Psyllid ID: psy9698


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MYILKQGKIPPNVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPPHFPQCDNFQPAVTKQDWAAAKNLEKT
cEEEEccccccccccccHHHHHHHccccccccccccccccccccEEEEccccEEEEEEEccccEEEEEEEcccHHHHcccEEEEEEccccccccccccccccccccccccHHHHHHHHccccc
cEEEEccccccccccEEEEccccccccccccccHcccccccEEcEEEEcccEEEEEEEEccccEEEEEEEccHHHHHcccEEEEEEcHHHccccccccccccccccccccccccccccHcccc
myilkqgkippnvdkgLFLSQLIRQLDqegprlrttqprpivkdtvgnlpsgyTVVRVHfnnpgmwyfHCHFVMHTDTGMTLVFQvgdrkqfvrapphfpqcdnfqpavtKQDWAAAKNLEKT
myilkqgkippnvdKGLFLSQLIRQLDqegprlrttqprpivkdtvgnlpsGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPPHFPQCDNFQPAVTKQDWAAAKNLEKT
MYILKQGKIPPNVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPPHFPQCDNFQPAVTKQDWAAAKNLEKT
*************DKGLFLSQLIRQ***************IVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPPHFPQCDNFQPAV**************
MYILKQGKIPPNVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPPHFPQCDNFQPAVTKQDW*********
MYILKQGKIPPNVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPPHFPQCDNFQPAVTKQDWAAAKNLEKT
MYILKQGKIPPNVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPPHFPQCDNFQPAVT*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYILKQGKIPPNVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPPHFPQCDNFQPAVTKQDWAAAKNLEKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
Q0IQU1564 Laccase-22 OS=Oryza sativ yes N/A 0.512 0.111 0.373 2e-08
P43561622 Iron transport multicoppe yes N/A 0.373 0.073 0.521 5e-08
Q9FY79569 Laccase-14 OS=Arabidopsis yes N/A 0.634 0.137 0.378 1e-07
Q6Z8L2579 Putative laccase-9 OS=Ory no N/A 0.512 0.108 0.417 1e-07
Q6ID18558 Laccase-10 OS=Arabidopsis no N/A 0.512 0.112 0.373 1e-07
Q5N7B4559 Laccase-7 OS=Oryza sativa no N/A 0.512 0.112 0.373 4e-07
Q1PDH6566 Laccase-16 OS=Arabidopsis no N/A 0.512 0.111 0.343 6e-07
O80434558 Laccase-4 OS=Arabidopsis no N/A 0.512 0.112 0.358 6e-07
Q9LFD1586 Laccase-9 OS=Arabidopsis no N/A 0.512 0.107 0.402 6e-07
Q7XE50467 Putative laccase-16 OS=Or no N/A 0.512 0.134 0.388 7e-07
>sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 Back     alignment and function desciption
 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 4/67 (5%)

Query: 40  PIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQ----FVRA 95
           PI ++T+G    G+T +R   +NPG+W+ HCHF +HT  G+ + F V + K+     +  
Sbjct: 498 PIERNTIGVPTGGWTAIRFRSDNPGVWFMHCHFEVHTSWGLKMAFVVDNGKRPSETLIPP 557

Query: 96  PPHFPQC 102
           P   PQC
Sbjct: 558 PKDLPQC 564




Lignin degradation and detoxification of lignin-derived products.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 1EC: .EC: 1EC: 0EC: .EC: 3EC: .EC: 2
>sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 Back     alignment and function description
>sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 Back     alignment and function description
>sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 Back     alignment and function description
>sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 Back     alignment and function description
>sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 Back     alignment and function description
>sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 Back     alignment and function description
>sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 Back     alignment and function description
>sp|Q7XE50|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
345497033 663 PREDICTED: L-ascorbate oxidase-like [Nas 0.796 0.147 0.45 2e-18
239787110 624 venom laccase precursor [Nasonia vitripe 0.739 0.145 0.423 2e-17
156540616 677 PREDICTED: laccase-like [Nasonia vitripe 0.756 0.137 0.473 3e-17
380011697 729 PREDICTED: LOW QUALITY PROTEIN: laccase- 0.682 0.115 0.482 1e-16
170053960 984 multicopper oxidase [Culex quinquefascia 0.739 0.092 0.445 2e-16
170073770 271 multicopper oxidase [Culex quinquefascia 0.739 0.335 0.445 2e-16
157116980 929 multicopper oxidase [Aedes aegypti] gi|1 0.869 0.115 0.379 3e-16
328790075 727 PREDICTED: laccase-1-like [Apis mellifer 0.682 0.115 0.470 3e-16
345497358 743 PREDICTED: laccase-2-like [Nasonia vitri 0.804 0.133 0.39 6e-16
350399770 727 PREDICTED: laccase-1-like [Bombus impati 0.886 0.149 0.423 7e-16
>gi|345497033|ref|XP_001600222.2| PREDICTED: L-ascorbate oxidase-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score = 96.3 bits (238), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 2/100 (2%)

Query: 12  NVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCH 71
           N+D G+     I++LD+EG   R     P+ KDT+ +   GYT+VR++ NNPG W+FHCH
Sbjct: 566 NLD-GVVTVDRIKKLDKEGKVKRRLHRAPL-KDTIKSPGGGYTIVRLYANNPGYWFFHCH 623

Query: 72  FVMHTDTGMTLVFQVGDRKQFVRAPPHFPQCDNFQPAVTK 111
           F  HT+ GM L+F+VG+ K F + P  FP+C  F P   K
Sbjct: 624 FEQHTNVGMALIFKVGEHKDFAKIPKDFPKCGGFTPITMK 663




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|239787110|ref|NP_001155158.1| venom laccase precursor [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156540616|ref|XP_001603789.1| PREDICTED: laccase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380011697|ref|XP_003689934.1| PREDICTED: LOW QUALITY PROTEIN: laccase-1-like [Apis florea] Back     alignment and taxonomy information
>gi|170053960|ref|XP_001862911.1| multicopper oxidase [Culex quinquefasciatus] gi|167874381|gb|EDS37764.1| multicopper oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170073770|ref|XP_001870433.1| multicopper oxidase [Culex quinquefasciatus] gi|167870425|gb|EDS33808.1| multicopper oxidase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157116980|ref|XP_001652917.1| multicopper oxidase [Aedes aegypti] gi|108876239|gb|EAT40464.1| AAEL007802-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|328790075|ref|XP_001120790.2| PREDICTED: laccase-1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|345497358|ref|XP_001603034.2| PREDICTED: laccase-2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350399770|ref|XP_003485633.1| PREDICTED: laccase-1-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
FB|FBgn0259247784 laccase2 "laccase 2" [Drosophi 0.861 0.135 0.388 7.9e-16
FB|FBgn0032116959 Mco1 "Multicopper oxidase-1" [ 0.829 0.106 0.398 8.3e-16
SGD|S000001853622 FET5 "Multicopper oxidase" [Sa 0.455 0.090 0.464 1.4e-09
FB|FBgn0052557645 CG32557 [Drosophila melanogast 0.585 0.111 0.386 1.6e-09
FB|FBgn0039387677 MCO3 "multicopper oxidase 3" [ 0.585 0.106 0.402 5.9e-09
TAIR|locus:2182895569 LAC13 "laccase 13" [Arabidopsi 0.512 0.110 0.402 7.6e-09
TAIR|locus:2150139558 LAC10 "laccase 10" [Arabidopsi 0.504 0.111 0.397 1.5e-08
TAIR|locus:2184802569 LAC14 "laccase 14" [Arabidopsi 0.617 0.133 0.387 3.3e-08
TAIR|locus:2042842558 IRX12 "IRREGULAR XYLEM 12" [Ar 0.504 0.111 0.382 4.1e-08
TAIR|locus:2135242582 AT4G39830 [Arabidopsis thalian 0.487 0.103 0.426 7.1e-08
FB|FBgn0259247 laccase2 "laccase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 209 (78.6 bits), Expect = 7.9e-16, P = 7.9e-16
 Identities = 42/108 (38%), Positives = 58/108 (53%)

Query:     2 YILKQGKIPPNVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFN 61
             Y+L  G+ P    + + L   + +LDQ G  L     +P +KDTV    +GY ++R   +
Sbjct:   676 YVLGLGRSPDKQIQRMNLKHAL-ELDQRG-LLERQYLKPSLKDTVAVPNNGYAILRFRAD 733

Query:    62 NPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPPHFPQCDNFQPAV 109
             NPG W FHCHF  H   GM LVFQ+G        PP+FP+C N  P +
Sbjct:   734 NPGFWLFHCHFQYHIVIGMNLVFQIGTPNDLPPVPPNFPRCGNHLPPI 781




GO:0052716 "hydroquinone:oxygen oxidoreductase activity" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005507 "copper ion binding" evidence=IEA
GO:0040003 "chitin-based cuticle development" evidence=IMP
FB|FBgn0032116 Mco1 "Multicopper oxidase-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
SGD|S000001853 FET5 "Multicopper oxidase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
FB|FBgn0052557 CG32557 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039387 MCO3 "multicopper oxidase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2182895 LAC13 "laccase 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150139 LAC10 "laccase 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184802 LAC14 "laccase 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042842 IRX12 "IRREGULAR XYLEM 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135242 AT4G39830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
pfam07731135 pfam07731, Cu-oxidase_2, Multicopper oxidase 3e-14
TIGR03389539 TIGR03389, laccase, laccase, plant 3e-10
PLN02604566 PLN02604, PLN02604, oxidoreductase 8e-10
TIGR03388541 TIGR03388, ascorbase, L-ascorbate oxidase, plant t 3e-09
COG2132451 COG2132, SufI, Putative multicopper oxidases [Seco 2e-08
PLN02191574 PLN02191, PLN02191, L-ascorbate oxidase 4e-08
TIGR03390538 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu 2e-07
PRK10965523 PRK10965, PRK10965, multicopper oxidase; Provision 6e-05
TIGR01480587 TIGR01480, copper_res_A, copper-resistance protein 2e-04
>gnl|CDD|219541 pfam07731, Cu-oxidase_2, Multicopper oxidase Back     alignment and domain information
 Score = 64.0 bits (156), Expect = 3e-14
 Identities = 21/49 (42%), Positives = 27/49 (55%)

Query: 40  PIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGD 88
           P+ +DTV   P G+  +R   +NPG W FHCH + H D GM   F V  
Sbjct: 85  PVRRDTVQVPPGGWVAIRFKADNPGPWLFHCHILWHLDQGMMGQFVVDP 133


This entry contains many divergent copper oxidase-like domains that are not recognised by the pfam00394 model. Length = 135

>gnl|CDD|234194 TIGR03389, laccase, laccase, plant Back     alignment and domain information
>gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase Back     alignment and domain information
>gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type Back     alignment and domain information
>gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase Back     alignment and domain information
>gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type Back     alignment and domain information
>gnl|CDD|236810 PRK10965, PRK10965, multicopper oxidase; Provisional Back     alignment and domain information
>gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
PLN02835539 oxidoreductase 99.91
TIGR03388541 ascorbase L-ascorbate oxidase, plant type. Members 99.91
TIGR03389539 laccase laccase, plant. Members of this protein fa 99.91
PLN02604566 oxidoreductase 99.9
PLN02191574 L-ascorbate oxidase 99.9
PLN02792536 oxidoreductase 99.89
PLN02991543 oxidoreductase 99.89
PLN02168545 copper ion binding / pectinesterase 99.88
PLN02354552 copper ion binding / oxidoreductase 99.88
PLN00044596 multi-copper oxidase-related protein; Provisional 99.88
KOG1263|consensus563 99.87
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 99.81
TIGR03390538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 99.79
TIGR01480587 copper_res_A copper-resistance protein, CopA famil 99.3
PRK10883471 FtsI repressor; Provisional 99.28
PRK10965523 multicopper oxidase; Provisional 99.26
COG2132451 SufI Putative multicopper oxidases [Secondary meta 99.24
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 98.63
PLN02604 566 oxidoreductase 98.03
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 97.94
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 97.48
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 97.37
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 97.27
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 97.24
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 96.82
PLN02191 574 L-ascorbate oxidase 96.66
COG4454158 Uncharacterized copper-binding protein [Inorganic 96.34
TIGR01480 587 copper_res_A copper-resistance protein, CopA famil 96.14
PLN02168 545 copper ion binding / pectinesterase 95.49
TIGR03389 539 laccase laccase, plant. Members of this protein fa 95.45
PLN02354 552 copper ion binding / oxidoreductase 95.38
PLN02835 539 oxidoreductase 95.32
KOG1263|consensus 563 95.32
PLN00044 596 multi-copper oxidase-related protein; Provisional 94.87
PRK02710119 plastocyanin; Provisional 94.78
PLN02792 536 oxidoreductase 94.58
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 94.45
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 94.32
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 94.21
PRK10965 523 multicopper oxidase; Provisional 94.07
PRK02888635 nitrous-oxide reductase; Validated 93.93
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 93.91
PLN02991 543 oxidoreductase 93.56
PRK10883 471 FtsI repressor; Provisional 93.52
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 91.84
TIGR03390 538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 90.92
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 85.03
TIGR0265783 amicyanin amicyanin. Members of this family are am 83.59
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 80.93
COG3794128 PetE Plastocyanin [Energy production and conversio 80.1
>PLN02835 oxidoreductase Back     alignment and domain information
Probab=99.91  E-value=7.7e-25  Score=187.49  Aligned_cols=90  Identities=16%  Similarity=0.263  Sum_probs=77.6

Q ss_pred             CEEEeecCCCCCCCcccccHHHHHHhccCCCccccCCCCCceeeeEEeCCCCEEEEEEEecCCceEEEeecCccccccCc
Q psy9698           1 MYILKQGKIPPNVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGM   80 (123)
Q Consensus         1 f~vlg~g~~~~~~~~~~~~~~e~~~~~~~g~~~~~n~~~p~~rDTv~v~pg~~~~irf~adnpG~Wl~HCHi~~H~~~GM   80 (123)
                      |||||+|. ++|..           ..    ...+|+.||++|||+.|++++|++|||+|||||.|+||||+.+|+..||
T Consensus       442 F~Vlg~G~-g~~~~-----------~~----~~~~nl~nP~~RDTv~vp~~gw~~IrF~aDNPG~Wl~HCHi~~H~~~Gm  505 (539)
T PLN02835        442 FWVVGYGS-GQWTP-----------AK----RSLYNLVDALTRHTAQVYPKSWTTILVSLDNQGMWNMRSAIWERQYLGQ  505 (539)
T ss_pred             EEEEeccC-CCCCc-----------cc----ccccCCCCCCccceEEeCCCCEEEEEEECcCCEEeeeeecchhhhhccc
Confidence            89999997 44431           11    1146899999999999999999999999999999999999999999999


Q ss_pred             eEEEEeecc----CccCCCCCCCCCCccCC
Q psy9698          81 TLVFQVGDR----KQFVRAPPHFPQCDNFQ  106 (123)
Q Consensus        81 ~~~~~V~~~----~~~~~~p~~~~~C~~~~  106 (123)
                      +++|+|++.    ++++++|++++.||..+
T Consensus       506 ~~~~~V~~~~~~~~~~~~~P~~~~~Cg~~~  535 (539)
T PLN02835        506 QFYLRVWNQVHSLANEYDIPDNALLCGKAI  535 (539)
T ss_pred             EEEEEEccCCCccccccCCCccccccccCc
Confidence            999999754    68889999999998654



>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>KOG1263|consensus Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
1aoz_A552 Refined Crystal Structure Of Ascorbate Oxidase At 1 5e-07
2hzh_A499 Crystal Structure Of Laccase From Coriolus Zonatus 6e-05
3t9w_A299 Small Laccase From Amycolatopsis Sp. Atcc 39116 Len 9e-05
2xyb_A497 Crystal Structure Of A Fully Functional Laccase Fro 1e-04
3pps_A604 Crystal Structure Of An Ascomycete Fungal Laccase F 2e-04
3v9e_A580 Structure Of The L513m Mutant Of The Laccase From B 2e-04
1kya_A499 Active Laccase From Trametes Versicolor Complexed W 4e-04
3t6v_A495 Crystal Structure Of Laccase From Steccherinum Ochr 5e-04
1hfu_A503 Type-2 Cu-Depleted Laccase From Coprinus Cinereus A 5e-04
3sqr_A580 Crystal Structure Of Laccase From Botrytis Aclada A 6e-04
1gyc_A499 Crystal Structure Determination At Room Temperature 6e-04
3kw7_A502 Crystal Structure Of Lacb From Trametes Sp. Ah28-2 7e-04
1a65_A504 Type-2 Cu-depleted Laccase From Coprinus Cinereus L 9e-04
>pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 Back     alignment and structure

Iteration: 1

Score = 49.3 bits (116), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 22/52 (42%), Positives = 30/52 (57%) Query: 39 RPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRK 90 P +++TV P G+T +R +NPG+W FHCH H GM +VF G K Sbjct: 476 NPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVEK 527
>pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 Back     alignment and structure
>pdb|3T9W|A Chain A, Small Laccase From Amycolatopsis Sp. Atcc 39116 Length = 299 Back     alignment and structure
>pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 Back     alignment and structure
>pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 Back     alignment and structure
>pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 Back     alignment and structure
>pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 Back     alignment and structure
>pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 Back     alignment and structure
>pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 Back     alignment and structure
>pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 Back     alignment and structure
>pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 Back     alignment and structure
>pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 Back     alignment and structure
>pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 4e-18
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 1e-15
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 6e-15
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 7e-15
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 9e-15
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 2e-14
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 4e-14
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 1e-13
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 1e-13
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 2e-12
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 3e-11
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 2e-10
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 6e-10
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 6e-09
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 7e-09
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 2e-08
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 8e-09
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 1e-08
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 2e-07
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 1e-08
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 2e-08
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 2e-08
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 3e-08
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 3e-08
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 1e-06
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 2e-06
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 2e-05
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 9e-04
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 Back     alignment and structure
 Score = 77.7 bits (192), Expect = 4e-18
 Identities = 25/73 (34%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 40  PIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPPHF 99
           P +++TV   P G+T +R   +NPG+W FHCH   H   GM +VF  G  K   R P   
Sbjct: 477 PPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVEK-VGRIPTKA 535

Query: 100 PQCDNFQPAVTKQ 112
             C     ++   
Sbjct: 536 LACGGTAKSLINN 548


>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 99.9
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 99.84
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 99.83
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 99.82
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 99.81
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 99.8
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 99.79
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 99.78
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 99.71
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 99.71
3gyr_A612 PHS, phenoxazinone synthase; metalloprotein, lacca 99.7
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 99.6
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 99.56
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 99.55
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 99.54
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 99.53
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 99.43
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 99.4
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 99.39
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 99.38
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 99.35
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 99.33
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 99.33
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 99.3
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 99.25
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 99.16
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 99.1
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 99.04
2r7e_A742 Coagulation factor VIII; ceruloplasmin fold, cuppe 99.04
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 98.98
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 98.94
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 98.93
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 98.89
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.79
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 98.69
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 98.62
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 98.57
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 98.52
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 98.42
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.4
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 98.35
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 98.32
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.17
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 98.11
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 98.1
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.1
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 98.08
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.08
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 97.98
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 97.97
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 97.97
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 97.88
1byp_A99 Protein (plastocyanin); electron transfer, photosy 97.86
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 97.86
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 97.68
2cal_A154 Rusticyanin; iron respiratory electron transport c 97.66
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 97.63
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 97.61
3kw8_A 276 Laccase, putative copper oxidase; two-domain lacca 97.4
3g5w_A 318 Multicopper oxidase type 1; two domain, laccase, n 97.37
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 97.25
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 97.17
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 97.13
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 97.04
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 97.01
3t9w_A 299 Small laccase, multi-copper oxidase; two-domain co 96.98
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 96.98
3tas_A 313 Small laccase, multi-copper oxidase; two-domain la 96.96
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 96.93
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 96.91
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 96.91
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 96.91
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 96.88
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 96.82
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 96.81
3cg8_A 343 Laccase; oxidoreductase, multicopper blue protein; 96.77
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 96.76
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 96.76
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 96.74
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 96.69
1sdd_A 306 Coagulation factor V; copper-binding protein, cofa 96.64
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 96.29
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 96.15
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 96.1
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 96.1
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 96.09
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 96.06
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 96.02
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 95.92
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 95.82
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 95.52
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 95.39
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 95.3
3c75_A132 Amicyanin; copper proteins, electron transfer comp 95.25
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 95.17
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 94.98
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 94.64
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 94.56
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 94.23
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 93.58
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 93.16
3gyr_A 612 PHS, phenoxazinone synthase; metalloprotein, lacca 92.93
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 92.66
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 90.79
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
Probab=99.90  E-value=6.5e-25  Score=185.64  Aligned_cols=90  Identities=29%  Similarity=0.545  Sum_probs=78.2

Q ss_pred             CEEEeecCCCCCCCcccccHHHHHHhccCCCccccCCCCCceeeeEEeCCCCEEEEEEEecCCceEEEeecCccccccCc
Q psy9698           1 MYILKQGKIPPNVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGM   80 (123)
Q Consensus         1 f~vlg~g~~~~~~~~~~~~~~e~~~~~~~g~~~~~n~~~p~~rDTv~v~pg~~~~irf~adnpG~Wl~HCHi~~H~~~GM   80 (123)
                      |+||++|. +.|.     .      .+    ...+|+.+|++||||.|+|++|++|||++||||.|+||||+++|++.||
T Consensus       454 F~Vl~~g~-G~~~-----~------~~----~~~~n~~~p~~RDTv~vpp~g~v~Irf~aDNPG~W~~HCHi~~H~~~GM  517 (552)
T 1aoz_A          454 FWVLGYGD-GKFS-----A------EE----ESSLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGM  517 (552)
T ss_dssp             EEEEEEEE-SSCC-----G------GG----GGGSCCSSCCEESEEEECTTEEEEEEEECCSCEEEEEEESSHHHHHTTC
T ss_pred             eEEEeccc-CccC-----c------cc----ccccccCCCCccCeEEeCCCceEEEEEEcCCCeEEEEEeeehhHhhCCC
Confidence            79999986 3443     1      11    2258999999999999999999999999999999999999999999999


Q ss_pred             eEEEEeeccCccCCCCCCCCCCccCCC
Q psy9698          81 TLVFQVGDRKQFVRAPPHFPQCDNFQP  107 (123)
Q Consensus        81 ~~~~~V~~~~~~~~~p~~~~~C~~~~~  107 (123)
                      +++|.|+ +++++++|++++.|+.+++
T Consensus       518 ~~~~~~~-~~~~~~~P~~~~~C~~~~~  543 (552)
T 1aoz_A          518 GVVFAEG-VEKVGRIPTKALACGGTAK  543 (552)
T ss_dssp             EEEEEEC-GGGCCCCCHHHHSSHHHHH
T ss_pred             eEEEEeC-chhhccCCcchhhhhccCc
Confidence            9999997 4588899999999999863



>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 123
d1aoza3214 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (C 8e-15
d2q9oa3216 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyce 1e-13
d1gska3154 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Ba 1e-13
d1gyca3199 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, 7e-13
d1hfua3200 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Copr 2e-12
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 3e-10
d1v10a3190 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus 9e-10
d1kcwa2146 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap 9e-10
d2j5wa5149 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa 1e-09
d1kv7a3181 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Esc 8e-09
d2j5wa2145 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap 4e-08
d1sdda2116 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos 7e-07
d1qhqa_139 b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus 4e-05
d2bw4a2173 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcali 0.001
d1e30a_153 b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan 0.004
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 214 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Ascorbate oxidase
species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]
 Score = 65.3 bits (158), Expect = 8e-15
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 1/74 (1%)

Query: 38  PRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGMTLVFQVGDRKQFVRAPP 97
             P +++TV   P G+T +R   +NPG+W FHCH   H   GM +VF  G   +  R P 
Sbjct: 137 KNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAEGVE-KVGRIPT 195

Query: 98  HFPQCDNFQPAVTK 111
               C     ++  
Sbjct: 196 KALACGGTAKSLIN 209


>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 216 Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 154 Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 199 Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 200 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 190 Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 181 Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Length = 139 Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.91
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 99.89
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 99.86
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 99.84
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 99.82
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 99.8
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.58
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 99.45
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 99.41
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 99.33
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 99.1
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 99.0
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 98.95
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.93
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 98.81
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.79
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.78
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 98.72
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 98.72
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.66
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 98.3
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 98.29
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 98.2
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 98.03
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 97.94
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 97.77
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 97.7
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 97.58
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 97.54
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 97.28
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 97.08
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 96.71
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 96.66
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 96.49
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 96.35
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 96.34
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 96.33
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 96.28
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 96.06
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 95.99
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 95.9
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 95.9
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 95.9
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 95.84
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 95.81
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 95.81
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 95.76
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 95.51
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 95.5
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 95.41
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 95.08
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 93.87
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 93.73
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 90.32
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Multidomain cupredoxins
domain: Ascorbate oxidase
species: Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]
Probab=99.91  E-value=6.9e-26  Score=171.55  Aligned_cols=89  Identities=29%  Similarity=0.556  Sum_probs=77.8

Q ss_pred             CEEEeecCCCCCCCcccccHHHHHHhccCCCccccCCCCCceeeeEEeCCCCEEEEEEEecCCceEEEeecCccccccCc
Q psy9698           1 MYILKQGKIPPNVDKGLFLSQLIRQLDQEGPRLRTTQPRPIVKDTVGNLPSGYTVVRVHFNNPGMWYFHCHFVMHTDTGM   80 (123)
Q Consensus         1 f~vlg~g~~~~~~~~~~~~~~e~~~~~~~g~~~~~n~~~p~~rDTv~v~pg~~~~irf~adnpG~Wl~HCHi~~H~~~GM   80 (123)
                      |||||+|. +++..           .+    ...+|+.+|.+|||+.|++++|++|||++||||.|+||||+++|++.||
T Consensus       116 F~vl~~~~-g~~~~-----------~~----~~~~n~~~p~~rDTv~v~~g~~~~ir~~adnpG~w~~HCH~~~H~~~GM  179 (214)
T d1aoza3         116 FWVLGYGD-GKFSA-----------EE----ESSLNLKNPPLRNTVVIFPYGWTAIRFVADNPGVWAFHCHIEPHLHMGM  179 (214)
T ss_dssp             EEEEEEEE-SSCCG-----------GG----GGGSCCSSCCEESEEEECTTEEEEEEEECCSCEEEEEEESSHHHHHTTC
T ss_pred             eEEeccCC-Ccccc-----------cc----cccccccCCceecCcccCCCceEEEEEecCCCeeEEEEECcHHHHhCcC
Confidence            79999987 34431           11    1257899999999999999999999999999999999999999999999


Q ss_pred             eEEEEeeccCccCCCCCCCCCCccCC
Q psy9698          81 TLVFQVGDRKQFVRAPPHFPQCDNFQ  106 (123)
Q Consensus        81 ~~~~~V~~~~~~~~~p~~~~~C~~~~  106 (123)
                      +++|.|+ .++++++|+++++||.+.
T Consensus       180 ~~~~~v~-~~~~~~~P~~~~~cg~~~  204 (214)
T d1aoza3         180 GVVFAEG-VEKVGRIPTKALACGGTA  204 (214)
T ss_dssp             EEEEEEC-GGGCCCCCHHHHSSHHHH
T ss_pred             cEEEEEc-cccccCCCccccccccch
Confidence            9999997 567888999999999885



>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure