Psyllid ID: psy9687
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 141 | ||||||
| 195450244 | 2116 | GK22329 [Drosophila willistoni] gi|19416 | 0.914 | 0.060 | 0.623 | 4e-41 | |
| 328709399 | 2180 | PREDICTED: protein crumbs-like isoform 4 | 0.921 | 0.059 | 0.625 | 5e-41 | |
| 328709397 | 2180 | PREDICTED: protein crumbs-like isoform 3 | 0.921 | 0.059 | 0.625 | 5e-41 | |
| 328709395 | 2304 | PREDICTED: protein crumbs-like isoform 2 | 0.921 | 0.056 | 0.625 | 6e-41 | |
| 328709393 | 2304 | PREDICTED: protein crumbs-like isoform 1 | 0.921 | 0.056 | 0.625 | 6e-41 | |
| 270002371 | 2162 | hypothetical protein TcasGA2_TC004424 [T | 0.914 | 0.059 | 0.646 | 2e-40 | |
| 91076648 | 2134 | PREDICTED: similar to crumbs CG6383-PA [ | 0.914 | 0.060 | 0.646 | 2e-40 | |
| 195504849 | 2296 | GE23470 [Drosophila yakuba] gi|194185356 | 0.914 | 0.056 | 0.6 | 6e-40 | |
| 194909783 | 2188 | GG11278 [Drosophila erecta] gi|190656646 | 0.914 | 0.058 | 0.592 | 8e-40 | |
| 195573441 | 2287 | GD21088 [Drosophila simulans] gi|1942006 | 0.914 | 0.056 | 0.584 | 2e-39 |
| >gi|195450244|ref|XP_002072428.1| GK22329 [Drosophila willistoni] gi|194168513|gb|EDW83414.1| GK22329 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Score = 172 bits (436), Expect = 4e-41, Method: Compositional matrix adjust.
Identities = 81/130 (62%), Positives = 96/130 (73%)
Query: 11 RLCETNIDDCESGPCLNGGLCKDLLNNYTCNCQQTGYTGPHCEINIDDCAPNPCKNGARC 70
R+C+ +IDDC S PCLN G C D L + C+C TGY G +CE+NID+C NPC NGA+C
Sbjct: 725 RICDIDIDDCVSAPCLNSGKCIDELGGFHCDCSGTGYEGKNCELNIDECISNPCTNGAQC 784
Query: 71 VDKVKDYLCECYPGYTGKTCADDIKECESNPCQYGGTCLEHSNMSLYQRSDLPALPKIFA 130
VD+VKDYLCEC+PGYTGK C DI ECESNPCQY CLE SNM+LYQ S LPK+F+
Sbjct: 785 VDQVKDYLCECHPGYTGKNCDQDINECESNPCQYNSNCLERSNMTLYQLSKFMDLPKVFS 844
Query: 131 QEFNYSTAEG 140
Q F+Y A G
Sbjct: 845 QPFSYENASG 854
|
Source: Drosophila willistoni Species: Drosophila willistoni Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328709399|ref|XP_003243948.1| PREDICTED: protein crumbs-like isoform 4 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328709397|ref|XP_003243947.1| PREDICTED: protein crumbs-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328709395|ref|XP_003243946.1| PREDICTED: protein crumbs-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328709393|ref|XP_001950069.2| PREDICTED: protein crumbs-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|270002371|gb|EEZ98818.1| hypothetical protein TcasGA2_TC004424 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91076648|ref|XP_970640.1| PREDICTED: similar to crumbs CG6383-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195504849|ref|XP_002099255.1| GE23470 [Drosophila yakuba] gi|194185356|gb|EDW98967.1| GE23470 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194909783|ref|XP_001982008.1| GG11278 [Drosophila erecta] gi|190656646|gb|EDV53878.1| GG11278 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195573441|ref|XP_002104702.1| GD21088 [Drosophila simulans] gi|194200629|gb|EDX14205.1| GD21088 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 141 | ||||||
| FB|FBgn0259685 | 2146 | crb "crumbs" [Drosophila melan | 0.921 | 0.060 | 0.576 | 3.2e-43 | |
| UNIPROTKB|F1P3N1 | 1259 | Gga.53999 "Uncharacterized pro | 0.865 | 0.096 | 0.460 | 3.2e-31 | |
| UNIPROTKB|E2QZC0 | 376 | CRB1 "Uncharacterized protein" | 0.822 | 0.308 | 0.5 | 2.3e-30 | |
| UNIPROTKB|F5H0L2 | 1382 | CRB1 "Protein crumbs homolog 1 | 0.865 | 0.088 | 0.484 | 1.5e-29 | |
| UNIPROTKB|P82279 | 1406 | CRB1 "Protein crumbs homolog 1 | 0.865 | 0.086 | 0.484 | 1.5e-29 | |
| UNIPROTKB|I3LVI7 | 504 | NOTCH2 "Uncharacterized protei | 0.836 | 0.234 | 0.5 | 2.3e-29 | |
| UNIPROTKB|F1NRS3 | 728 | DLL1 "Delta-like protein" [Gal | 0.709 | 0.137 | 0.554 | 2.5e-29 | |
| ZFIN|ZDB-GENE-000329-4 | 2475 | notch2 "notch homolog 2" [Dani | 0.709 | 0.040 | 0.549 | 2.6e-29 | |
| ZFIN|ZDB-GENE-060612-1 | 1466 | crb2a "crumbs homolog 2a" [Dan | 0.836 | 0.080 | 0.460 | 2.7e-29 | |
| MGI|MGI:2136343 | 1405 | Crb1 "crumbs homolog 1 (Drosop | 0.822 | 0.082 | 0.5 | 3.2e-29 |
| FB|FBgn0259685 crb "crumbs" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 472 (171.2 bits), Expect = 3.2e-43, P = 3.2e-43
Identities = 75/130 (57%), Positives = 95/130 (73%)
Query: 11 RLCETNIDDCESGPCLNGGLCKDLLNNYTCNCQQTGYTGPHCEINIDDCAPNPCKNGARC 70
R+C+ +IDDC PCLNGG C D L + C+C TGY G +CE+NID+C NPC NGA+C
Sbjct: 756 RICDIDIDDCVGDPCLNGGQCIDQLGGFRCDCSGTGYEGENCELNIDECLSNPCTNGAKC 815
Query: 71 VDKVKDYLCECYPGYTGKTCADDIKECESNPCQYGGTCLEHSNMSLYQRSDLPALPKIFA 130
+D+VKDY C+C+ GY GK C DI ECESNPCQY G CLE SN++LYQ S + LPK+F+
Sbjct: 816 LDRVKDYFCDCHNGYKGKNCEQDINECESNPCQYNGNCLERSNITLYQMSRITDLPKVFS 875
Query: 131 QEFNYSTAEG 140
Q F++ A G
Sbjct: 876 QPFSFENASG 885
|
|
| UNIPROTKB|F1P3N1 Gga.53999 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZC0 CRB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5H0L2 CRB1 "Protein crumbs homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P82279 CRB1 "Protein crumbs homolog 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LVI7 NOTCH2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NRS3 DLL1 "Delta-like protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-000329-4 notch2 "notch homolog 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060612-1 crb2a "crumbs homolog 2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2136343 Crb1 "crumbs homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 141 | |||
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 2e-07 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 5e-06 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 5e-06 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 2e-04 | |
| pfam00008 | 32 | pfam00008, EGF, EGF-like domain | 5e-04 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 0.002 |
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
Score = 44.2 bits (105), Expect = 2e-07
Identities = 21/37 (56%), Positives = 26/37 (70%), Gaps = 1/37 (2%)
Query: 55 NIDDCA-PNPCKNGARCVDKVKDYLCECYPGYTGKTC 90
+ID+CA NPC+NG CV+ V Y C C PGYTG+ C
Sbjct: 1 DIDECASGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
|
Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements. Length = 38 |
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|215652 pfam00008, EGF, EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 141 | |||
| KOG1219|consensus | 4289 | 99.64 | ||
| KOG1219|consensus | 4289 | 99.34 | ||
| KOG4289|consensus | 2531 | 99.28 | ||
| KOG4289|consensus | 2531 | 99.08 | ||
| KOG1214|consensus | 1289 | 99.03 | ||
| KOG1217|consensus | 487 | 98.26 | ||
| KOG1225|consensus | 525 | 98.06 | ||
| KOG1217|consensus | 487 | 97.99 | ||
| KOG1214|consensus | 1289 | 97.98 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.91 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.91 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.84 | |
| KOG1225|consensus | 525 | 97.82 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.75 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.74 | |
| KOG4260|consensus | 350 | 97.72 | ||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 97.72 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.56 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.43 | |
| KOG4260|consensus | 350 | 97.26 | ||
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.88 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.85 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.84 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.82 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 96.46 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 96.21 | |
| KOG1226|consensus | 783 | 95.92 | ||
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 95.75 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 95.32 | |
| KOG1226|consensus | 783 | 94.51 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 93.4 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 93.07 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 92.16 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 91.99 | |
| KOG3516|consensus | 1306 | 90.41 | ||
| KOG3514|consensus | 1591 | 88.79 | ||
| PF12946 | 37 | EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 | 86.62 | |
| KOG3516|consensus | 1306 | 84.8 | ||
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 83.37 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 80.45 |
| >KOG1219|consensus | Back alignment and domain information |
|---|
Probab=99.64 E-value=1e-15 Score=122.43 Aligned_cols=104 Identities=38% Similarity=0.956 Sum_probs=96.4
Q ss_pred CCCCCCCCCCCCEEeecC-CceeEecCCCCccCCCCCcCCCcCcCCCCCCCCEEeeCCCCeeecCCCCCCCCCCCCC-CC
Q psy9687 18 DDCESGPCLNGGLCKDLL-NNYTCNCQQTGYTGPHCEINIDDCAPNPCKNGARCVDKVKDYLCECYPGYTGKTCADD-IK 95 (141)
Q Consensus 18 ~~c~~~~c~~~~~C~~~~-g~~~c~c~~~g~~g~~c~~~~~~c~~~~c~~~~~c~~~~~~~~c~C~~g~~~~~c~~~-~~ 95 (141)
+.|..+||.+++.|..+. +.|.|.|. +.|.|++|+.++..|..+||..++.|....++|.|.|+.||+|.+|+.+ ++
T Consensus 3865 d~C~~npCqhgG~C~~~~~ggy~CkCp-sqysG~~CEi~~epC~snPC~~GgtCip~~n~f~CnC~~gyTG~~Ce~~Gi~ 3943 (4289)
T KOG1219|consen 3865 DPCNDNPCQHGGTCISQPKGGYKCKCP-SQYSGNHCEIDLEPCASNPCLTGGTCIPFYNGFLCNCPNGYTGKRCEARGIS 3943 (4289)
T ss_pred cccccCcccCCCEecCCCCCceEEeCc-ccccCcccccccccccCCCCCCCCEEEecCCCeeEeCCCCccCceeeccccc
Confidence 789999999999998875 56999999 5999999998999999999999999999999999999999999999988 89
Q ss_pred CCcCCCCCCCCEEeecCCCcceecCCC
Q psy9687 96 ECESNPCQYGGTCLEHSNMSLYQRSDL 122 (141)
Q Consensus 96 ~c~~~~c~~~~~C~~~~~~~~~~~~~~ 122 (141)
+|+.++|.+++.|++..+++.|.|.+.
T Consensus 3944 eCs~n~C~~gg~C~n~~gsf~CncT~g 3970 (4289)
T KOG1219|consen 3944 ECSKNVCGTGGQCINIPGSFHCNCTPG 3970 (4289)
T ss_pred ccccccccCCceeeccCCceEeccChh
Confidence 999999999999999999998888643
|
|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
| >PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein | Back alignment and domain information |
|---|
| >KOG3516|consensus | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 141 | ||||
| 2vj3_A | 135 | Human Notch-1 Egfs 11-13 Length = 135 | 1e-18 | ||
| 1toz_A | 116 | Nmr Structure Of The Human Notch-1 Ligand Binding R | 3e-18 | ||
| 4d90_A | 143 | Crystal Structure Of Del-1 Egf Domains Length = 143 | 2e-09 | ||
| 1x7a_L | 146 | Porcine Factor Ixa Complexed To 1-{3-[amino(Imino) | 4e-07 | ||
| 1pfx_L | 146 | Porcine Factor Ixa Length = 146 | 2e-06 | ||
| 1nfu_B | 195 | Crystal Structure Of Human Coagulation Factor Xa Co | 3e-05 | ||
| 2h9e_L | 149 | Crystal Structure Of FxaSELECTIDENAPC2 TERNARY COMP | 4e-05 | ||
| 3h5c_B | 317 | X-Ray Structure Of Protein Z-Protein Z Inhibitor Co | 5e-05 | ||
| 3qcw_A | 1245 | Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), | 1e-04 | ||
| 3r05_A | 1254 | Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), | 1e-04 | ||
| 1ht5_A | 551 | The 2.75 Angstrom Resolution Model Of Ovine Cox-1 C | 1e-04 | ||
| 1ezq_B | 134 | Crystal Structure Of Human Coagulation Factor Xa Co | 1e-04 | ||
| 1ebv_A | 551 | Ovine Pghs-1 Complexed With Salicyl Hydroxamic Acid | 1e-04 | ||
| 1prh_A | 554 | The X-Ray Crystal Structure Of The Membrane Protein | 1e-04 | ||
| 1o5d_L | 152 | Dissecting And Designing Inhibitor Selectivity Dete | 1e-04 | ||
| 1u67_A | 600 | Crystal Structure Of Arachidonic Acid Bound To A Mu | 2e-04 | ||
| 1pth_A | 576 | The Structural Basis Of Aspirin Activity Inferred F | 2e-04 | ||
| 3n8y_B | 553 | Structure Of Aspirin Acetylated Cyclooxygenase-1 In | 2e-04 | ||
| 2oye_P | 600 | Indomethacin-(r)-alpha-ethyl-ethanolamide Bound To | 2e-04 | ||
| 1diy_A | 553 | Crystal Structure Of Arachidonic Acid Bound In The | 2e-04 | ||
| 1pge_A | 576 | Prostaglandin H2 Synthase-1 Complexed With P-(2'-Io | 2e-04 | ||
| 3n8w_B | 553 | Crystal Structure Of R120qNATIVE CYCLOOXYGENASE-1 H | 2e-04 | ||
| 1cqe_A | 580 | Prostaglandin H2 Synthase-1 Complex With Flurbiprof | 2e-04 | ||
| 3poy_A | 1019 | Crystal Structure Of The Alpha-Neurexin-1 Ectodomai | 2e-04 | ||
| 1bf9_A | 41 | N-Terminal Egf-Like Domain From Human Factor Vii, N | 2e-04 | ||
| 1f7e_A | 46 | The First Egf-Like Domain From Human Blood Coagulat | 2e-04 | ||
| 1z6j_L | 142 | Crystal Structure Of A Ternary Complex Of Factor Vi | 2e-04 | ||
| 1w0y_L | 142 | Tf7a_3771 Complex Length = 142 | 2e-04 | ||
| 1dan_L | 152 | Complex Of Active Site Inhibited Human Blood Coagul | 2e-04 | ||
| 1p0s_L | 138 | Crystal Structure Of Blood Coagulation Factor Xa In | 2e-04 | ||
| 1edm_B | 39 | Epidermal Growth Factor-Like Domain From Human Fact | 2e-04 | ||
| 1dva_L | 101 | Crystal Structure Of The Complex Between The Peptid | 2e-04 | ||
| 1j9c_L | 95 | Crystal Structure Of Tissue Factor-Factor Viia Comp | 2e-04 | ||
| 2rqz_A | 38 | Structure Of Sugar Modified Epidermal Growth Factor | 3e-04 | ||
| 1fax_L | 96 | Coagulation Factor Xa Inhibitor Complex Length = 96 | 4e-04 | ||
| 1g2l_B | 94 | Factor Xa Inhibitor Complex Length = 94 | 4e-04 | ||
| 1ioe_L | 96 | Human Coagulation Factor Xa In Complex With M55532 | 4e-04 | ||
| 3ens_A | 94 | Crystal Structure Of Human Fxa In Complex With Meth | 4e-04 | ||
| 1apo_A | 42 | Three-Dimensional Structure Of The Apo Form Of The | 8e-04 | ||
| 2puq_L | 94 | Crystal Structure Of Active Site Inhibited Coagulat | 9e-04 |
| >pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 | Back alignment and structure |
|
| >pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 | Back alignment and structure |
| >pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 | Back alignment and structure |
| >pdb|1X7A|L Chain L, Porcine Factor Ixa Complexed To 1-{3-[amino(Imino) Methyl]phenyl}-N-[4-(1h-Benzimidazol-1-Yl)-2- Fluorophenyl]- 3-(Trifluoromethyl)-1h-Pyrazole-5-Carboxamide Length = 146 | Back alignment and structure |
| >pdb|1PFX|L Chain L, Porcine Factor Ixa Length = 146 | Back alignment and structure |
| >pdb|1NFU|B Chain B, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr132747 Length = 195 | Back alignment and structure |
| >pdb|2H9E|L Chain L, Crystal Structure Of FxaSELECTIDENAPC2 TERNARY COMPLEX Length = 149 | Back alignment and structure |
| >pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 | Back alignment and structure |
| >pdb|3QCW|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), No Splice Inserts Length = 1245 | Back alignment and structure |
| >pdb|3R05|A Chain A, Structure Of Neurexin 1 Alpha (Domains Lns1-Lns6), With Splice Insert Ss3 Length = 1254 | Back alignment and structure |
| >pdb|1HT5|A Chain A, The 2.75 Angstrom Resolution Model Of Ovine Cox-1 Complexed With Methyl Ester Flurbiprofen Length = 551 | Back alignment and structure |
| >pdb|1EZQ|B Chain B, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 134 | Back alignment and structure |
| >pdb|1EBV|A Chain A, Ovine Pghs-1 Complexed With Salicyl Hydroxamic Acid Length = 551 | Back alignment and structure |
| >pdb|1PRH|A Chain A, The X-Ray Crystal Structure Of The Membrane Protein Prostaglandin H2 Synthase-1 Length = 554 | Back alignment and structure |
| >pdb|1O5D|L Chain L, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 152 | Back alignment and structure |
| >pdb|1U67|A Chain A, Crystal Structure Of Arachidonic Acid Bound To A Mutant Of Prostagladin H Synthase-1 That Forms Predominantly 11-hpete Length = 600 | Back alignment and structure |
| >pdb|1PTH|A Chain A, The Structural Basis Of Aspirin Activity Inferred From The Crystal Structure Of Inactivated Prostaglandin H2 Synthase Length = 576 | Back alignment and structure |
| >pdb|3N8Y|B Chain B, Structure Of Aspirin Acetylated Cyclooxygenase-1 In Complex With Diclofenac Length = 553 | Back alignment and structure |
| >pdb|2OYE|P Chain P, Indomethacin-(r)-alpha-ethyl-ethanolamide Bound To Cyclooxygenase-1 Length = 600 | Back alignment and structure |
| >pdb|1DIY|A Chain A, Crystal Structure Of Arachidonic Acid Bound In The Cyclooxygenase Active Site Of Pghs-1 Length = 553 | Back alignment and structure |
| >pdb|1PGE|A Chain A, Prostaglandin H2 Synthase-1 Complexed With P-(2'-Iodo-5'-Thenoyl) Hydrotropic Acid (Iodosuprofen) Length = 576 | Back alignment and structure |
| >pdb|3N8W|B Chain B, Crystal Structure Of R120qNATIVE CYCLOOXYGENASE-1 Heterodimer Mutant In Complex With Flurbiprofen Length = 553 | Back alignment and structure |
| >pdb|1CQE|A Chain A, Prostaglandin H2 Synthase-1 Complex With Flurbiprofen Length = 580 | Back alignment and structure |
| >pdb|3POY|A Chain A, Crystal Structure Of The Alpha-Neurexin-1 Ectodomain, Lns 2-6 Length = 1019 | Back alignment and structure |
| >pdb|1BF9|A Chain A, N-Terminal Egf-Like Domain From Human Factor Vii, Nmr, 23 Structures Length = 41 | Back alignment and structure |
| >pdb|1F7E|A Chain A, The First Egf-Like Domain From Human Blood Coagulation Fvii, Nmr, 20 Structures Length = 46 | Back alignment and structure |
| >pdb|1Z6J|L Chain L, Crystal Structure Of A Ternary Complex Of Factor Viia/tissue Factor/pyrazinone Inhibitor Length = 142 | Back alignment and structure |
| >pdb|1W0Y|L Chain L, Tf7a_3771 Complex Length = 142 | Back alignment and structure |
| >pdb|1DAN|L Chain L, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 152 | Back alignment and structure |
| >pdb|1P0S|L Chain L, Crystal Structure Of Blood Coagulation Factor Xa In Complex With Ecotin M84r Length = 138 | Back alignment and structure |
| >pdb|1EDM|B Chain B, Epidermal Growth Factor-Like Domain From Human Factor Ix Length = 39 | Back alignment and structure |
| >pdb|1DVA|L Chain L, Crystal Structure Of The Complex Between The Peptide Exosite Inhibitor E-76 And Coagulation Factor Viia Length = 101 | Back alignment and structure |
| >pdb|1J9C|L Chain L, Crystal Structure Of Tissue Factor-Factor Viia Complex Length = 95 | Back alignment and structure |
| >pdb|2RQZ|A Chain A, Structure Of Sugar Modified Epidermal Growth Factor-Like Repeat 12 Of Mouse Notch-1 Receptor Length = 38 | Back alignment and structure |
| >pdb|1FAX|L Chain L, Coagulation Factor Xa Inhibitor Complex Length = 96 | Back alignment and structure |
| >pdb|1G2L|B Chain B, Factor Xa Inhibitor Complex Length = 94 | Back alignment and structure |
| >pdb|1IOE|L Chain L, Human Coagulation Factor Xa In Complex With M55532 Length = 96 | Back alignment and structure |
| >pdb|3ENS|A Chain A, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1- (2-oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 94 | Back alignment and structure |
| >pdb|1APO|A Chain A, Three-Dimensional Structure Of The Apo Form Of The N- Terminal Egf-Like Module Of Blood Coagulation Factor X As Determined By Nmr Spectroscopy And Simulated Folding Length = 42 | Back alignment and structure |
| >pdb|2PUQ|L Chain L, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia In Complex With Soluble Tissue Factor Length = 94 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 141 | |||
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 2e-36 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 3e-36 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 7e-19 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 5e-34 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 8e-20 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 1e-15 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 9e-33 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 1e-24 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 8e-16 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 3e-30 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 7e-22 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 4e-13 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 2e-29 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 2e-26 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 1e-19 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 8e-16 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 4e-28 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 5e-28 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 9e-25 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 3e-11 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 6e-09 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 3e-16 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 3e-16 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 3e-14 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 4e-14 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 1e-12 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 1e-07 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 2e-05 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 4e-16 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 4e-14 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 6e-13 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 2e-11 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 2e-05 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 1e-04 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 2e-14 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 2e-09 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 3e-09 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 4e-08 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 7e-08 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 4e-13 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 7e-12 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 2e-11 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 3e-09 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 2e-04 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 3e-11 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 4e-11 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 8e-11 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 5e-09 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 5e-07 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 2e-10 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 2e-08 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 3e-04 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 8e-04 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 4e-09 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 4e-08 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 3e-07 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 3e-06 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 1e-08 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 1e-05 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 3e-04 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 6e-04 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 2e-07 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 2e-06 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 2e-05 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 1e-06 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 1e-04 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 2e-06 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 2e-06 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 4e-05 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 1e-04 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 1e-04 | |
| 3nxp_A | 424 | Prethrombin-1; allostery, blood coagulation, hydro | 1e-04 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 1e-04 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 8e-04 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 2e-04 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 2e-04 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 2e-04 | |
| 2f83_A | 625 | Coagulation factor XI; protease, apple domain, hyd | 4e-04 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 4e-04 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 5e-04 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 5e-04 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 5e-04 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 8e-04 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 9e-04 |
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
Score = 120 bits (304), Expect = 2e-36
Identities = 42/100 (42%), Positives = 64/100 (64%), Gaps = 3/100 (3%)
Query: 16 NIDDCE--SGPCLNGGLCKDLLNNYTCNCQQTGYTGPHCEINIDDCAPNPCKNGARCVDK 73
++D+C + PC + G C + L ++ C C Q GYTGP CEI++++C NPC+N A C+D+
Sbjct: 4 DVDECSLGANPCEHAGKCINTLGSFECQCLQ-GYTGPRCEIDVNECVSNPCQNDATCLDQ 62
Query: 74 VKDYLCECYPGYTGKTCADDIKECESNPCQYGGTCLEHSN 113
+ ++ C C PGY G C + EC S+PC + G CL+ N
Sbjct: 63 IGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKIN 102
|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 141 | |||
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.82 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.75 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.75 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.65 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.62 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.58 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.46 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.42 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.42 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.4 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 99.39 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 99.32 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 99.32 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.31 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.31 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 99.29 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 99.27 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 99.23 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.22 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 99.19 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.17 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 99.14 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 99.13 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 99.12 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 99.09 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 99.08 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.07 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.98 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.95 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.91 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.9 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.88 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.87 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.86 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 98.86 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.86 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 98.82 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 98.82 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.81 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.8 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.78 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.75 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.73 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.73 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 98.72 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.66 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 98.65 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 98.64 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.61 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.58 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.55 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.49 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.44 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.42 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.28 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.27 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 98.26 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.24 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.22 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.18 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.15 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.15 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.13 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 98.1 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.08 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.07 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.03 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 97.98 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 97.98 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.98 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.97 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 97.93 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 97.88 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 97.79 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 97.48 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 97.47 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.43 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.24 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 97.23 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 96.95 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 96.94 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.88 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 96.81 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 96.8 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 96.78 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 96.77 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.73 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 96.66 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 96.56 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 96.48 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 96.43 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 96.36 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 96.32 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 96.31 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 96.26 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 96.24 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 96.07 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 96.0 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 95.89 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 95.8 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 95.77 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 95.73 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 95.71 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 95.69 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 95.46 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 95.43 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 95.43 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 95.41 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 95.38 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 95.35 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 95.24 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 94.96 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 94.86 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 94.84 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 94.71 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 94.6 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 94.54 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 94.28 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 94.24 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 93.14 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 93.13 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 93.01 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 92.91 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 92.63 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 92.16 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 92.16 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 92.01 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 91.46 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 91.3 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 91.27 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 90.82 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 90.05 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 89.99 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 85.73 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 85.68 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 81.63 |
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
Probab=99.82 E-value=1.7e-19 Score=110.27 Aligned_cols=107 Identities=39% Similarity=1.021 Sum_probs=97.3
Q ss_pred ccCCCC--CCCCCCCCEEeecCCceeEecCCCCccCCCCCcCCCcCcCCCCCCCCEEeeCCCCeeecCCCCCCCCCCCCC
Q psy9687 16 NIDDCE--SGPCLNGGLCKDLLNNYTCNCQQTGYTGPHCEINIDDCAPNPCKNGARCVDKVKDYLCECYPGYTGKTCADD 93 (141)
Q Consensus 16 ~~~~c~--~~~c~~~~~C~~~~g~~~c~c~~~g~~g~~c~~~~~~c~~~~c~~~~~c~~~~~~~~c~C~~g~~~~~c~~~ 93 (141)
++++|. ..||.+++.|.+..++|.|.|.+ ||.|..|+.++++|...+|..++.|++..+.|.|.|++||.|..|+.+
T Consensus 4 dideC~~~~~~C~~~g~C~~~~g~~~C~C~~-Gy~G~~C~~~~~~C~~~~C~~~~~C~~~~g~~~C~C~~G~~G~~C~~~ 82 (135)
T 2vj3_A 4 DVDECSLGANPCEHAGKCINTLGSFECQCLQ-GYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVN 82 (135)
T ss_dssp CCCTTTSSSCSSSTTCEEEECSSSEEEECCT-TEESTTSCEECCTTTTCCCCSSCEEEECSSCEEEECCTTEESSSSCEE
T ss_pred ccccccCCCCCCCCCCEeECCCCCEEEECCC-CCcCCcccccCccCCCCCCCCCCEEeCCCCCceeeCCCCCcCCcceec
Confidence 789998 67899999999999999999995 999999976788999889999999999999999999999999999778
Q ss_pred CCCCcCCCCCCCCEEeecCCCcceecCCCC
Q psy9687 94 IKECESNPCQYGGTCLEHSNMSLYQRSDLP 123 (141)
Q Consensus 94 ~~~c~~~~c~~~~~C~~~~~~~~~~~~~~~ 123 (141)
+++|...+|.++++|++..+.+.|.|...+
T Consensus 83 ~~~C~~~~C~~~g~C~~~~g~~~C~C~~G~ 112 (135)
T 2vj3_A 83 TDECASSPCLHNGRCLDKINEFQCECPTGF 112 (135)
T ss_dssp CCTTTTCCSTTTCEEEECSSCEEEECCTTE
T ss_pred CCcccCCCcCCCCEeECCCCCeEEECCCCC
Confidence 999999999999999999999999886443
|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 141 | ||||
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 2e-10 | |
| d2vj3a2 | 39 | g.3.11.1 (A:453-491) Neurogenic locus notch homolo | 7e-10 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 2e-10 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 4e-10 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 4e-10 | |
| d1xkba1 | 39 | g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu | 5e-09 | |
| d1haea_ | 63 | g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu | 2e-09 | |
| d1haea_ | 63 | g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu | 9e-09 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 3e-09 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 6e-09 | |
| d1q4ga2 | 42 | g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG | 6e-09 | |
| d1q4ga2 | 42 | g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG | 2e-05 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 1e-08 | |
| d2vj3a3 | 35 | g.3.11.1 (A:492-526) Neurogenic locus notch homolo | 1e-08 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 2e-08 | |
| d1g1ta2 | 39 | g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human | 4e-08 | |
| d1cvua2 | 41 | g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG | 2e-08 | |
| d1cvua2 | 41 | g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG | 9e-05 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 9e-08 | |
| d1g1sa2 | 40 | g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human | 9e-08 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 2e-07 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 3e-07 | |
| d1tpga1 | 41 | g.3.11.1 (A:51-91) Plasminogen activator (tissue-t | 1e-06 | |
| d1tpga1 | 41 | g.3.11.1 (A:51-91) Plasminogen activator (tissue-t | 4e-06 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 3e-06 | |
| d1autl1 | 48 | g.3.11.1 (L:49-96) Activated protein c (autoprothr | 9e-06 | |
| d1nqlb_ | 48 | g.3.11.1 (B:) Epidermal growth factor, EGF {Human | 6e-06 | |
| d1nqlb_ | 48 | g.3.11.1 (B:) Epidermal growth factor, EGF {Human | 1e-04 | |
| d3egfa_ | 53 | g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse | 8e-05 | |
| d3egfa_ | 53 | g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse | 1e-04 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 7e-04 | |
| d1ioxa_ | 50 | g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) | 0.003 |
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Neurogenic locus notch homolog protein 1, Notch1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 50.4 bits (121), Expect = 2e-10
Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
Query: 17 IDDCESGPCLNGGLCKDLLNNYTCNCQQTGYTGPHCEIN 55
+++C S PC N C D + + C C GY G HCE+N
Sbjct: 1 VNECVSNPCQNDATCLDQIGEFQCIC-MPGYEGVHCEVN 38
|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 141 | |||
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.91 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.89 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.89 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.87 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.74 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.73 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.72 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.71 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.71 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.69 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.56 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.54 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.5 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.43 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.41 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.41 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.37 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.37 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.32 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.29 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.28 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.23 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.22 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.0 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.99 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.95 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.84 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.84 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.81 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.8 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.79 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.75 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.7 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 97.65 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.65 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.61 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.61 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.6 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.4 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.39 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 97.38 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.38 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.36 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 97.31 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 97.28 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.26 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 97.15 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.07 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.05 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 96.97 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 96.96 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 96.93 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 96.89 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 96.65 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 96.5 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 96.15 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 95.53 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 94.7 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 94.58 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 94.24 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 94.18 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 93.85 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.45 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 90.41 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 87.7 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 87.4 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 86.71 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 83.28 |
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Factor IX (IXa) species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.91 E-value=1.3e-09 Score=50.49 Aligned_cols=37 Identities=57% Similarity=1.264 Sum_probs=31.5
Q ss_pred ccCCCCCCCCCCCCEEeecCCceeEecCCCCccCCCCC
Q psy9687 16 NIDDCESGPCLNGGLCKDLLNNYTCNCQQTGYTGPHCE 53 (141)
Q Consensus 16 ~~~~c~~~~c~~~~~C~~~~g~~~c~c~~~g~~g~~c~ 53 (141)
++|+|.++||.+++.|.+..+.|.|.|. .||.|++|+
T Consensus 2 d~d~C~~~PC~ngg~C~~~~~~y~C~C~-~g~~G~~Ce 38 (39)
T d1edmb_ 2 DGDQCESNPCLNGGSCKDDINSYECWCP-FGFEGKNCE 38 (39)
T ss_dssp CCCTTTTCCCCTTCEEEEETTEEEEECC-TTCCSTTSC
T ss_pred ccccCCCCCCCCCcEEEcCCCCEEEECC-CCCCCCCCC
Confidence 6788888899999999888888999998 489888884
|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|