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 3e-73 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 2e-54 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 9e-73 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 3e-55 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 1e-58 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 1e-43 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 5e-55 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 1e-30 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 2e-54 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 1e-45 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 6e-50 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 2e-31 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 7e-49 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 9e-32 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 2e-34 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 9e-17 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 5e-34 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 1e-16 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 6e-34 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 4e-19 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 4e-33 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 1e-17 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 1e-31 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 4e-23 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 4e-28 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 2e-22 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 4e-26 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 6e-04 | |
| 1xe1_A | 116 | Hypothetical protein PF0907; structural genomics, | 5e-25 | |
| 3e1y_E | 204 | Eukaryotic peptide chain release factor GTP-bindi | 5e-17 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 8e-11 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 2e-09 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 1e-08 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 1e-08 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 2e-08 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 8e-07 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 2e-05 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 3e-04 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 6e-04 |
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Length = 397 | Back alignment and structure |
|---|
Score = 232 bits (594), Expect = 7e-76
Identities = 75/103 (72%), Positives = 90/103 (87%)
Query: 108 VLADKKLAKVKQYADIDNAPEEKARGITINVAHVEYATENRHYSHTDCPGHADYIKNMIT 167
+LA+ AK K+Y +IDNAPEE+ARGITIN AHVEY+T RHY+HTDCPGHADY+KNMIT
Sbjct: 26 ILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMIT 85
Query: 168 GTSQMDGAILVVAATDGAMPQTREHLLLAKQIGVTNIVVFINK 210
GT+ +DG ILVVAA DG MPQTREHLLLA+QIGV ++VV++NK
Sbjct: 86 GTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNK 128
|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Length = 397 | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Length = 405 | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Length = 405 | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 | Back alignment and structure |
|---|
| >1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Length = 116 | Back alignment and structure |
|---|
| >3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Length = 178 | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Length = 842 | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Length = 501 | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Length = 537 | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Length = 665 | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Length = 528 | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Length = 529 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| 3e1y_E | 204 | Eukaryotic peptide chain release factor GTP-bindi | 99.89 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 99.87 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 99.84 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 99.84 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 99.84 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 99.84 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 99.83 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 99.83 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 99.81 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 99.8 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 99.79 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 99.79 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 99.78 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 99.77 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 99.76 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 99.75 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 99.75 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 99.74 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 99.73 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 99.71 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 99.7 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 99.61 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 99.59 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 99.58 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 99.58 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 99.58 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 99.57 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 99.55 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 99.55 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 99.54 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 99.54 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 99.51 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 99.5 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 99.49 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 99.48 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 99.46 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 99.46 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 99.46 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 99.45 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 99.42 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 99.41 | |
| 1xe1_A | 116 | Hypothetical protein PF0907; structural genomics, | 99.4 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 99.33 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 99.33 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 99.31 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 99.3 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 99.23 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 99.23 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 99.22 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 99.19 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 99.12 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 99.08 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 99.08 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 98.99 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 98.98 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 98.97 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 98.95 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 98.92 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 98.91 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 98.89 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 98.89 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 98.88 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 98.87 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 98.87 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 98.86 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 98.86 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 98.82 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 98.81 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 98.78 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 98.74 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 98.73 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 98.72 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 98.71 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 98.66 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 98.62 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 98.62 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 98.61 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 98.6 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 98.6 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 98.6 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 98.59 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 98.59 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 98.59 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 98.58 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 98.58 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 98.55 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 98.54 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 98.54 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 98.54 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 98.53 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 98.52 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 98.52 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 98.51 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 98.51 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 98.5 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 98.5 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 98.5 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 98.49 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 98.49 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 98.49 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 98.49 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 98.49 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 98.47 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 98.47 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 98.47 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 98.47 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 98.46 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 98.46 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 98.45 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 98.45 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 98.45 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 98.44 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 98.44 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 98.44 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 98.44 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 98.43 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 98.43 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 98.43 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 98.43 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 98.43 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 98.42 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 98.42 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 98.41 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 98.41 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 98.41 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 98.41 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 98.4 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 98.4 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 98.4 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 98.39 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 98.39 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 98.39 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 98.39 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 98.39 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 98.38 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 98.37 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 98.36 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 98.36 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 98.35 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 98.35 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 98.35 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 98.33 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 98.33 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 98.33 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 98.32 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 98.32 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 98.31 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 98.31 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 98.31 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 98.31 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 98.3 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 98.3 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 98.3 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 98.3 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 98.29 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 98.29 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 98.29 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 98.29 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 98.28 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 98.28 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 98.27 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 98.26 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 98.26 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 98.25 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 98.23 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 98.22 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 98.21 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 98.21 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 98.21 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 98.19 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 98.19 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 98.19 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 98.17 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 98.16 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 98.15 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 98.13 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 98.12 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 98.11 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 98.11 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 98.1 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 98.1 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 98.1 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 98.09 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 98.09 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 98.08 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 98.08 | |
| 1d1n_A | 99 | Initiation factor 2; beta-barrel, gene regulation; | 98.07 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 98.06 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 98.06 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 98.05 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 98.05 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 98.05 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 98.02 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 98.02 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 98.01 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 98.0 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 97.24 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 97.97 | |
| 2crv_A | 120 | IF-2MT, translation initiation factor IF-2; riboso | 97.97 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 97.96 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 97.96 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.86 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 97.86 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 97.83 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 97.79 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 97.78 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 97.77 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 97.73 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 97.71 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 97.7 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 97.7 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 97.66 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 97.65 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 97.62 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 97.6 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 97.51 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 97.49 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 97.44 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 97.41 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 97.39 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.35 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 97.28 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 97.24 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 97.23 | |
| 4fid_A | 340 | G protein alpha subunit; RAS-like domain, all-heli | 97.13 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 97.05 | |
| 3r7w_B | 331 | Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT | 97.05 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 97.03 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 96.87 | |
| 3ohm_A | 327 | Guanine nucleotide-binding protein G(Q) subunit A; | 96.75 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.62 | |
| 2xtz_A | 354 | Guanine nucleotide-binding protein alpha-1 subuni; | 96.52 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 96.48 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 96.37 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 96.32 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 96.19 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.1 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 95.98 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 95.83 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 95.76 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 95.73 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 95.7 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 95.46 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 95.44 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 95.36 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 95.3 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 95.25 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 95.21 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 95.01 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 95.0 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 94.93 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 94.54 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 94.51 | |
| 3la6_A | 286 | Tyrosine-protein kinase WZC; P-loop protein, nucle | 94.48 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 94.36 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 94.23 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 94.2 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 94.01 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 94.01 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 93.66 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 93.61 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 93.28 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 92.99 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 92.59 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 92.5 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 92.42 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 91.97 | |
| 1wcv_1 | 257 | SOJ, segregation protein; ATPase, bacterial, chrom | 91.84 | |
| 4he6_A | 89 | Peptidase family U32; ultra-tight crystal packing, | 91.64 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 91.41 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 90.91 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 90.18 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 89.69 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 87.03 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 86.67 | |
| 1byi_A | 224 | Dethiobiotin synthase; biotin synthesis, cyclo-lig | 86.47 | |
| 3l82_B | 227 | F-box only protein 4; TRFH domain, helix, GTPase d | 86.39 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 86.22 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 86.08 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 85.63 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 85.12 | |
| 2xj4_A | 286 | MIPZ; replication, cell division, ATPase, WACA; 1. | 84.67 | |
| 2woj_A | 354 | ATPase GET3; tail-anchored, membrane protein, targ | 83.42 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 82.45 | |
| 3ez9_A | 403 | Para; DNA binding, winged-HTH, partition, biosynth | 82.32 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 81.49 |
| >3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.89 E-value=9.1e-24 Score=162.97 Aligned_cols=124 Identities=23% Similarity=0.284 Sum_probs=105.2
Q ss_pred CCCCCeeEEEeeEEeecCCcEEEEEEEEEEEEecCCEEEEeecCceeeEEEEEEEecceecceecccCceehhccCCCcc
Q psy9646 17 DLDKPFYLPVEHTYSIPGRGTVVTGRLERGIVKKGMECEFTGYGRQFKTTVTGIEMFHKILDEAQAGDQLGALVKGMKRD 96 (211)
Q Consensus 17 ~~~~p~~~~v~~~~~~~~~G~v~~G~v~~G~i~~g~~v~i~p~~~~~~~~v~~i~~~~~~~~~a~~G~~v~~~l~~~~~~ 96 (211)
+.++||||||+++|+ +.|++++|+|++|.+++||+|.++|++. +++|++|+++++++++|.|||+|+++|++++..
T Consensus 2 ~~~~p~rl~v~~v~~--g~G~v~~G~v~~G~i~~Gd~v~i~P~~~--~~~V~~I~~~~~~~~~A~aGd~V~l~L~gi~~~ 77 (204)
T 3e1y_E 2 PLGSPIRLPIVDKYK--DMGTVVLGKLESGSICKGQQLVMMPNKH--NVEVLGILSDDVETDTVAPGENLKIRLKGIEEE 77 (204)
T ss_dssp -----CBEEEEEEEE--SSSEEEEEECCBSCEESSCCEEETTTTE--EEEEEEECSSSSCBSEECTTSEEEEEEEESSSS
T ss_pred CCCCCEEEEEEEEEc--CCCEEEEEEEecCEEECCCEEEECCCCC--EEEEEEEEECCEEeEEECCCCEEEEEEcCCCHH
Confidence 357899999999998 7999999999999999999999999974 899999999999999999999999999999999
Q ss_pred cccccccccccchhhhhhhhcccccccccchhhcccceEEeEeEEEee
Q psy9646 97 EVNRGLIMAKPVLADKKLAKVKQYADIDNAPEEKARGITINVAHVEYA 144 (211)
Q Consensus 97 ~v~~G~ii~~~~~~~~~~~~f~~~i~~~~~~~e~~rg~tv~~~~~~~~ 144 (211)
+++||++++++..++.....|.+.+....++.....|+...+++++..
T Consensus 78 di~rG~vl~~~~~~~~~~~~f~a~v~~l~~~~~i~~g~~~~l~~~t~~ 125 (204)
T 3e1y_E 78 EILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCI 125 (204)
T ss_dssp CCCTTCEEBCSSSCCCCCSEEEEEEECCSCCSCCCTTEEEEEESSSCE
T ss_pred HCccceEEECCCCCCchhEEEEEEEEEeCCCCccCCCceEEEEEeCCE
Confidence 999999999988777778889998876666656667777766554443
|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >1d1n_A Initiation factor 2; beta-barrel, gene regulation; NMR {Geobacillus stearothermophilus} SCOP: b.43.3.1 | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >2crv_A IF-2MT, translation initiation factor IF-2; ribosome, beta barrel, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* | Back alignment and structure |
|---|
| >4he6_A Peptidase family U32; ultra-tight crystal packing, unknown function; 1.10A {Geobacillus thermoleovorans} PDB: 4he5_A | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A | Back alignment and structure |
|---|
| >3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A | Back alignment and structure |
|---|
| >2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 211 | ||||
| d2c78a3 | 204 | c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N | 2e-41 | |
| d1f60a3 | 239 | c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N | 7e-36 | |
| d1d2ea1 | 98 | b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), | 3e-34 | |
| d1efca1 | 92 | b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), | 6e-34 | |
| d1d2ea3 | 196 | c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), | 4e-32 | |
| d2c78a1 | 100 | b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), | 2e-31 | |
| d1wb1a1 | 92 | b.43.3.1 (A:180-271) Elongation factor SelB, domai | 4e-27 | |
| d1f60a1 | 94 | b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, | 1e-26 | |
| d1jnya3 | 224 | c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N | 4e-26 | |
| d1jnya1 | 95 | b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, | 1e-24 | |
| d1r5ba1 | 95 | b.43.3.1 (A:460-554) Eukaryotic peptide chain rele | 5e-22 | |
| d1kk1a1 | 121 | b.43.3.1 (A:201-321) Initiation factor eIF2 gamma | 2e-20 | |
| d2bv3a2 | 276 | c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t | 3e-19 | |
| d1xe1a_ | 91 | b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococ | 6e-19 | |
| d1s0ua1 | 118 | b.43.3.1 (A:230-347) Initiation factor eIF2 gamma | 7e-19 | |
| d1zunb3 | 222 | c.37.1.8 (B:16-237) Sulfate adenylate transferase | 3e-17 | |
| d2qn6a1 | 114 | b.43.3.1 (A:207-320) Initiation factor eIF2 gamma | 9e-17 | |
| d1zunb1 | 92 | b.43.3.1 (B:238-329) Sulfate adenylate transferase | 7e-15 | |
| d1n0ua2 | 341 | c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- | 1e-13 | |
| d1r5ba3 | 245 | c.37.1.8 (A:215-459) Eukaryotic peptide chain rele | 6e-13 | |
| d2qn6a3 | 205 | c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su | 5e-08 | |
| d1g7sa2 | 128 | b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, | 1e-05 | |
| d2dy1a2 | 267 | c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-t | 3e-05 | |
| d1g7sa4 | 227 | c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- | 0.002 |
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Elongation factor Tu (EF-Tu), N-terminal (G) domain species: Thermus thermophilus [TaxId: 274]
Score = 137 bits (346), Expect = 2e-41
Identities = 75/101 (74%), Positives = 84/101 (83%)
Query: 110 ADKKLAKVKQYADIDNAPEEKARGITINVAHVEYATENRHYSHTDCPGHADYIKNMITGT 169
A+ +VK Y DID APEE+ARGITIN AHVEY T RHYSH DCPGHADYIKNMITG
Sbjct: 29 AENPNVEVKDYGDIDKAPEERARGITINTAHVEYETAKRHYSHVDCPGHADYIKNMITGA 88
Query: 170 SQMDGAILVVAATDGAMPQTREHLLLAKQIGVTNIVVFINK 210
+QMDGAILVV+A DG MPQTREH+LLA+Q+GV IVVF+NK
Sbjct: 89 AQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFMNK 129
|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 | Back information, alignment and structure |
|---|
| >d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Length = 92 | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 | Back information, alignment and structure |
|---|
| >d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Length = 100 | Back information, alignment and structure |
|---|
| >d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Length = 92 | Back information, alignment and structure |
|---|
| >d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 94 | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 | Back information, alignment and structure |
|---|
| >d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 95 | Back information, alignment and structure |
|---|
| >d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 95 | Back information, alignment and structure |
|---|
| >d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 121 | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 | Back information, alignment and structure |
|---|
| >d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Length = 91 | Back information, alignment and structure |
|---|
| >d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 118 | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 | Back information, alignment and structure |
|---|
| >d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Length = 114 | Back information, alignment and structure |
|---|
| >d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 92 | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 | Back information, alignment and structure |
|---|
| >d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 128 | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Length = 267 | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 211 | |||
| d1f60a1 | 94 | Elongation factor eEF-1alpha, domain 2 {Baker's ye | 99.94 | |
| d1efca1 | 92 | Elongation factor Tu (EF-Tu), domain 2 {Escherichi | 99.93 | |
| d1d2ea1 | 98 | Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t | 99.93 | |
| d2c78a1 | 100 | Elongation factor Tu (EF-Tu), domain 2 {Thermus th | 99.93 | |
| d1jnya1 | 95 | Elongation factor eEF-1alpha, domain 2 {Archaeon S | 99.92 | |
| d1wb1a1 | 92 | Elongation factor SelB, domains 2 and 4 {Methanoco | 99.91 | |
| d1kk1a1 | 121 | Initiation factor eIF2 gamma subunit, domain II {A | 99.9 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.88 | |
| d1xe1a_ | 91 | Hypothetical protein PF0907 {Pyrococcus furiosus [ | 99.88 | |
| d1r5ba1 | 95 | Eukaryotic peptide chain release factor ERF2, post | 99.88 | |
| d1zunb1 | 92 | Sulfate adenylate transferase subunit cysN/C, EF-T | 99.87 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 99.87 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 99.87 | |
| d1s0ua1 | 118 | Initiation factor eIF2 gamma subunit, domain II {A | 99.86 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 99.81 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 99.8 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 99.8 | |
| d2qn6a1 | 114 | Initiation factor eIF2 gamma subunit, domain II {S | 99.79 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 99.79 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 99.73 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 99.73 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 99.62 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 99.58 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 99.57 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 99.46 | |
| d1g7sa2 | 128 | Initiation factor IF2/eIF5b, domains 2 and 4 {Arch | 99.41 | |
| d2bv3a1 | 121 | Elongation factor G (EF-G), domain II {Thermus the | 99.27 | |
| d2dy1a1 | 103 | Elongation factor G (EF-G), domain II {Thermus the | 99.25 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 99.01 | |
| d1n0ua1 | 138 | Elongation factor 2 (eEF-2), domain II {Baker's ye | 98.95 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 98.76 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 98.7 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 98.67 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 98.44 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 98.28 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 98.28 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 98.19 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.05 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 98.03 | |
| d1d1na_ | 99 | Initiation factor IF2/eIF5b, domains 2 and 4 {Baci | 98.03 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 98.02 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 98.02 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 97.99 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 97.92 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 97.91 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 97.9 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 97.89 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 97.85 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 97.85 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 97.68 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 97.67 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 97.66 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 97.6 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 97.58 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 97.58 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 97.54 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 97.54 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 97.53 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 97.52 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 97.52 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 97.5 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 97.44 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 97.38 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.33 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 97.33 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.32 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 97.3 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 97.26 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 97.25 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 97.19 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 97.16 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 97.14 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 97.12 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 97.12 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 97.08 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 97.07 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 97.04 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 97.02 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 97.01 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 96.99 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 96.94 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 96.9 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 96.9 | |
| d1g7sa1 | 101 | Initiation factor IF2/eIF5b, domains 2 and 4 {Arch | 96.86 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 96.8 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 96.8 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 96.77 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 96.74 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 96.48 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 96.4 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 95.9 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 95.64 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 95.62 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 95.53 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 95.36 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 94.99 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 94.35 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.34 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 94.2 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 93.83 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.79 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 93.73 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 92.92 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 92.89 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 90.71 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 90.57 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 90.08 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 89.72 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 89.11 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 86.24 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 86.15 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 83.19 |
| >d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Reductase/isomerase/elongation factor common domain superfamily: Translation proteins family: Elongation factors domain: Elongation factor eEF-1alpha, domain 2 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.94 E-value=3.2e-27 Score=157.88 Aligned_cols=90 Identities=38% Similarity=0.637 Sum_probs=85.7
Q ss_pred CCCeeEEEeeEEeecCCcEEEEEEEEEEEEecCCEEEEeecCceeeEEEEEEEecceecceecccCceehhccCCCcccc
Q psy9646 19 DKPFYLPVEHTYSIPGRGTVVTGRLERGIVKKGMECEFTGYGRQFKTTVTGIEMFHKILDEAQAGDQLGALVKGMKRDEV 98 (211)
Q Consensus 19 ~~p~~~~v~~~~~~~~~G~v~~G~v~~G~i~~g~~v~i~p~~~~~~~~v~~i~~~~~~~~~a~~G~~v~~~l~~~~~~~v 98 (211)
|+||||||+++|++++.|++++|+|++|.+++||++.++|++. +++|++|+++++++++|.+||+|+++|++.+.+++
T Consensus 1 dkP~rmpI~~vf~i~g~GtVvtG~v~~G~i~~Gd~v~i~P~~~--~~~VksI~~~~~~~~~a~aG~~v~l~l~~i~~~~i 78 (94)
T d1f60a1 1 DKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGV--TTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEI 78 (94)
T ss_dssp TSCCEEEEEEEEEETTTEEEEEEECCBSCBCTTCEEEEETTTE--EEEEEEEEETTEECSCBCTTCEEEEEESSCCTTTS
T ss_pred CCCEEEEEEEEEEeCCeeEEEEEeeecccCCCCCEEEECcCCc--eEEEEEEEEcCcCcCEecCCCeEEEEEeCccHHhc
Confidence 6899999999999999999999999999999999999999975 89999999999999999999999999999999999
Q ss_pred cccccccccchh
Q psy9646 99 NRGLIMAKPVLA 110 (211)
Q Consensus 99 ~~G~ii~~~~~~ 110 (211)
+||++++++..+
T Consensus 79 ~rG~vl~~~~~~ 90 (94)
T d1f60a1 79 RRGNVCGDAKND 90 (94)
T ss_dssp CTTCEEEETTSS
T ss_pred CCCCEEECCCCC
Confidence 999999976544
|
| >d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|